NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
468647 2a63 6771 cing 4-filtered-FRED STAR entry full 765


data_FRED_restraints_with_modified_coordinates_PDB_code_2a63

# This FRED archive file contains, for PDB entry <2a63>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2a63
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2a63
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        7416.43

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Regulatory_protein_cro A . 1 1 
    stop_

save_


save_Regulatory_protein_cro
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Regulatory protein cro"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MEQRITLKDYAMRFGQTKTAKDLGVQQSAINKWIHAGRKIFLTINADGSVYAEEVKPDPSNKKTTA
    _Entity.Number_of_monomers           66

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 MET . 1 1 
        2 GLU . 1 1 
        3 GLN . 1 1 
        4 ARG . 1 1 
        5 ILE . 1 1 
        6 THR . 1 1 
        7 LEU . 1 1 
        8 LYS . 1 1 
        9 ASP . 1 1 
       10 TYR . 1 1 
       11 ALA . 1 1 
       12 MET . 1 1 
       13 ARG . 1 1 
       14 PHE . 1 1 
       15 GLY . 1 1 
       16 GLN . 1 1 
       17 THR . 1 1 
       18 LYS . 1 1 
       19 THR . 1 1 
       20 ALA . 1 1 
       21 LYS . 1 1 
       22 ASP . 1 1 
       23 LEU . 1 1 
       24 GLY . 1 1 
       25 VAL . 1 1 
       26 GLN . 1 1 
       27 GLN . 1 1 
       28 SER . 1 1 
       29 ALA . 1 1 
       30 ILE . 1 1 
       31 ASN . 1 1 
       32 LYS . 1 1 
       33 TRP . 1 1 
       34 ILE . 1 1 
       35 HIS . 1 1 
       36 ALA . 1 1 
       37 GLY . 1 1 
       38 ARG . 1 1 
       39 LYS . 1 1 
       40 ILE . 1 1 
       41 PHE . 1 1 
       42 LEU . 1 1 
       43 THR . 1 1 
       44 ILE . 1 1 
       45 ASN . 1 1 
       46 ALA . 1 1 
       47 ASP . 1 1 
       48 GLY . 1 1 
       49 SER . 1 1 
       50 VAL . 1 1 
       51 TYR . 1 1 
       52 ALA . 1 1 
       53 GLU . 1 1 
       54 GLU . 1 1 
       55 VAL . 1 1 
       56 LYS . 1 1 
       57 PRO . 1 1 
       58 ASP . 1 1 
       59 PRO . 1 1 
       60 SER . 1 1 
       61 ASN . 1 1 
       62 LYS . 1 1 
       63 LYS . 1 1 
       64 THR . 1 1 
       65 THR . 1 1 
       66 ALA . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET  1  1 1 1 
       GLU  2  2 1 1 
       GLN  3  3 1 1 
       ARG  4  4 1 1 
       ILE  5  5 1 1 
       THR  6  6 1 1 
       LEU  7  7 1 1 
       LYS  8  8 1 1 
       ASP  9  9 1 1 
       TYR 10 10 1 1 
       ALA 11 11 1 1 
       MET 12 12 1 1 
       ARG 13 13 1 1 
       PHE 14 14 1 1 
       GLY 15 15 1 1 
       GLN 16 16 1 1 
       THR 17 17 1 1 
       LYS 18 18 1 1 
       THR 19 19 1 1 
       ALA 20 20 1 1 
       LYS 21 21 1 1 
       ASP 22 22 1 1 
       LEU 23 23 1 1 
       GLY 24 24 1 1 
       VAL 25 25 1 1 
       GLN 26 26 1 1 
       GLN 27 27 1 1 
       SER 28 28 1 1 
       ALA 29 29 1 1 
       ILE 30 30 1 1 
       ASN 31 31 1 1 
       LYS 32 32 1 1 
       TRP 33 33 1 1 
       ILE 34 34 1 1 
       HIS 35 35 1 1 
       ALA 36 36 1 1 
       GLY 37 37 1 1 
       ARG 38 38 1 1 
       LYS 39 39 1 1 
       ILE 40 40 1 1 
       PHE 41 41 1 1 
       LEU 42 42 1 1 
       THR 43 43 1 1 
       ILE 44 44 1 1 
       ASN 45 45 1 1 
       ALA 46 46 1 1 
       ASP 47 47 1 1 
       GLY 48 48 1 1 
       SER 49 49 1 1 
       VAL 50 50 1 1 
       TYR 51 51 1 1 
       ALA 52 52 1 1 
       GLU 53 53 1 1 
       GLU 54 54 1 1 
       VAL 55 55 1 1 
       LYS 56 56 1 1 
       PRO 57 57 1 1 
       ASP 58 58 1 1 
       PRO 59 59 1 1 
       SER 60 60 1 1 
       ASN 61 61 1 1 
       LYS 62 62 1 1 
       LYS 63 63 1 1 
       THR 64 64 1 1 
       THR 65 65 1 1 
       ALA 66 66 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
       491 1 . . . 1 1 
       492 1 . . . 1 1 
       493 1 . . . 1 1 
       494 1 . . . 1 1 
       495 1 . . . 1 1 
       496 1 . . . 1 1 
       497 1 . . . 1 1 
       498 1 . . . 1 1 
       499 1 . . . 1 1 
       500 1 . . . 1 1 
       501 1 . . . 1 1 
       502 1 . . . 1 1 
       503 1 . . . 1 1 
       504 1 . . . 1 1 
       505 1 . . . 1 1 
       506 1 . . . 1 1 
       507 1 . . . 1 1 
       508 1 . . . 1 1 
       509 1 . . . 1 1 
       510 1 . . . 1 1 
       511 1 . . . 1 1 
       512 1 . . . 1 1 
       513 1 . . . 1 1 
       514 1 . . . 1 1 
       515 1 . . . 1 1 
       516 1 . . . 1 1 
       517 1 . . . 1 1 
       518 1 . . . 1 1 
       519 1 . . . 1 1 
       520 1 . . . 1 1 
       521 1 . . . 1 1 
       522 1 . . . 1 1 
       523 1 . . . 1 1 
       524 1 . . . 1 1 
       525 1 . . . 1 1 
       526 1 . . . 1 1 
       527 1 . . . 1 1 
       528 1 . . . 1 1 
       529 1 . . . 1 1 
       530 1 . . . 1 1 
       531 1 . . . 1 1 
       532 1 . . . 1 1 
       533 1 . . . 1 1 
       534 1 . . . 1 1 
       535 1 . . . 1 1 
       536 1 . . . 1 1 
       537 1 . . . 1 1 
       538 1 . . . 1 1 
       539 1 . . . 1 1 
       540 1 . . . 1 1 
       541 1 . . . 1 1 
       542 1 . . . 1 1 
       543 1 . . . 1 1 
       544 1 . . . 1 1 
       545 1 . . . 1 1 
       546 1 . . . 1 1 
       547 1 . . . 1 1 
       548 1 . . . 1 1 
       549 1 . . . 1 1 
       550 1 . . . 1 1 
       551 1 . . . 1 1 
       552 1 . . . 1 1 
       553 1 . . . 1 1 
       554 1 . . . 1 1 
       555 1 . . . 1 1 
       556 1 . . . 1 1 
       557 1 . . . 1 1 
       558 1 . . . 1 1 
       559 1 . . . 1 1 
       560 1 . . . 1 1 
       561 1 . . . 1 1 
       562 1 . . . 1 1 
       563 1 . . . 1 1 
       564 1 . . . 1 1 
       565 1 . . . 1 1 
       566 1 . . . 1 1 
       567 1 . . . 1 1 
       568 1 . . . 1 1 
       569 1 . . . 1 1 
       570 1 . . . 1 1 
       571 1 . . . 1 1 
       572 1 . . . 1 1 
       573 1 . . . 1 1 
       574 1 . . . 1 1 
       575 1 . . . 1 1 
       576 1 . . . 1 1 
       577 1 . . . 1 1 
       578 1 . . . 1 1 
       579 1 . . . 1 1 
       580 1 . . . 1 1 
       581 1 . . . 1 1 
       582 1 . . . 1 1 
       583 1 . . . 1 1 
       584 1 . . . 1 1 
       585 1 . . . 1 1 
       586 1 . . . 1 1 
       587 1 . . . 1 1 
       588 1 . . . 1 1 
       589 1 . . . 1 1 
       590 1 . . . 1 1 
       591 1 . . . 1 1 
       592 1 . . . 1 1 
       593 1 . . . 1 1 
       594 1 . . . 1 1 
       595 1 . . . 1 1 
       596 1 . . . 1 1 
       597 1 . . . 1 1 
       598 1 . . . 1 1 
       599 1 . . . 1 1 
       600 1 . . . 1 1 
       601 1 . . . 1 1 
       602 1 . . . 1 1 
       603 1 . . . 1 1 
       604 1 . . . 1 1 
       605 1 . . . 1 1 
       606 1 . . . 1 1 
       607 1 . . . 1 1 
       608 1 . . . 1 1 
       609 1 . . . 1 1 
       610 1 . . . 1 1 
       611 1 . . . 1 1 
       612 1 . . . 1 1 
       613 1 . . . 1 1 
       614 1 . . . 1 1 
       615 1 . . . 1 1 
       616 1 . . . 1 1 
       617 1 . . . 1 1 
       618 1 . . . 1 1 
       619 1 . . . 1 1 
       620 1 . . . 1 1 
       621 1 . . . 1 1 
       622 1 . . . 1 1 
       623 1 . . . 1 1 
       624 1 . . . 1 1 
       625 1 . . . 1 1 
       626 1 . . . 1 1 
       627 1 . . . 1 1 
       628 1 . . . 1 1 
       629 1 . . . 1 1 
       630 1 . . . 1 1 
       631 1 . . . 1 1 
       632 1 . . . 1 1 
       633 1 . . . 1 1 
       634 1 . . . 1 1 
       635 1 . . . 1 1 
       636 1 . . . 1 1 
       637 1 . . . 1 1 
       638 1 . . . 1 1 
       639 1 . . . 1 1 
       640 1 . . . 1 1 
       641 1 . . . 1 1 
       642 1 . . . 1 1 
       643 1 . . . 1 1 
       644 1 . . . 1 1 
       645 1 . . . 1 1 
       646 1 . . . 1 1 
       647 1 . . . 1 1 
       648 1 . . . 1 1 
       649 1 . . . 1 1 
       650 1 . . . 1 1 
       651 1 . . . 1 1 
       652 1 . . . 1 1 
       653 1 . . . 1 1 
       654 1 . . . 1 1 
       655 1 . . . 1 1 
       656 1 . . . 1 1 
       657 1 . . . 1 1 
       658 1 . . . 1 1 
       659 1 . . . 1 1 
       660 1 . . . 1 1 
       661 1 . . . 1 1 
       662 1 . . . 1 1 
       663 1 . . . 1 1 
       664 1 . . . 1 1 
       665 1 . . . 1 1 
       666 1 . . . 1 1 
       667 1 . . . 1 1 
       668 1 . . . 1 1 
       669 1 . . . 1 1 
       670 1 . . . 1 1 
       671 1 . . . 1 1 
       672 1 . . . 1 1 
       673 1 . . . 1 1 
       674 1 . . . 1 1 
       675 1 . . . 1 1 
       676 1 . . . 1 1 
       677 1 . . . 1 1 
       678 1 . . . 1 1 
       679 1 . . . 1 1 
       680 1 . . . 1 1 
       681 1 . . . 1 1 
       682 1 . . . 1 1 
       683 1 . . . 1 1 
       684 1 . . . 1 1 
       685 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1  1 MET QG   .  1 . HG#  1 1 
         1 1 2 1 1  2 GLU H    .  2 . HN   1 1 
         2 1 1 1 1  1 MET HA   .  1 . HA   1 1 
         2 1 2 1 1  2 GLU H    .  2 . HN   1 1 
         3 1 1 1 1  2 GLU H    .  2 . HN   1 1 
         3 1 2 1 1  2 GLU QG   .  2 . HG#  1 1 
         4 1 1 1 1  2 GLU HA   .  2 . HA   1 1 
         4 1 2 1 1  2 GLU QB   .  2 . HB#  1 1 
         5 1 1 1 1  2 GLU QG   .  2 . HG#  1 1 
         5 1 2 1 1  3 GLN H    .  3 . HN   1 1 
         6 1 1 1 1  2 GLU QB   .  2 . HB#  1 1 
         6 1 2 1 1  3 GLN H    .  3 . HN   1 1 
         7 1 1 1 1  2 GLU HA   .  2 . HA   1 1 
         7 1 2 1 1  3 GLN H    .  3 . HN   1 1 
         8 1 1 1 1  2 GLU QG   .  2 . HG#  1 1 
         8 1 2 1 1  4 ARG H    .  4 . HN   1 1 
         9 1 1 1 1  2 GLU QG   .  2 . HG#  1 1 
         9 1 2 1 1 43 THR MG   . 43 . HG2# 1 1 
        10 1 1 1 1  3 GLN H    .  3 . HN   1 1 
        10 1 2 1 1  3 GLN QG   .  3 . HG#  1 1 
        11 1 1 1 1  3 GLN H    .  3 . HN   1 1 
        11 1 2 1 1  3 GLN HB2  .  3 . HB2  1 1 
        12 1 1 1 1  3 GLN H    .  3 . HN   1 1 
        12 1 2 1 1  3 GLN HB3  .  3 . HB1  1 1 
        13 1 1 1 1  3 GLN HA   .  3 . HA   1 1 
        13 1 2 1 1  3 GLN HG3  .  3 . HG1  1 1 
        14 1 1 1 1  3 GLN HA   .  3 . HA   1 1 
        14 1 2 1 1  3 GLN QB   .  3 . HB#  1 1 
        15 1 1 1 1  3 GLN HA   .  3 . HA   1 1 
        15 1 2 1 1  3 GLN HG2  .  3 . HG2  1 1 
        16 1 1 1 1  3 GLN H    .  3 . HN   1 1 
        16 1 2 1 1  4 ARG H    .  4 . HN   1 1 
        17 1 1 1 1  3 GLN HA   .  3 . HA   1 1 
        17 1 2 1 1  4 ARG H    .  4 . HN   1 1 
        18 1 1 1 1  3 GLN HB3  .  3 . HB1  1 1 
        18 1 2 1 1  4 ARG H    .  4 . HN   1 1 
        19 1 1 1 1  3 GLN HB2  .  3 . HB2  1 1 
        19 1 2 1 1  4 ARG H    .  4 . HN   1 1 
        20 1 1 1 1  3 GLN HA   .  3 . HA   1 1 
        20 1 2 1 1 43 THR MG   . 43 . HG2# 1 1 
        21 1 1 1 1  3 GLN HG3  .  3 . HG1  1 1 
        21 1 2 1 1 43 THR MG   . 43 . HG2# 1 1 
        22 1 1 1 1  3 GLN HG2  .  3 . HG2  1 1 
        22 1 2 1 1 43 THR MG   . 43 . HG2# 1 1 
        23 1 1 1 1  3 GLN H    .  3 . HN   1 1 
        23 1 2 1 1 43 THR MG   . 43 . HG2# 1 1 
        24 1 1 1 1  3 GLN QB   .  3 . HB#  1 1 
        24 1 2 1 1 44 ILE MD   . 44 . HD1# 1 1 
        25 1 1 1 1  4 ARG H    .  4 . HN   1 1 
        25 1 2 1 1  4 ARG QB   .  4 . HB#  1 1 
        26 1 1 1 1  4 ARG H    .  4 . HN   1 1 
        26 1 2 1 1  4 ARG QG   .  4 . HG#  1 1 
        27 1 1 1 1  4 ARG QB   .  4 . HB#  1 1 
        27 1 2 1 1  4 ARG HE   .  4 . HE   1 1 
        28 1 1 1 1  4 ARG H    .  4 . HN   1 1 
        28 1 2 1 1  4 ARG QD   .  4 . HD#  1 1 
        29 1 1 1 1  4 ARG HA   .  4 . HA   1 1 
        29 1 2 1 1  4 ARG QG   .  4 . HG#  1 1 
        30 1 1 1 1  4 ARG H    .  4 . HN   1 1 
        30 1 2 1 1  5 ILE H    .  5 . HN   1 1 
        31 1 1 1 1  4 ARG HA   .  4 . HA   1 1 
        31 1 2 1 1  5 ILE H    .  5 . HN   1 1 
        32 1 1 1 1  4 ARG HB3  .  4 . HB1  1 1 
        32 1 2 1 1  5 ILE H    .  5 . HN   1 1 
        33 1 1 1 1  4 ARG HB2  .  4 . HB2  1 1 
        33 1 2 1 1  5 ILE H    .  5 . HN   1 1 
        34 1 1 1 1  4 ARG QG   .  4 . HG#  1 1 
        34 1 2 1 1  5 ILE H    .  5 . HN   1 1 
        35 1 1 1 1  4 ARG HA   .  4 . HA   1 1 
        35 1 2 1 1  5 ILE HB   .  5 . HB   1 1 
        36 1 1 1 1  4 ARG HA   .  4 . HA   1 1 
        36 1 2 1 1 41 PHE QB   . 41 . HB#  1 1 
        37 1 1 1 1  4 ARG H    .  4 . HN   1 1 
        37 1 2 1 1 43 THR MG   . 43 . HG2# 1 1 
        38 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        38 1 2 1 1  5 ILE HB   .  5 . HB   1 1 
        39 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        39 1 2 1 1  5 ILE HG12 .  5 . HG12 1 1 
        40 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        40 1 2 1 1  5 ILE HG13 .  5 . HG11 1 1 
        41 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        41 1 2 1 1  5 ILE MD   .  5 . HD1# 1 1 
        42 1 1 1 1  5 ILE HA   .  5 . HA   1 1 
        42 1 2 1 1  6 THR H    .  6 . HN   1 1 
        43 1 1 1 1  5 ILE HB   .  5 . HB   1 1 
        43 1 2 1 1  6 THR H    .  6 . HN   1 1 
        44 1 1 1 1  5 ILE HG12 .  5 . HG12 1 1 
        44 1 2 1 1  6 THR H    .  6 . HN   1 1 
        45 1 1 1 1  5 ILE HG13 .  5 . HG11 1 1 
        45 1 2 1 1  6 THR H    .  6 . HN   1 1 
        46 1 1 1 1  5 ILE MD   .  5 . HD1# 1 1 
        46 1 2 1 1  6 THR H    .  6 . HN   1 1 
        47 1 1 1 1  5 ILE MD   .  5 . HD1# 1 1 
        47 1 2 1 1  9 ASP HB3  .  9 . HB1  1 1 
        48 1 1 1 1  5 ILE MD   .  5 . HD1# 1 1 
        48 1 2 1 1  9 ASP HB2  .  9 . HB2  1 1 
        49 1 1 1 1  5 ILE HB   .  5 . HB   1 1 
        49 1 2 1 1 10 TYR QD   . 10 . HD#  1 1 
        50 1 1 1 1  5 ILE HB   .  5 . HB   1 1 
        50 1 2 1 1 10 TYR QE   . 10 . HE#  1 1 
        51 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        51 1 2 1 1 10 TYR QD   . 10 . HD#  1 1 
        52 1 1 1 1  5 ILE MG   .  5 . HG2# 1 1 
        52 1 2 1 1 10 TYR QB   . 10 . HB#  1 1 
        53 1 1 1 1  5 ILE MD   .  5 . HD1# 1 1 
        53 1 2 1 1 10 TYR QB   . 10 . HB#  1 1 
        54 1 1 1 1  5 ILE MG   .  5 . HG2# 1 1 
        54 1 2 1 1 10 TYR HA   . 10 . HA   1 1 
        55 1 1 1 1  5 ILE MD   .  5 . HD1# 1 1 
        55 1 2 1 1 10 TYR HA   . 10 . HA   1 1 
        56 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        56 1 2 1 1 41 PHE QD   . 41 . HD#  1 1 
        57 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        57 1 2 1 1 41 PHE QB   . 41 . HB#  1 1 
        58 1 1 1 1  5 ILE H    .  5 . HN   1 1 
        58 1 2 1 1 42 LEU H    . 42 . HN   1 1 
        59 1 1 1 1  5 ILE HB   .  5 . HB   1 1 
        59 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
        60 1 1 1 1  5 ILE HB   .  5 . HB   1 1 
        60 1 2 1 1 42 LEU QB   . 42 . HB#  1 1 
        61 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        61 1 2 1 1  6 THR HB   .  6 . HB   1 1 
        62 1 1 1 1  6 THR HB   .  6 . HB   1 1 
        62 1 2 1 1  7 LEU H    .  7 . HN   1 1 
        63 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        63 1 2 1 1  7 LEU H    .  7 . HN   1 1 
        64 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        64 1 2 1 1  7 LEU QB   .  7 . HB#  1 1 
        65 1 1 1 1  6 THR H    .  6 . HN   1 1 
        65 1 2 1 1  7 LEU H    .  7 . HN   1 1 
        66 1 1 1 1  6 THR H    .  6 . HN   1 1 
        66 1 2 1 1  9 ASP H    .  9 . HN   1 1 
        67 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        67 1 2 1 1  7 LEU HA   .  7 . HA   1 1 
        68 1 1 1 1  6 THR HB   .  6 . HB   1 1 
        68 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        69 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        69 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        70 1 1 1 1  6 THR MG   .  6 . HG2# 1 1 
        70 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        71 1 1 1 1  6 THR H    .  6 . HN   1 1 
        71 1 2 1 1  9 ASP HB2  .  9 . HB2  1 1 
        72 1 1 1 1  6 THR H    .  6 . HN   1 1 
        72 1 2 1 1  9 ASP HB3  .  9 . HB1  1 1 
        73 1 1 1 1  6 THR HB   .  6 . HB   1 1 
        73 1 2 1 1  9 ASP H    .  9 . HN   1 1 
        74 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        74 1 2 1 1 41 PHE QD   . 41 . HD#  1 1 
        75 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        75 1 2 1 1 41 PHE QB   . 41 . HB#  1 1 
        76 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        76 1 2 1 1 41 PHE HA   . 41 . HA   1 1 
        77 1 1 1 1  6 THR MG   .  6 . HG2# 1 1 
        77 1 2 1 1 41 PHE HA   . 41 . HA   1 1 
        78 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        78 1 2 1 1 42 LEU H    . 42 . HN   1 1 
        79 1 1 1 1  6 THR HA   .  6 . HA   1 1 
        79 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
        80 1 1 1 1  7 LEU H    .  7 . HN   1 1 
        80 1 2 1 1  7 LEU HG   .  7 . HG   1 1 
        81 1 1 1 1  7 LEU H    .  7 . HN   1 1 
        81 1 2 1 1  7 LEU QD   .  7 . HD## 1 1 
        82 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
        82 1 2 1 1  7 LEU HG   .  7 . HG   1 1 
        83 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
        83 1 2 1 1 34 ILE MD   . 34 . HD1# 1 1 
        84 1 1 1 1  7 LEU HG   .  7 . HG   1 1 
        84 1 2 1 1 34 ILE MD   . 34 . HD1# 1 1 
        85 1 1 1 1  7 LEU HG   .  7 . HG   1 1 
        85 1 2 1 1 34 ILE QG   . 34 . HG1# 1 1 
        86 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
        86 1 2 1 1 34 ILE QG   . 34 . HG1# 1 1 
        87 1 1 1 1  7 LEU H    .  7 . HN   1 1 
        87 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
        88 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
        88 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        89 1 1 1 1  7 LEU HG   .  7 . HG   1 1 
        89 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        90 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
        90 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        91 1 1 1 1  7 LEU H    .  7 . HN   1 1 
        91 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        92 1 1 1 1  7 LEU HB2  .  7 . HB2  1 1 
        92 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        93 1 1 1 1  7 LEU HB3  .  7 . HB1  1 1 
        93 1 2 1 1  8 LYS H    .  8 . HN   1 1 
        94 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
        94 1 2 1 1 10 TYR QD   . 10 . HD#  1 1 
        95 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
        95 1 2 1 1 10 TYR QB   . 10 . HB#  1 1 
        96 1 1 1 1  7 LEU H    .  7 . HN   1 1 
        96 1 2 1 1 10 TYR H    . 10 . HN   1 1 
        97 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
        97 1 2 1 1 11 ALA H    . 11 . HN   1 1 
        98 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
        98 1 2 1 1 11 ALA H    . 11 . HN   1 1 
        99 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
        99 1 2 1 1 11 ALA MB   . 11 . HB#  1 1 
       100 1 1 1 1  7 LEU MD1  .  7 . HD1# 1 1 
       100 1 2 1 1 30 ILE HA   . 30 . HA   1 1 
       101 1 1 1 1  7 LEU MD2  .  7 . HD2# 1 1 
       101 1 2 1 1 30 ILE HA   . 30 . HA   1 1 
       102 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       102 1 2 1 1 33 TRP HD1  . 33 . HD1  1 1 
       103 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       103 1 2 1 1 33 TRP HB2  . 33 . HB2  1 1 
       104 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       104 1 2 1 1 33 TRP HB3  . 33 . HB1  1 1 
       105 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       105 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       106 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       106 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       107 1 1 1 1  7 LEU H    .  7 . HN   1 1 
       107 1 2 1 1 40 ILE MG   . 40 . HG2# 1 1 
       108 1 1 1 1  7 LEU H    .  7 . HN   1 1 
       108 1 2 1 1 41 PHE HA   . 41 . HA   1 1 
       109 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
       109 1 2 1 1 42 LEU MD1  . 42 . HD1# 1 1 
       110 1 1 1 1  7 LEU HA   .  7 . HA   1 1 
       110 1 2 1 1 42 LEU MD2  . 42 . HD2# 1 1 
       111 1 1 1 1  7 LEU QB   .  7 . HB#  1 1 
       111 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       112 1 1 1 1  7 LEU HG   .  7 . HG   1 1 
       112 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       113 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       113 1 2 1 1 42 LEU MD2  . 42 . HD2# 1 1 
       114 1 1 1 1  7 LEU QD   .  7 . HD## 1 1 
       114 1 2 1 1 42 LEU MD1  . 42 . HD1# 1 1 
       115 1 1 1 1  8 LYS H    .  8 . HN   1 1 
       115 1 2 1 1  8 LYS HA   .  8 . HA   1 1 
       116 1 1 1 1  8 LYS H    .  8 . HN   1 1 
       116 1 2 1 1  9 ASP H    .  9 . HN   1 1 
       117 1 1 1 1  8 LYS HA   .  8 . HA   1 1 
       117 1 2 1 1 11 ALA H    . 11 . HN   1 1 
       118 1 1 1 1  8 LYS QE   .  8 . HE#  1 1 
       118 1 2 1 1 34 ILE QG   . 34 . HG## 1 1 
       118 1 2 1 1 34 ILE MG   . 34 . HG## 1 1 
       119 1 1 1 1  8 LYS QB   .  8 . HB#  1 1 
       119 1 2 1 1 34 ILE MD   . 34 . HD1# 1 1 
       120 1 1 1 1  9 ASP HA   .  9 . HA   1 1 
       120 1 2 1 1 10 TYR H    . 10 . HN   1 1 
       121 1 1 1 1  9 ASP HB3  .  9 . HB1  1 1 
       121 1 2 1 1 10 TYR H    . 10 . HN   1 1 
       122 1 1 1 1  9 ASP H    .  9 . HN   1 1 
       122 1 2 1 1 10 TYR QB   . 10 . HB#  1 1 
       123 1 1 1 1  9 ASP H    .  9 . HN   1 1 
       123 1 2 1 1 10 TYR H    . 10 . HN   1 1 
       124 1 1 1 1  9 ASP H    .  9 . HN   1 1 
       124 1 2 1 1 11 ALA H    . 11 . HN   1 1 
       125 1 1 1 1  9 ASP HA   .  9 . HA   1 1 
       125 1 2 1 1 12 MET H    . 12 . HN   1 1 
       126 1 1 1 1  9 ASP HA   .  9 . HA   1 1 
       126 1 2 1 1 12 MET ME   . 12 . HE#  1 1 
       127 1 1 1 1  9 ASP HA   .  9 . HA   1 1 
       127 1 2 1 1 12 MET QB   . 12 . HB#  1 1 
       128 1 1 1 1  9 ASP HA   .  9 . HA   1 1 
       128 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       129 1 1 1 1  9 ASP HB2  .  9 . HB2  1 1 
       129 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       130 1 1 1 1 10 TYR H    . 10 . HN   1 1 
       130 1 2 1 1 10 TYR QD   . 10 . HD#  1 1 
       131 1 1 1 1 10 TYR H    . 10 . HN   1 1 
       131 1 2 1 1 10 TYR QB   . 10 . HB#  1 1 
       132 1 1 1 1 10 TYR HA   . 10 . HA   1 1 
       132 1 2 1 1 10 TYR QD   . 10 . HD#  1 1 
       133 1 1 1 1 10 TYR QB   . 10 . HB#  1 1 
       133 1 2 1 1 10 TYR QD   . 10 . HD#  1 1 
       134 1 1 1 1 10 TYR H    . 10 . HN   1 1 
       134 1 2 1 1 11 ALA MB   . 11 . HB#  1 1 
       135 1 1 1 1 10 TYR QD   . 10 . HD#  1 1 
       135 1 2 1 1 11 ALA H    . 11 . HN   1 1 
       136 1 1 1 1 10 TYR HA   . 10 . HA   1 1 
       136 1 2 1 1 11 ALA H    . 11 . HN   1 1 
       137 1 1 1 1 10 TYR QB   . 10 . HB#  1 1 
       137 1 2 1 1 11 ALA H    . 11 . HN   1 1 
       138 1 1 1 1 10 TYR QD   . 10 . HD#  1 1 
       138 1 2 1 1 11 ALA HA   . 11 . HA   1 1 
       139 1 1 1 1 10 TYR QB   . 10 . HB#  1 1 
       139 1 2 1 1 11 ALA HA   . 11 . HA   1 1 
       140 1 1 1 1 10 TYR H    . 10 . HN   1 1 
       140 1 2 1 1 12 MET H    . 12 . HN   1 1 
       141 1 1 1 1 10 TYR HA   . 10 . HA   1 1 
       141 1 2 1 1 13 ARG QG   . 13 . HG#  1 1 
       142 1 1 1 1 10 TYR HA   . 10 . HA   1 1 
       142 1 2 1 1 13 ARG QB   . 13 . HB#  1 1 
       143 1 1 1 1 10 TYR QD   . 10 . HD#  1 1 
       143 1 2 1 1 14 PHE HB3  . 14 . HB1  1 1 
       144 1 1 1 1 10 TYR HA   . 10 . HA   1 1 
       144 1 2 1 1 14 PHE QE   . 14 . HE#  1 1 
       145 1 1 1 1 10 TYR HA   . 10 . HA   1 1 
       145 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       146 1 1 1 1 10 TYR QD   . 10 . HD#  1 1 
       146 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       147 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       147 1 2 1 1 19 THR H    . 19 . HN   1 1 
       148 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       148 1 2 1 1 19 THR HA   . 19 . HA   1 1 
       149 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       149 1 2 1 1 19 THR MG   . 19 . HG2# 1 1 
       150 1 1 1 1 10 TYR QB   . 10 . HB#  1 1 
       150 1 2 1 1 19 THR MG   . 19 . HG2# 1 1 
       151 1 1 1 1 10 TYR H    . 10 . HN   1 1 
       151 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       152 1 1 1 1 10 TYR QD   . 10 . HD#  1 1 
       152 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       153 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       153 1 2 1 1 42 LEU HG   . 42 . HG   1 1 
       154 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       154 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       155 1 1 1 1 10 TYR QB   . 10 . HB#  1 1 
       155 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       156 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       156 1 2 1 1 44 ILE HB   . 44 . HB   1 1 
       157 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       157 1 2 1 1 44 ILE QG   . 44 . HG1# 1 1 
       158 1 1 1 1 10 TYR QD   . 10 . HD#  1 1 
       158 1 2 1 1 50 VAL QG   . 50 . HG## 1 1 
       159 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       159 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       160 1 1 1 1 10 TYR QE   . 10 . HE#  1 1 
       160 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       161 1 1 1 1 11 ALA H    . 11 . HN   1 1 
       161 1 2 1 1 11 ALA MB   . 11 . HB#  1 1 
       162 1 1 1 1 11 ALA H    . 11 . HN   1 1 
       162 1 2 1 1 12 MET H    . 12 . HN   1 1 
       163 1 1 1 1 11 ALA H    . 11 . HN   1 1 
       163 1 2 1 1 12 MET QB   . 12 . HB#  1 1 
       164 1 1 1 1 11 ALA MB   . 11 . HB#  1 1 
       164 1 2 1 1 12 MET H    . 12 . HN   1 1 
       165 1 1 1 1 11 ALA H    . 11 . HN   1 1 
       165 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       166 1 1 1 1 11 ALA HA   . 11 . HA   1 1 
       166 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       167 1 1 1 1 11 ALA MB   . 11 . HB#  1 1 
       167 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       168 1 1 1 1 11 ALA MB   . 11 . HB#  1 1 
       168 1 2 1 1 16 GLN H    . 16 . HN   1 1 
       169 1 1 1 1 11 ALA H    . 11 . HN   1 1 
       169 1 2 1 1 19 THR MG   . 19 . HG2# 1 1 
       170 1 1 1 1 11 ALA H    . 11 . HN   1 1 
       170 1 2 1 1 34 ILE MD   . 34 . HD## 1 1 
       171 1 1 1 1 12 MET H    . 12 . HN   1 1 
       171 1 2 1 1 12 MET HA   . 12 . HA   1 1 
       172 1 1 1 1 12 MET H    . 12 . HN   1 1 
       172 1 2 1 1 12 MET HG3  . 12 . HG1  1 1 
       173 1 1 1 1 12 MET H    . 12 . HN   1 1 
       173 1 2 1 1 12 MET HG2  . 12 . HG2  1 1 
       174 1 1 1 1 12 MET H    . 12 . HN   1 1 
       174 1 2 1 1 12 MET HB2  . 12 . HB2  1 1 
       175 1 1 1 1 12 MET H    . 12 . HN   1 1 
       175 1 2 1 1 12 MET HB3  . 12 . HB1  1 1 
       176 1 1 1 1 12 MET H    . 12 . HN   1 1 
       176 1 2 1 1 12 MET ME   . 12 . HE#  1 1 
       177 1 1 1 1 12 MET HA   . 12 . HA   1 1 
       177 1 2 1 1 12 MET HG3  . 12 . HG1  1 1 
       178 1 1 1 1 12 MET HA   . 12 . HA   1 1 
       178 1 2 1 1 12 MET HG2  . 12 . HG2  1 1 
       179 1 1 1 1 12 MET HA   . 12 . HA   1 1 
       179 1 2 1 1 12 MET QB   . 12 . HB#  1 1 
       180 1 1 1 1 12 MET HA   . 12 . HA   1 1 
       180 1 2 1 1 12 MET ME   . 12 . HE#  1 1 
       181 1 1 1 1 12 MET H    . 12 . HN   1 1 
       181 1 2 1 1 13 ARG QB   . 13 . HB#  1 1 
       182 1 1 1 1 12 MET HA   . 12 . HA   1 1 
       182 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       183 1 1 1 1 12 MET HG3  . 12 . HG1  1 1 
       183 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       184 1 1 1 1 12 MET HG2  . 12 . HG2  1 1 
       184 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       185 1 1 1 1 12 MET HB2  . 12 . HB2  1 1 
       185 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       186 1 1 1 1 12 MET HB3  . 12 . HB1  1 1 
       186 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       187 1 1 1 1 12 MET H    . 12 . HN   1 1 
       187 1 2 1 1 13 ARG H    . 13 . HN   1 1 
       188 1 1 1 1 13 ARG H    . 13 . HN   1 1 
       188 1 2 1 1 13 ARG QB   . 13 . HB#  1 1 
       189 1 1 1 1 13 ARG H    . 13 . HN   1 1 
       189 1 2 1 1 13 ARG QG   . 13 . HG#  1 1 
       190 1 1 1 1 13 ARG HE   . 13 . HE   1 1 
       190 1 2 1 1 13 ARG QG   . 13 . HG#  1 1 
       191 1 1 1 1 13 ARG H    . 13 . HN   1 1 
       191 1 2 1 1 14 PHE H    . 14 . HN   1 1 
       192 1 1 1 1 13 ARG HB2  . 13 . HB2  1 1 
       192 1 2 1 1 14 PHE H    . 14 . HN   1 1 
       193 1 1 1 1 13 ARG HG3  . 13 . HG1  1 1 
       193 1 2 1 1 14 PHE H    . 14 . HN   1 1 
       194 1 1 1 1 13 ARG HB3  . 13 . HB1  1 1 
       194 1 2 1 1 14 PHE H    . 14 . HN   1 1 
       195 1 1 1 1 13 ARG HG2  . 13 . HG2  1 1 
       195 1 2 1 1 14 PHE H    . 14 . HN   1 1 
       196 1 1 1 1 13 ARG H    . 13 . HN   1 1 
       196 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       197 1 1 1 1 13 ARG HA   . 13 . HA   1 1 
       197 1 2 1 1 14 PHE QE   . 14 . HE#  1 1 
       198 1 1 1 1 13 ARG QD   . 13 . HD#  1 1 
       198 1 2 1 1 14 PHE HZ   . 14 . HZ   1 1 
       199 1 1 1 1 13 ARG QG   . 13 . HG#  1 1 
       199 1 2 1 1 14 PHE HZ   . 14 . HZ   1 1 
       200 1 1 1 1 13 ARG QG   . 13 . HG#  1 1 
       200 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       201 1 1 1 1 13 ARG H    . 13 . HN   1 1 
       201 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       202 1 1 1 1 13 ARG HA   . 13 . HA   1 1 
       202 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       203 1 1 1 1 13 ARG QB   . 13 . HB#  1 1 
       203 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       204 1 1 1 1 14 PHE H    . 14 . HN   1 1 
       204 1 2 1 1 14 PHE QE   . 14 . HE#  1 1 
       205 1 1 1 1 14 PHE H    . 14 . HN   1 1 
       205 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       206 1 1 1 1 14 PHE H    . 14 . HN   1 1 
       206 1 2 1 1 14 PHE HB3  . 14 . HB1  1 1 
       207 1 1 1 1 14 PHE HA   . 14 . HA   1 1 
       207 1 2 1 1 14 PHE QD   . 14 . HD#  1 1 
       208 1 1 1 1 14 PHE H    . 14 . HN   1 1 
       208 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       209 1 1 1 1 14 PHE QD   . 14 . HD#  1 1 
       209 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       210 1 1 1 1 14 PHE HB3  . 14 . HB1  1 1 
       210 1 2 1 1 15 GLY H    . 15 . HN   1 1 
       211 1 1 1 1 14 PHE QD   . 14 . HD#  1 1 
       211 1 2 1 1 18 LYS HE2  . 18 . HE2  1 1 
       212 1 1 1 1 14 PHE QD   . 14 . HD#  1 1 
       212 1 2 1 1 18 LYS HE3  . 18 . HE1  1 1 
       213 1 1 1 1 14 PHE QD   . 14 . HD#  1 1 
       213 1 2 1 1 18 LYS QD   . 18 . HD#  1 1 
       214 1 1 1 1 14 PHE QB   . 14 . HB#  1 1 
       214 1 2 1 1 18 LYS QD   . 18 . HD#  1 1 
       215 1 1 1 1 14 PHE HZ   . 14 . HZ   1 1 
       215 1 2 1 1 44 ILE MD   . 44 . HD## 1 1 
       216 1 1 1 1 14 PHE QE   . 14 . HE#  1 1 
       216 1 2 1 1 44 ILE MD   . 44 . HD## 1 1 
       217 1 1 1 1 15 GLY H    . 15 . HN   1 1 
       217 1 2 1 1 16 GLN H    . 16 . HN   1 1 
       218 1 1 1 1 15 GLY HA2  . 15 . HA2  1 1 
       218 1 2 1 1 16 GLN H    . 16 . HN   1 1 
       219 1 1 1 1 15 GLY HA3  . 15 . HA1  1 1 
       219 1 2 1 1 16 GLN H    . 16 . HN   1 1 
       220 1 1 1 1 16 GLN H    . 16 . HN   1 1 
       220 1 2 1 1 16 GLN QG   . 16 . HG#  1 1 
       221 1 1 1 1 16 GLN H    . 16 . HN   1 1 
       221 1 2 1 1 16 GLN QB   . 16 . HB#  1 1 
       222 1 1 1 1 16 GLN H    . 16 . HN   1 1 
       222 1 2 1 1 17 THR H    . 17 . HN   1 1 
       223 1 1 1 1 16 GLN QG   . 16 . HG#  1 1 
       223 1 2 1 1 17 THR H    . 17 . HN   1 1 
       224 1 1 1 1 16 GLN HA   . 16 . HA   1 1 
       224 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       225 1 1 1 1 16 GLN HA   . 16 . HA   1 1 
       225 1 2 1 1 30 ILE MD   . 30 . HD## 1 1 
       226 1 1 1 1 16 GLN QE   . 16 . HE2# 1 1 
       226 1 2 1 1 34 ILE MD   . 34 . HD1# 1 1 
       227 1 1 1 1 17 THR H    . 17 . HN   1 1 
       227 1 2 1 1 17 THR MG   . 17 . HG2# 1 1 
       228 1 1 1 1 17 THR H    . 17 . HN   1 1 
       228 1 2 1 1 18 LYS H    . 18 . HN   1 1 
       229 1 1 1 1 17 THR HB   . 17 . HB   1 1 
       229 1 2 1 1 18 LYS H    . 18 . HN   1 1 
       230 1 1 1 1 17 THR HA   . 17 . HA   1 1 
       230 1 2 1 1 18 LYS H    . 18 . HN   1 1 
       231 1 1 1 1 17 THR MG   . 17 . HG2# 1 1 
       231 1 2 1 1 18 LYS H    . 18 . HN   1 1 
       232 1 1 1 1 17 THR H    . 17 . HN   1 1 
       232 1 2 1 1 18 LYS QB   . 18 . HB#  1 1 
       233 1 1 1 1 17 THR MG   . 17 . HG2# 1 1 
       233 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       234 1 1 1 1 17 THR HA   . 17 . HA   1 1 
       234 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       235 1 1 1 1 17 THR HA   . 17 . HA   1 1 
       235 1 2 1 1 20 ALA MB   . 20 . HB#  1 1 
       236 1 1 1 1 17 THR HA   . 17 . HA   1 1 
       236 1 2 1 1 27 GLN QG   . 27 . HG#  1 1 
       237 1 1 1 1 17 THR MG   . 17 . HG2# 1 1 
       237 1 2 1 1 27 GLN QG   . 27 . HG#  1 1 
       238 1 1 1 1 18 LYS H    . 18 . HN   1 1 
       238 1 2 1 1 18 LYS HD3  . 18 . HD1  1 1 
       239 1 1 1 1 18 LYS H    . 18 . HN   1 1 
       239 1 2 1 1 18 LYS QG   . 18 . HG#  1 1 
       240 1 1 1 1 18 LYS H    . 18 . HN   1 1 
       240 1 2 1 1 18 LYS HD2  . 18 . HD2  1 1 
       241 1 1 1 1 18 LYS H    . 18 . HN   1 1 
       241 1 2 1 1 19 THR H    . 19 . HN   1 1 
       242 1 1 1 1 18 LYS QB   . 18 . HB#  1 1 
       242 1 2 1 1 19 THR H    . 19 . HN   1 1 
       243 1 1 1 1 18 LYS H    . 18 . HN   1 1 
       243 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       244 1 1 1 1 19 THR H    . 19 . HN   1 1 
       244 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       245 1 1 1 1 19 THR HB   . 19 . HB   1 1 
       245 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       246 1 1 1 1 19 THR MG   . 19 . HG2# 1 1 
       246 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       247 1 1 1 1 19 THR HA   . 19 . HA   1 1 
       247 1 2 1 1 20 ALA H    . 20 . HN   1 1 
       248 1 1 1 1 19 THR MG   . 19 . HG2# 1 1 
       248 1 2 1 1 20 ALA HA   . 20 . HA   1 1 
       249 1 1 1 1 19 THR HA   . 19 . HA   1 1 
       249 1 2 1 1 22 ASP H    . 22 . HN   1 1 
       250 1 1 1 1 19 THR HA   . 19 . HA   1 1 
       250 1 2 1 1 22 ASP HB3  . 22 . HB1  1 1 
       251 1 1 1 1 19 THR HB   . 19 . HB   1 1 
       251 1 2 1 1 30 ILE MD   . 30 . HD## 1 1 
       252 1 1 1 1 19 THR MG   . 19 . HG2# 1 1 
       252 1 2 1 1 30 ILE MG   . 30 . HG2# 1 1 
       253 1 1 1 1 19 THR MG   . 19 . HG2# 1 1 
       253 1 2 1 1 42 LEU MD2  . 42 . HD2# 1 1 
       254 1 1 1 1 19 THR MG   . 19 . HG2# 1 1 
       254 1 2 1 1 42 LEU MD1  . 42 . HD1# 1 1 
       255 1 1 1 1 20 ALA H    . 20 . HN   1 1 
       255 1 2 1 1 21 LYS QB   . 21 . HB#  1 1 
       256 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       256 1 2 1 1 21 LYS H    . 21 . HN   1 1 
       257 1 1 1 1 20 ALA H    . 20 . HN   1 1 
       257 1 2 1 1 21 LYS H    . 21 . HN   1 1 
       258 1 1 1 1 20 ALA H    . 20 . HN   1 1 
       258 1 2 1 1 22 ASP H    . 22 . HN   1 1 
       259 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       259 1 2 1 1 23 LEU QB   . 23 . HB#  1 1 
       260 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       260 1 2 1 1 23 LEU H    . 23 . HN   1 1 
       261 1 1 1 1 20 ALA H    . 20 . HN   1 1 
       261 1 2 1 1 23 LEU H    . 23 . HN   1 1 
       262 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       262 1 2 1 1 25 VAL QG   . 25 . HG## 1 1 
       263 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       263 1 2 1 1 25 VAL QG   . 25 . HG## 1 1 
       264 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       264 1 2 1 1 25 VAL H    . 25 . HN   1 1 
       265 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       265 1 2 1 1 26 GLN HA   . 26 . HA   1 1 
       266 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       266 1 2 1 1 27 GLN QG   . 27 . HG#  1 1 
       267 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       267 1 2 1 1 27 GLN H    . 27 . HN   1 1 
       268 1 1 1 1 20 ALA H    . 20 . HN   1 1 
       268 1 2 1 1 30 ILE MG   . 30 . HG2# 1 1 
       269 1 1 1 1 20 ALA H    . 20 . HN   1 1 
       269 1 2 1 1 30 ILE MD   . 30 . HD## 1 1 
       270 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       270 1 2 1 1 30 ILE MD   . 30 . HD## 1 1 
       271 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       271 1 2 1 1 30 ILE MG   . 30 . HG2# 1 1 
       272 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       272 1 2 1 1 30 ILE MD   . 30 . HD1# 1 1 
       273 1 1 1 1 20 ALA MB   . 20 . HB#  1 1 
       273 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       274 1 1 1 1 20 ALA HA   . 20 . HA   1 1 
       274 1 2 1 1 30 ILE QG   . 30 . HG1# 1 1 
       275 1 1 1 1 21 LYS H    . 21 . HN   1 1 
       275 1 2 1 1 21 LYS HB3  . 21 . HB1  1 1 
       276 1 1 1 1 21 LYS H    . 21 . HN   1 1 
       276 1 2 1 1 21 LYS HB2  . 21 . HB2  1 1 
       277 1 1 1 1 21 LYS H    . 21 . HN   1 1 
       277 1 2 1 1 22 ASP H    . 22 . HN   1 1 
       278 1 1 1 1 21 LYS H    . 21 . HN   1 1 
       278 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       279 1 1 1 1 22 ASP H    . 22 . HN   1 1 
       279 1 2 1 1 22 ASP HB2  . 22 . HB2  1 1 
       280 1 1 1 1 22 ASP H    . 22 . HN   1 1 
       280 1 2 1 1 22 ASP HB3  . 22 . HB1  1 1 
       281 1 1 1 1 22 ASP HA   . 22 . HA   1 1 
       281 1 2 1 1 22 ASP HB3  . 22 . HB1  1 1 
       282 1 1 1 1 22 ASP HA   . 22 . HA   1 1 
       282 1 2 1 1 23 LEU H    . 23 . HN   1 1 
       283 1 1 1 1 22 ASP HB2  . 22 . HB2  1 1 
       283 1 2 1 1 23 LEU H    . 23 . HN   1 1 
       284 1 1 1 1 22 ASP HB3  . 22 . HB1  1 1 
       284 1 2 1 1 23 LEU H    . 23 . HN   1 1 
       285 1 1 1 1 22 ASP H    . 22 . HN   1 1 
       285 1 2 1 1 23 LEU H    . 23 . HN   1 1 
       286 1 1 1 1 22 ASP QB   . 22 . HB#  1 1 
       286 1 2 1 1 23 LEU QD   . 23 . HD## 1 1 
       287 1 1 1 1 22 ASP HB3  . 22 . HB1  1 1 
       287 1 2 1 1 23 LEU QD   . 23 . HD## 1 1 
       288 1 1 1 1 22 ASP HB2  . 22 . HB2  1 1 
       288 1 2 1 1 23 LEU QD   . 23 . HD## 1 1 
       289 1 1 1 1 22 ASP HA   . 22 . HA   1 1 
       289 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       290 1 1 1 1 22 ASP H    . 22 . HN   1 1 
       290 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       291 1 1 1 1 22 ASP H    . 22 . HN   1 1 
       291 1 2 1 1 50 VAL QG   . 50 . HG## 1 1 
       292 1 1 1 1 22 ASP HB2  . 22 . HB2  1 1 
       292 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       293 1 1 1 1 22 ASP HB2  . 22 . HB2  1 1 
       293 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       294 1 1 1 1 22 ASP HB3  . 22 . HB1  1 1 
       294 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       295 1 1 1 1 22 ASP HB3  . 22 . HB1  1 1 
       295 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       296 1 1 1 1 22 ASP HB3  . 22 . HB1  1 1 
       296 1 2 1 1 50 VAL HB   . 50 . HB   1 1 
       297 1 1 1 1 22 ASP HB2  . 22 . HB2  1 1 
       297 1 2 1 1 50 VAL HB   . 50 . HB   1 1 
       298 1 1 1 1 23 LEU H    . 23 . HN   1 1 
       298 1 2 1 1 23 LEU MD2  . 23 . HD2# 1 1 
       299 1 1 1 1 23 LEU H    . 23 . HN   1 1 
       299 1 2 1 1 23 LEU MD1  . 23 . HD1# 1 1 
       300 1 1 1 1 23 LEU HA   . 23 . HA   1 1 
       300 1 2 1 1 23 LEU MD1  . 23 . HD1# 1 1 
       301 1 1 1 1 23 LEU HA   . 23 . HA   1 1 
       301 1 2 1 1 23 LEU MD2  . 23 . HD2# 1 1 
       302 1 1 1 1 23 LEU HG   . 23 . HG   1 1 
       302 1 2 1 1 50 VAL QG   . 50 . HG## 1 1 
       303 1 1 1 1 23 LEU HG   . 23 . HG   1 1 
       303 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       304 1 1 1 1 23 LEU MD2  . 23 . HD2# 1 1 
       304 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       305 1 1 1 1 23 LEU MD1  . 23 . HD1# 1 1 
       305 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       306 1 1 1 1 23 LEU HA   . 23 . HA   1 1 
       306 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       307 1 1 1 1 23 LEU H    . 23 . HN   1 1 
       307 1 2 1 1 24 GLY H    . 24 . HN   1 1 
       308 1 1 1 1 23 LEU H    . 23 . HN   1 1 
       308 1 2 1 1 25 VAL QG   . 25 . HG## 1 1 
       309 1 1 1 1 23 LEU QB   . 23 . HB#  1 1 
       309 1 2 1 1 25 VAL QG   . 25 . HG## 1 1 
       310 1 1 1 1 23 LEU HA   . 23 . HA   1 1 
       310 1 2 1 1 25 VAL QG   . 25 . HG## 1 1 
       311 1 1 1 1 23 LEU QB   . 23 . HB#  1 1 
       311 1 2 1 1 33 TRP HH2  . 33 . HH2  1 1 
       312 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       312 1 2 1 1 33 TRP HZ3  . 33 . HZ3  1 1 
       313 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       313 1 2 1 1 33 TRP HH2  . 33 . HH2  1 1 
       314 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       314 1 2 1 1 33 TRP HE3  . 33 . HE3  1 1 
       315 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       315 1 2 1 1 42 LEU HA   . 42 . HA   1 1 
       316 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       316 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       317 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       317 1 2 1 1 51 TYR HA   . 51 . HA   1 1 
       318 1 1 1 1 23 LEU QD   . 23 . HD## 1 1 
       318 1 2 1 1 52 ALA H    . 52 . HN   1 1 
       319 1 1 1 1 24 GLY H    . 24 . HN   1 1 
       319 1 2 1 1 25 VAL MG2  . 25 . HG2# 1 1 
       320 1 1 1 1 24 GLY H    . 24 . HN   1 1 
       320 1 2 1 1 25 VAL MG1  . 25 . HG1# 1 1 
       321 1 1 1 1 25 VAL H    . 25 . HN   1 1 
       321 1 2 1 1 25 VAL MG2  . 25 . HG2# 1 1 
       322 1 1 1 1 25 VAL H    . 25 . HN   1 1 
       322 1 2 1 1 25 VAL MG1  . 25 . HG1# 1 1 
       323 1 1 1 1 25 VAL QG   . 25 . HG## 1 1 
       323 1 2 1 1 26 GLN QB   . 26 . HB#  1 1 
       324 1 1 1 1 25 VAL HA   . 25 . HA   1 1 
       324 1 2 1 1 26 GLN H    . 26 . HN   1 1 
       325 1 1 1 1 25 VAL HB   . 25 . HB   1 1 
       325 1 2 1 1 26 GLN H    . 26 . HN   1 1 
       326 1 1 1 1 25 VAL MG2  . 25 . HG2# 1 1 
       326 1 2 1 1 26 GLN H    . 26 . HN   1 1 
       327 1 1 1 1 25 VAL MG1  . 25 . HG1# 1 1 
       327 1 2 1 1 26 GLN H    . 26 . HN   1 1 
       328 1 1 1 1 25 VAL HA   . 25 . HA   1 1 
       328 1 2 1 1 29 ALA MB   . 29 . HB#  1 1 
       329 1 1 1 1 25 VAL QG   . 25 . HG## 1 1 
       329 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       330 1 1 1 1 25 VAL QG   . 25 . HG## 1 1 
       330 1 2 1 1 30 ILE HA   . 30 . HA   1 1 
       331 1 1 1 1 25 VAL QG   . 25 . HG## 1 1 
       331 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       332 1 1 1 1 25 VAL QG   . 25 . HG## 1 1 
       332 1 2 1 1 33 TRP HZ2  . 33 . HZ2  1 1 
       333 1 1 1 1 25 VAL HB   . 25 . HB   1 1 
       333 1 2 1 1 33 TRP HH2  . 33 . HH2  1 1 
       334 1 1 1 1 25 VAL QG   . 25 . HG## 1 1 
       334 1 2 1 1 33 TRP HH2  . 33 . HH2  1 1 
       335 1 1 1 1 26 GLN H    . 26 . HN   1 1 
       335 1 2 1 1 26 GLN QG   . 26 . HG#  1 1 
       336 1 1 1 1 26 GLN HA   . 26 . HA   1 1 
       336 1 2 1 1 26 GLN QG   . 26 . HG#  1 1 
       337 1 1 1 1 26 GLN H    . 26 . HN   1 1 
       337 1 2 1 1 27 GLN H    . 27 . HN   1 1 
       338 1 1 1 1 26 GLN HA   . 26 . HA   1 1 
       338 1 2 1 1 27 GLN H    . 27 . HN   1 1 
       339 1 1 1 1 26 GLN QG   . 26 . HG#  1 1 
       339 1 2 1 1 27 GLN H    . 27 . HN   1 1 
       340 1 1 1 1 26 GLN QB   . 26 . HB#  1 1 
       340 1 2 1 1 27 GLN H    . 27 . HN   1 1 
       341 1 1 1 1 26 GLN QG   . 26 . HG#  1 1 
       341 1 2 1 1 28 SER H    . 28 . HN   1 1 
       342 1 1 1 1 26 GLN H    . 26 . HN   1 1 
       342 1 2 1 1 29 ALA MB   . 29 . HB#  1 1 
       343 1 1 1 1 26 GLN HA   . 26 . HA   1 1 
       343 1 2 1 1 29 ALA H    . 29 . HN   1 1 
       344 1 1 1 1 26 GLN QG   . 26 . HG#  1 1 
       344 1 2 1 1 29 ALA H    . 29 . HN   1 1 
       345 1 1 1 1 26 GLN QB   . 26 . HB#  1 1 
       345 1 2 1 1 29 ALA H    . 29 . HN   1 1 
       346 1 1 1 1 26 GLN QB   . 26 . HB#  1 1 
       346 1 2 1 1 29 ALA MB   . 29 . HB#  1 1 
       347 1 1 1 1 26 GLN QG   . 26 . HG#  1 1 
       347 1 2 1 1 29 ALA MB   . 29 . HB#  1 1 
       348 1 1 1 1 27 GLN H    . 27 . HN   1 1 
       348 1 2 1 1 27 GLN QG   . 27 . HG#  1 1 
       349 1 1 1 1 27 GLN H    . 27 . HN   1 1 
       349 1 2 1 1 27 GLN QB   . 27 . HB#  1 1 
       350 1 1 1 1 27 GLN H    . 27 . HN   1 1 
       350 1 2 1 1 28 SER H    . 28 . HN   1 1 
       351 1 1 1 1 27 GLN HA   . 27 . HA   1 1 
       351 1 2 1 1 28 SER H    . 28 . HN   1 1 
       352 1 1 1 1 27 GLN HB2  . 27 . HB2  1 1 
       352 1 2 1 1 28 SER H    . 28 . HN   1 1 
       353 1 1 1 1 27 GLN QB   . 27 . HB#  1 1 
       353 1 2 1 1 28 SER HA   . 28 . HA   1 1 
       354 1 1 1 1 27 GLN QG   . 27 . HG#  1 1 
       354 1 2 1 1 28 SER H    . 28 . HN   1 1 
       355 1 1 1 1 27 GLN HB3  . 27 . HB1  1 1 
       355 1 2 1 1 28 SER H    . 28 . HN   1 1 
       356 1 1 1 1 27 GLN HA   . 27 . HA   1 1 
       356 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       357 1 1 1 1 27 GLN HA   . 27 . HA   1 1 
       357 1 2 1 1 30 ILE HB   . 30 . HB   1 1 
       358 1 1 1 1 27 GLN HA   . 27 . HA   1 1 
       358 1 2 1 1 30 ILE MD   . 30 . HD## 1 1 
       359 1 1 1 1 27 GLN HA   . 27 . HA   1 1 
       359 1 2 1 1 30 ILE MG   . 30 . HG2# 1 1 
       360 1 1 1 1 28 SER H    . 28 . HN   1 1 
       360 1 2 1 1 28 SER HA   . 28 . HA   1 1 
       361 1 1 1 1 28 SER H    . 28 . HN   1 1 
       361 1 2 1 1 29 ALA H    . 29 . HN   1 1 
       362 1 1 1 1 28 SER HA   . 28 . HA   1 1 
       362 1 2 1 1 29 ALA H    . 29 . HN   1 1 
       363 1 1 1 1 28 SER H    . 28 . HN   1 1 
       363 1 2 1 1 29 ALA MB   . 29 . HB#  1 1 
       364 1 1 1 1 28 SER H    . 28 . HN   1 1 
       364 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       365 1 1 1 1 28 SER HA   . 28 . HA   1 1 
       365 1 2 1 1 31 ASN QD   . 31 . HD2# 1 1 
       366 1 1 1 1 28 SER HA   . 28 . HA   1 1 
       366 1 2 1 1 31 ASN QB   . 31 . HB#  1 1 
       367 1 1 1 1 28 SER H    . 28 . HN   1 1 
       367 1 2 1 1 31 ASN H    . 31 . HN   1 1 
       368 1 1 1 1 28 SER HA   . 28 . HA   1 1 
       368 1 2 1 1 32 LYS QB   . 32 . HB#  1 1 
       369 1 1 1 1 29 ALA H    . 29 . HN   1 1 
       369 1 2 1 1 29 ALA MB   . 29 . HB#  1 1 
       370 1 1 1 1 29 ALA H    . 29 . HN   1 1 
       370 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       371 1 1 1 1 29 ALA HA   . 29 . HA   1 1 
       371 1 2 1 1 32 LYS QB   . 32 . HB#  1 1 
       372 1 1 1 1 29 ALA MB   . 29 . HB#  1 1 
       372 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       373 1 1 1 1 29 ALA MB   . 29 . HB#  1 1 
       373 1 2 1 1 30 ILE HA   . 30 . HA   1 1 
       374 1 1 1 1 29 ALA HA   . 29 . HA   1 1 
       374 1 2 1 1 30 ILE H    . 30 . HN   1 1 
       375 1 1 1 1 29 ALA H    . 29 . HN   1 1 
       375 1 2 1 1 31 ASN H    . 31 . HN   1 1 
       376 1 1 1 1 29 ALA HA   . 29 . HA   1 1 
       376 1 2 1 1 32 LYS H    . 32 . HN   1 1 
       377 1 1 1 1 29 ALA MB   . 29 . HB#  1 1 
       377 1 2 1 1 32 LYS H    . 32 . HN   1 1 
       378 1 1 1 1 29 ALA HA   . 29 . HA   1 1 
       378 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       379 1 1 1 1 29 ALA MB   . 29 . HB#  1 1 
       379 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       380 1 1 1 1 29 ALA HA   . 29 . HA   1 1 
       380 1 2 1 1 33 TRP H    . 33 . HN   1 1 
       381 1 1 1 1 29 ALA MB   . 29 . HB#  1 1 
       381 1 2 1 1 33 TRP HZ2  . 33 . HZ2  1 1 
       382 1 1 1 1 30 ILE H    . 30 . HN   1 1 
       382 1 2 1 1 30 ILE HB   . 30 . HB   1 1 
       383 1 1 1 1 30 ILE H    . 30 . HN   1 1 
       383 1 2 1 1 30 ILE MG   . 30 . HG2# 1 1 
       384 1 1 1 1 30 ILE H    . 30 . HN   1 1 
       384 1 2 1 1 30 ILE MD   . 30 . HD1# 1 1 
       385 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       385 1 2 1 1 30 ILE HG12 . 30 . HG12 1 1 
       386 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       386 1 2 1 1 30 ILE HG13 . 30 . HG11 1 1 
       387 1 1 1 1 30 ILE HB   . 30 . HB   1 1 
       387 1 2 1 1 30 ILE MD   . 30 . HD1# 1 1 
       388 1 1 1 1 30 ILE H    . 30 . HN   1 1 
       388 1 2 1 1 31 ASN H    . 31 . HN   1 1 
       389 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       389 1 2 1 1 31 ASN H    . 31 . HN   1 1 
       390 1 1 1 1 30 ILE MD   . 30 . HD## 1 1 
       390 1 2 1 1 31 ASN H    . 31 . HN   1 1 
       391 1 1 1 1 30 ILE MG   . 30 . HG2# 1 1 
       391 1 2 1 1 31 ASN HA   . 31 . HA   1 1 
       392 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       392 1 2 1 1 32 LYS H    . 32 . HN   1 1 
       393 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       393 1 2 1 1 33 TRP H    . 33 . HN   1 1 
       394 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       394 1 2 1 1 33 TRP HE3  . 33 . HE3  1 1 
       395 1 1 1 1 30 ILE MD   . 30 . HD## 1 1 
       395 1 2 1 1 33 TRP HE3  . 33 . HE3  1 1 
       396 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       396 1 2 1 1 33 TRP HZ3  . 33 . HZ3  1 1 
       397 1 1 1 1 30 ILE MG   . 30 . HG2# 1 1 
       397 1 2 1 1 33 TRP HZ3  . 33 . HZ3  1 1 
       398 1 1 1 1 30 ILE MD   . 30 . HD## 1 1 
       398 1 2 1 1 33 TRP HZ3  . 33 . HZ3  1 1 
       399 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       399 1 2 1 1 33 TRP HB3  . 33 . HB1  1 1 
       400 1 1 1 1 30 ILE MD   . 30 . HD1# 1 1 
       400 1 2 1 1 33 TRP HH2  . 33 . HH2  1 1 
       401 1 1 1 1 30 ILE MD   . 30 . HD1# 1 1 
       401 1 2 1 1 33 TRP HB2  . 33 . HB2  1 1 
       402 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       402 1 2 1 1 33 TRP HB2  . 33 . HB2  1 1 
       403 1 1 1 1 30 ILE HA   . 30 . HA   1 1 
       403 1 2 1 1 34 ILE MD   . 34 . HD1# 1 1 
       404 1 1 1 1 31 ASN H    . 31 . HN   1 1 
       404 1 2 1 1 31 ASN HA   . 31 . HA   1 1 
       405 1 1 1 1 31 ASN H    . 31 . HN   1 1 
       405 1 2 1 1 32 LYS H    . 32 . HN   1 1 
       406 1 1 1 1 31 ASN QB   . 31 . HB#  1 1 
       406 1 2 1 1 32 LYS H    . 32 . HN   1 1 
       407 1 1 1 1 31 ASN H    . 31 . HN   1 1 
       407 1 2 1 1 33 TRP H    . 33 . HN   1 1 
       408 1 1 1 1 31 ASN HA   . 31 . HA   1 1 
       408 1 2 1 1 33 TRP H    . 33 . HN   1 1 
       409 1 1 1 1 31 ASN H    . 31 . HN   1 1 
       409 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       410 1 1 1 1 31 ASN HA   . 31 . HA   1 1 
       410 1 2 1 1 34 ILE QG   . 34 . HG1# 1 1 
       411 1 1 1 1 31 ASN HA   . 31 . HA   1 1 
       411 1 2 1 1 34 ILE MD   . 34 . HD1# 1 1 
       412 1 1 1 1 31 ASN HA   . 31 . HA   1 1 
       412 1 2 1 1 35 HIS HD2  . 35 . HD2  1 1 
       413 1 1 1 1 31 ASN QB   . 31 . HB#  1 1 
       413 1 2 1 1 35 HIS HD2  . 35 . HD2  1 1 
       414 1 1 1 1 31 ASN QD   . 31 . HD2# 1 1 
       414 1 2 1 1 35 HIS HE1  . 35 . HE1  1 1 
       415 1 1 1 1 32 LYS H    . 32 . HN   1 1 
       415 1 2 1 1 32 LYS HA   . 32 . HA   1 1 
       416 1 1 1 1 32 LYS H    . 32 . HN   1 1 
       416 1 2 1 1 32 LYS QD   . 32 . HD#  1 1 
       417 1 1 1 1 32 LYS H    . 32 . HN   1 1 
       417 1 2 1 1 32 LYS QG   . 32 . HG#  1 1 
       418 1 1 1 1 32 LYS QB   . 32 . HB#  1 1 
       418 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       419 1 1 1 1 32 LYS QG   . 32 . HG#  1 1 
       419 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       420 1 1 1 1 32 LYS H    . 32 . HN   1 1 
       420 1 2 1 1 33 TRP H    . 33 . HN   1 1 
       421 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       421 1 2 1 1 33 TRP H    . 33 . HN   1 1 
       422 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       422 1 2 1 1 33 TRP HD1  . 33 . HD1  1 1 
       423 1 1 1 1 32 LYS QB   . 32 . HB#  1 1 
       423 1 2 1 1 33 TRP HD1  . 33 . HD1  1 1 
       424 1 1 1 1 32 LYS H    . 32 . HN   1 1 
       424 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       425 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       425 1 2 1 1 35 HIS H    . 35 . HN   1 1 
       426 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       426 1 2 1 1 35 HIS HD2  . 35 . HD2  1 1 
       427 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       427 1 2 1 1 35 HIS HB3  . 35 . HB1  1 1 
       428 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       428 1 2 1 1 35 HIS HB2  . 35 . HB2  1 1 
       429 1 1 1 1 32 LYS HA   . 32 . HA   1 1 
       429 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       430 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       430 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       431 1 1 1 1 33 TRP HA   . 33 . HA   1 1 
       431 1 2 1 1 33 TRP HE1  . 33 . HE1  1 1 
       432 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       432 1 2 1 1 33 TRP HE3  . 33 . HE3  1 1 
       433 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       433 1 2 1 1 33 TRP HD1  . 33 . HD1  1 1 
       434 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       434 1 2 1 1 33 TRP HB2  . 33 . HB2  1 1 
       435 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       435 1 2 1 1 33 TRP HB3  . 33 . HB1  1 1 
       436 1 1 1 1 33 TRP HB2  . 33 . HB2  1 1 
       436 1 2 1 1 33 TRP HE3  . 33 . HE3  1 1 
       437 1 1 1 1 33 TRP HB3  . 33 . HB1  1 1 
       437 1 2 1 1 33 TRP HE3  . 33 . HE3  1 1 
       438 1 1 1 1 33 TRP HA   . 33 . HA   1 1 
       438 1 2 1 1 33 TRP HD1  . 33 . HD1  1 1 
       439 1 1 1 1 33 TRP HB2  . 33 . HB2  1 1 
       439 1 2 1 1 33 TRP HD1  . 33 . HD1  1 1 
       440 1 1 1 1 33 TRP HB2  . 33 . HB2  1 1 
       440 1 2 1 1 33 TRP HZ3  . 33 . HZ3  1 1 
       441 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       441 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       442 1 1 1 1 33 TRP HA   . 33 . HA   1 1 
       442 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       443 1 1 1 1 33 TRP HB2  . 33 . HB2  1 1 
       443 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       444 1 1 1 1 33 TRP HB3  . 33 . HB1  1 1 
       444 1 2 1 1 34 ILE H    . 34 . HN   1 1 
       445 1 1 1 1 33 TRP H    . 33 . HN   1 1 
       445 1 2 1 1 35 HIS H    . 35 . HN   1 1 
       446 1 1 1 1 33 TRP HA   . 33 . HA   1 1 
       446 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       447 1 1 1 1 33 TRP HA   . 33 . HA   1 1 
       447 1 2 1 1 36 ALA MB   . 36 . HB#  1 1 
       448 1 1 1 1 33 TRP HE1  . 33 . HE1  1 1 
       448 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       449 1 1 1 1 33 TRP HE3  . 33 . HE3  1 1 
       449 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       450 1 1 1 1 33 TRP HD1  . 33 . HD1  1 1 
       450 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       451 1 1 1 1 33 TRP HZ3  . 33 . HZ3  1 1 
       451 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       452 1 1 1 1 33 TRP HB2  . 33 . HB2  1 1 
       452 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       453 1 1 1 1 33 TRP HB3  . 33 . HB1  1 1 
       453 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       454 1 1 1 1 33 TRP HA   . 33 . HA   1 1 
       454 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       455 1 1 1 1 34 ILE MG   . 34 . HG2# 1 1 
       455 1 2 1 1 35 HIS HA   . 35 . HA   1 1 
       456 1 1 1 1 34 ILE QG   . 34 . HG1# 1 1 
       456 1 2 1 1 35 HIS H    . 35 . HN   1 1 
       457 1 1 1 1 34 ILE H    . 34 . HN   1 1 
       457 1 2 1 1 35 HIS QB   . 35 . HB#  1 1 
       458 1 1 1 1 34 ILE H    . 34 . HN   1 1 
       458 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       459 1 1 1 1 35 HIS H    . 35 . HN   1 1 
       459 1 2 1 1 35 HIS HD2  . 35 . HD2  1 1 
       460 1 1 1 1 35 HIS H    . 35 . HN   1 1 
       460 1 2 1 1 35 HIS HB3  . 35 . HB1  1 1 
       461 1 1 1 1 35 HIS HB2  . 35 . HB2  1 1 
       461 1 2 1 1 35 HIS HD2  . 35 . HD2  1 1 
       462 1 1 1 1 35 HIS H    . 35 . HN   1 1 
       462 1 2 1 1 35 HIS HB2  . 35 . HB2  1 1 
       463 1 1 1 1 35 HIS H    . 35 . HN   1 1 
       463 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       464 1 1 1 1 35 HIS HB3  . 35 . HB1  1 1 
       464 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       465 1 1 1 1 35 HIS HB2  . 35 . HB2  1 1 
       465 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       466 1 1 1 1 35 HIS HD2  . 35 . HD2  1 1 
       466 1 2 1 1 36 ALA MB   . 36 . HB#  1 1 
       467 1 1 1 1 35 HIS HA   . 35 . HA   1 1 
       467 1 2 1 1 36 ALA H    . 36 . HN   1 1 
       468 1 1 1 1 35 HIS H    . 35 . HN   1 1 
       468 1 2 1 1 37 GLY H    . 37 . HN   1 1 
       469 1 1 1 1 36 ALA H    . 36 . HN   1 1 
       469 1 2 1 1 36 ALA MB   . 36 . HB#  1 1 
       470 1 1 1 1 36 ALA H    . 36 . HN   1 1 
       470 1 2 1 1 37 GLY H    . 37 . HN   1 1 
       471 1 1 1 1 36 ALA HA   . 36 . HA   1 1 
       471 1 2 1 1 37 GLY H    . 37 . HN   1 1 
       472 1 1 1 1 36 ALA MB   . 36 . HB#  1 1 
       472 1 2 1 1 37 GLY H    . 37 . HN   1 1 
       473 1 1 1 1 36 ALA H    . 36 . HN   1 1 
       473 1 2 1 1 38 ARG H    . 38 . HN   1 1 
       474 1 1 1 1 37 GLY H    . 37 . HN   1 1 
       474 1 2 1 1 37 GLY QA   . 37 . HA#  1 1 
       475 1 1 1 1 37 GLY H    . 37 . HN   1 1 
       475 1 2 1 1 38 ARG H    . 38 . HN   1 1 
       476 1 1 1 1 37 GLY QA   . 37 . HA#  1 1 
       476 1 2 1 1 38 ARG H    . 38 . HN   1 1 
       477 1 1 1 1 38 ARG HA   . 38 . HA   1 1 
       477 1 2 1 1 38 ARG QD   . 38 . HD#  1 1 
       478 1 1 1 1 38 ARG H    . 38 . HN   1 1 
       478 1 2 1 1 38 ARG QD   . 38 . HD#  1 1 
       479 1 1 1 1 38 ARG HA   . 38 . HA   1 1 
       479 1 2 1 1 39 LYS H    . 39 . HN   1 1 
       480 1 1 1 1 38 ARG H    . 38 . HN   1 1 
       480 1 2 1 1 39 LYS H    . 39 . HN   1 1 
       481 1 1 1 1 38 ARG HE   . 38 . HE   1 1 
       481 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       482 1 1 1 1 38 ARG H    . 38 . HN   1 1 
       482 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       483 1 1 1 1 38 ARG HA   . 38 . HA   1 1 
       483 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       484 1 1 1 1 38 ARG QD   . 38 . HD#  1 1 
       484 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       485 1 1 1 1 38 ARG HG2  . 38 . HG2  1 1 
       485 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       486 1 1 1 1 38 ARG HG3  . 38 . HG1  1 1 
       486 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       487 1 1 1 1 38 ARG QB   . 38 . HB#  1 1 
       487 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       488 1 1 1 1 38 ARG HE   . 38 . HE   1 1 
       488 1 2 1 1 54 GLU QG   . 54 . HG#  1 1 
       489 1 1 1 1 39 LYS HA   . 39 . HA   1 1 
       489 1 2 1 1 40 ILE H    . 40 . HN   1 1 
       490 1 1 1 1 39 LYS H    . 39 . HN   1 1 
       490 1 2 1 1 40 ILE H    . 40 . HN   1 1 
       491 1 1 1 1 39 LYS QE   . 39 . HE#  1 1 
       491 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       492 1 1 1 1 39 LYS QB   . 39 . HB#  1 1 
       492 1 2 1 1 55 VAL H    . 55 . HN   1 1 
       493 1 1 1 1 40 ILE HB   . 40 . HB   1 1 
       493 1 2 1 1 40 ILE MD   . 40 . HD1# 1 1 
       494 1 1 1 1 40 ILE HA   . 40 . HA   1 1 
       494 1 2 1 1 41 PHE H    . 41 . HN   1 1 
       495 1 1 1 1 40 ILE MD   . 40 . HD1# 1 1 
       495 1 2 1 1 41 PHE H    . 41 . HN   1 1 
       496 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       496 1 2 1 1 41 PHE QB   . 41 . HB#  1 1 
       497 1 1 1 1 40 ILE H    . 40 . HN   1 1 
       497 1 2 1 1 41 PHE H    . 41 . HN   1 1 
       498 1 1 1 1 40 ILE HB   . 40 . HB   1 1 
       498 1 2 1 1 41 PHE HA   . 41 . HA   1 1 
       499 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       499 1 2 1 1 41 PHE HA   . 41 . HA   1 1 
       500 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       500 1 2 1 1 42 LEU H    . 42 . HN   1 1 
       501 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       501 1 2 1 1 42 LEU HA   . 42 . HA   1 1 
       502 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       502 1 2 1 1 52 ALA HA   . 52 . HA   1 1 
       503 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       503 1 2 1 1 53 GLU H    . 53 . HN   1 1 
       504 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       504 1 2 1 1 54 GLU H    . 54 . HN   1 1 
       505 1 1 1 1 40 ILE MD   . 40 . HD1# 1 1 
       505 1 2 1 1 54 GLU QG   . 54 . HG#  1 1 
       506 1 1 1 1 40 ILE QG   . 40 . HG1# 1 1 
       506 1 2 1 1 54 GLU QG   . 54 . HG#  1 1 
       507 1 1 1 1 40 ILE MG   . 40 . HG2# 1 1 
       507 1 2 1 1 54 GLU QG   . 54 . HG#  1 1 
       508 1 1 1 1 40 ILE HA   . 40 . HA   1 1 
       508 1 2 1 1 55 VAL H    . 55 . HN   1 1 
       509 1 1 1 1 40 ILE QG   . 40 . HG1# 1 1 
       509 1 2 1 1 55 VAL H    . 55 . HN   1 1 
       510 1 1 1 1 41 PHE H    . 41 . HN   1 1 
       510 1 2 1 1 41 PHE QD   . 41 . HD#  1 1 
       511 1 1 1 1 41 PHE H    . 41 . HN   1 1 
       511 1 2 1 1 41 PHE QB   . 41 . HB#  1 1 
       512 1 1 1 1 41 PHE HA   . 41 . HA   1 1 
       512 1 2 1 1 41 PHE QD   . 41 . HD#  1 1 
       513 1 1 1 1 41 PHE HA   . 41 . HA   1 1 
       513 1 2 1 1 41 PHE QB   . 41 . HB#  1 1 
       514 1 1 1 1 41 PHE QD   . 41 . HD#  1 1 
       514 1 2 1 1 42 LEU H    . 42 . HN   1 1 
       515 1 1 1 1 41 PHE HA   . 41 . HA   1 1 
       515 1 2 1 1 42 LEU H    . 42 . HN   1 1 
       516 1 1 1 1 41 PHE QB   . 41 . HB#  1 1 
       516 1 2 1 1 42 LEU H    . 42 . HN   1 1 
       517 1 1 1 1 41 PHE HA   . 41 . HA   1 1 
       517 1 2 1 1 42 LEU QD   . 42 . HD## 1 1 
       518 1 1 1 1 41 PHE H    . 41 . HN   1 1 
       518 1 2 1 1 53 GLU H    . 53 . HN   1 1 
       519 1 1 1 1 41 PHE QB   . 41 . HB#  1 1 
       519 1 2 1 1 53 GLU H    . 53 . HN   1 1 
       520 1 1 1 1 41 PHE H    . 41 . HN   1 1 
       520 1 2 1 1 54 GLU H    . 54 . HN   1 1 
       521 1 1 1 1 41 PHE H    . 41 . HN   1 1 
       521 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       522 1 1 1 1 41 PHE QD   . 41 . HD#  1 1 
       522 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       523 1 1 1 1 41 PHE QB   . 41 . HB#  1 1 
       523 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       524 1 1 1 1 42 LEU H    . 42 . HN   1 1 
       524 1 2 1 1 42 LEU HG   . 42 . HG   1 1 
       525 1 1 1 1 42 LEU H    . 42 . HN   1 1 
       525 1 2 1 1 42 LEU MD1  . 42 . HD1# 1 1 
       526 1 1 1 1 42 LEU H    . 42 . HN   1 1 
       526 1 2 1 1 42 LEU MD2  . 42 . HD2# 1 1 
       527 1 1 1 1 42 LEU HG   . 42 . HG   1 1 
       527 1 2 1 1 43 THR H    . 43 . HN   1 1 
       528 1 1 1 1 42 LEU MD1  . 42 . HD1# 1 1 
       528 1 2 1 1 43 THR H    . 43 . HN   1 1 
       529 1 1 1 1 42 LEU MD2  . 42 . HD2# 1 1 
       529 1 2 1 1 43 THR H    . 43 . HN   1 1 
       530 1 1 1 1 42 LEU HA   . 42 . HA   1 1 
       530 1 2 1 1 43 THR HB   . 43 . HB   1 1 
       531 1 1 1 1 42 LEU QB   . 42 . HB#  1 1 
       531 1 2 1 1 43 THR H    . 43 . HN   1 1 
       532 1 1 1 1 42 LEU HG   . 42 . HG   1 1 
       532 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       533 1 1 1 1 42 LEU QD   . 42 . HD## 1 1 
       533 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       534 1 1 1 1 42 LEU QD   . 42 . HD## 1 1 
       534 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       535 1 1 1 1 42 LEU QD   . 42 . HD## 1 1 
       535 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       536 1 1 1 1 42 LEU HG   . 42 . HG   1 1 
       536 1 2 1 1 50 VAL QG   . 50 . HG## 1 1 
       537 1 1 1 1 42 LEU QB   . 42 . HB#  1 1 
       537 1 2 1 1 50 VAL QG   . 50 . HG## 1 1 
       538 1 1 1 1 40 ILE QG   . 40 . HG## 1 1 
       538 1 1 1 1 40 ILE MG   . 40 . HG## 1 1 
       538 1 2 1 1 42 LEU QB   . 42 . HB#  1 1 
       539 1 1 1 1 42 LEU QD   . 42 . HD## 1 1 
       539 1 2 1 1 52 ALA H    . 52 . HN   1 1 
       540 1 1 1 1 42 LEU QD   . 42 . HD## 1 1 
       540 1 2 1 1 52 ALA HA   . 52 . HA   1 1 
       541 1 1 1 1 42 LEU QD   . 42 . HD## 1 1 
       541 1 2 1 1 52 ALA MB   . 52 . HB#  1 1 
       542 1 1 1 1 42 LEU MD1  . 42 . HD1# 1 1 
       542 1 2 1 1 53 GLU H    . 53 . HN   1 1 
       543 1 1 1 1 42 LEU MD2  . 42 . HD2# 1 1 
       543 1 2 1 1 53 GLU H    . 53 . HN   1 1 
       544 1 1 1 1 43 THR H    . 43 . HN   1 1 
       544 1 2 1 1 43 THR HB   . 43 . HB   1 1 
       545 1 1 1 1 43 THR HB   . 43 . HB   1 1 
       545 1 2 1 1 44 ILE H    . 44 . HN   1 1 
       546 1 1 1 1 43 THR H    . 43 . HN   1 1 
       546 1 2 1 1 44 ILE H    . 44 . HN   1 1 
       547 1 1 1 1 43 THR HA   . 43 . HA   1 1 
       547 1 2 1 1 44 ILE H    . 44 . HN   1 1 
       548 1 1 1 1 43 THR H    . 43 . HN   1 1 
       548 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       549 1 1 1 1 43 THR H    . 43 . HN   1 1 
       549 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       550 1 1 1 1 43 THR H    . 43 . HN   1 1 
       550 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       551 1 1 1 1 43 THR HB   . 43 . HB   1 1 
       551 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       552 1 1 1 1 43 THR HB   . 43 . HB   1 1 
       552 1 2 1 1 51 TYR QD   . 51 . HD#  1 1 
       553 1 1 1 1 43 THR HB   . 43 . HB   1 1 
       553 1 2 1 1 51 TYR QE   . 51 . HE#  1 1 
       554 1 1 1 1 43 THR MG   . 43 . HG2# 1 1 
       554 1 2 1 1 51 TYR QE   . 51 . HE#  1 1 
       555 1 1 1 1 43 THR HB   . 43 . HB   1 1 
       555 1 2 1 1 51 TYR HB3  . 51 . HB1  1 1 
       556 1 1 1 1 43 THR HB   . 43 . HB   1 1 
       556 1 2 1 1 51 TYR HB2  . 51 . HB2  1 1 
       557 1 1 1 1 43 THR H    . 43 . HN   1 1 
       557 1 2 1 1 52 ALA MB   . 52 . HB#  1 1 
       558 1 1 1 1 44 ILE HA   . 44 . HA   1 1 
       558 1 2 1 1 45 ASN H    . 45 . HN   1 1 
       559 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       559 1 2 1 1 45 ASN H    . 45 . HN   1 1 
       560 1 1 1 1 44 ILE H    . 44 . HN   1 1 
       560 1 2 1 1 45 ASN H    . 45 . HN   1 1 
       561 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       561 1 2 1 1 46 ALA HA   . 46 . HA   1 1 
       562 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       562 1 2 1 1 47 ASP H    . 47 . HN   1 1 
       563 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       563 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       564 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       564 1 2 1 1 48 GLY QA   . 48 . HA#  1 1 
       565 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       565 1 2 1 1 49 SER H    . 49 . HN   1 1 
       566 1 1 1 1 44 ILE HA   . 44 . HA   1 1 
       566 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       567 1 1 1 1 44 ILE HA   . 44 . HA   1 1 
       567 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       568 1 1 1 1 44 ILE HA   . 44 . HA   1 1 
       568 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       569 1 1 1 1 44 ILE MD   . 44 . HD1# 1 1 
       569 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       570 1 1 1 1 44 ILE MG   . 44 . HG2# 1 1 
       570 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       571 1 1 1 1 45 ASN H    . 45 . HN   1 1 
       571 1 2 1 1 45 ASN QD   . 45 . HD2# 1 1 
       572 1 1 1 1 45 ASN HA   . 45 . HA   1 1 
       572 1 2 1 1 46 ALA MB   . 46 . HB#  1 1 
       573 1 1 1 1 45 ASN HB3  . 45 . HB1  1 1 
       573 1 2 1 1 47 ASP H    . 47 . HN   1 1 
       574 1 1 1 1 45 ASN HB2  . 45 . HB2  1 1 
       574 1 2 1 1 47 ASP H    . 47 . HN   1 1 
       575 1 1 1 1 45 ASN H    . 45 . HN   1 1 
       575 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       576 1 1 1 1 45 ASN HB2  . 45 . HB2  1 1 
       576 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       577 1 1 1 1 45 ASN HB3  . 45 . HB1  1 1 
       577 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       578 1 1 1 1 45 ASN H    . 45 . HN   1 1 
       578 1 2 1 1 49 SER H    . 49 . HN   1 1 
       579 1 1 1 1 45 ASN HB2  . 45 . HB2  1 1 
       579 1 2 1 1 49 SER H    . 49 . HN   1 1 
       580 1 1 1 1 45 ASN HB3  . 45 . HB1  1 1 
       580 1 2 1 1 49 SER H    . 49 . HN   1 1 
       581 1 1 1 1 45 ASN HD22 . 45 . HD22 1 1 
       581 1 2 1 1 49 SER H    . 49 . HN   1 1 
       582 1 1 1 1 45 ASN HD21 . 45 . HD21 1 1 
       582 1 2 1 1 49 SER H    . 49 . HN   1 1 
       583 1 1 1 1 45 ASN H    . 45 . HN   1 1 
       583 1 2 1 1 50 VAL HA   . 50 . HA   1 1 
       584 1 1 1 1 45 ASN QD   . 45 . HD2# 1 1 
       584 1 2 1 1 51 TYR QD   . 51 . HD#  1 1 
       585 1 1 1 1 45 ASN QD   . 45 . HD2# 1 1 
       585 1 2 1 1 51 TYR QE   . 51 . HE#  1 1 
       586 1 1 1 1 45 ASN H    . 45 . HN   1 1 
       586 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       587 1 1 1 1 46 ALA H    . 46 . HN   1 1 
       587 1 2 1 1 46 ALA MB   . 46 . HB#  1 1 
       588 1 1 1 1 46 ALA H    . 46 . HN   1 1 
       588 1 2 1 1 47 ASP H    . 47 . HN   1 1 
       589 1 1 1 1 46 ALA MB   . 46 . HB#  1 1 
       589 1 2 1 1 47 ASP H    . 47 . HN   1 1 
       590 1 1 1 1 46 ALA MB   . 46 . HB#  1 1 
       590 1 2 1 1 47 ASP HA   . 47 . HA   1 1 
       591 1 1 1 1 46 ALA H    . 46 . HN   1 1 
       591 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       592 1 1 1 1 46 ALA MB   . 46 . HB#  1 1 
       592 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       593 1 1 1 1 46 ALA HA   . 46 . HA   1 1 
       593 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       594 1 1 1 1 46 ALA HA   . 46 . HA   1 1 
       594 1 2 1 1 48 GLY QA   . 48 . HA#  1 1 
       595 1 1 1 1 46 ALA MB   . 46 . HB#  1 1 
       595 1 2 1 1 49 SER H    . 49 . HN   1 1 
       596 1 1 1 1 47 ASP H    . 47 . HN   1 1 
       596 1 2 1 1 47 ASP HB2  . 47 . HB2  1 1 
       597 1 1 1 1 47 ASP H    . 47 . HN   1 1 
       597 1 2 1 1 47 ASP HB3  . 47 . HB1  1 1 
       598 1 1 1 1 47 ASP HA   . 47 . HA   1 1 
       598 1 2 1 1 47 ASP HB2  . 47 . HB2  1 1 
       599 1 1 1 1 47 ASP HA   . 47 . HA   1 1 
       599 1 2 1 1 47 ASP HB3  . 47 . HB1  1 1 
       600 1 1 1 1 47 ASP H    . 47 . HN   1 1 
       600 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       601 1 1 1 1 47 ASP HA   . 47 . HA   1 1 
       601 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       602 1 1 1 1 47 ASP HB2  . 47 . HB2  1 1 
       602 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       603 1 1 1 1 47 ASP HB3  . 47 . HB1  1 1 
       603 1 2 1 1 48 GLY H    . 48 . HN   1 1 
       604 1 1 1 1 47 ASP H    . 47 . HN   1 1 
       604 1 2 1 1 48 GLY QA   . 48 . HA#  1 1 
       605 1 1 1 1 47 ASP H    . 47 . HN   1 1 
       605 1 2 1 1 49 SER H    . 49 . HN   1 1 
       606 1 1 1 1 47 ASP HA   . 47 . HA   1 1 
       606 1 2 1 1 49 SER H    . 49 . HN   1 1 
       607 1 1 1 1 47 ASP HB2  . 47 . HB2  1 1 
       607 1 2 1 1 49 SER H    . 49 . HN   1 1 
       608 1 1 1 1 47 ASP HB3  . 47 . HB1  1 1 
       608 1 2 1 1 49 SER H    . 49 . HN   1 1 
       609 1 1 1 1 48 GLY H    . 48 . HN   1 1 
       609 1 2 1 1 48 GLY QA   . 48 . HA#  1 1 
       610 1 1 1 1 48 GLY H    . 48 . HN   1 1 
       610 1 2 1 1 49 SER H    . 49 . HN   1 1 
       611 1 1 1 1 48 GLY QA   . 48 . HA#  1 1 
       611 1 2 1 1 49 SER H    . 49 . HN   1 1 
       612 1 1 1 1 48 GLY H    . 48 . HN   1 1 
       612 1 2 1 1 49 SER QB   . 49 . HB#  1 1 
       613 1 1 1 1 49 SER HA   . 49 . HA   1 1 
       613 1 2 1 1 49 SER HB3  . 49 . HB1  1 1 
       614 1 1 1 1 49 SER HA   . 49 . HA   1 1 
       614 1 2 1 1 49 SER HB2  . 49 . HB2  1 1 
       615 1 1 1 1 49 SER HA   . 49 . HA   1 1 
       615 1 2 1 1 50 VAL H    . 50 . HN   1 1 
       616 1 1 1 1 49 SER HB3  . 49 . HB1  1 1 
       616 1 2 1 1 50 VAL H    . 50 . HN   1 1 
       617 1 1 1 1 49 SER HB2  . 49 . HB2  1 1 
       617 1 2 1 1 50 VAL H    . 50 . HN   1 1 
       618 1 1 1 1 49 SER H    . 49 . HN   1 1 
       618 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       619 1 1 1 1 49 SER H    . 49 . HN   1 1 
       619 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       620 1 1 1 1 50 VAL H    . 50 . HN   1 1 
       620 1 2 1 1 50 VAL HB   . 50 . HB   1 1 
       621 1 1 1 1 50 VAL H    . 50 . HN   1 1 
       621 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       622 1 1 1 1 50 VAL H    . 50 . HN   1 1 
       622 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       623 1 1 1 1 50 VAL HA   . 50 . HA   1 1 
       623 1 2 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       624 1 1 1 1 50 VAL HA   . 50 . HA   1 1 
       624 1 2 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       625 1 1 1 1 50 VAL H    . 50 . HN   1 1 
       625 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       626 1 1 1 1 50 VAL HA   . 50 . HA   1 1 
       626 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       627 1 1 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       627 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       628 1 1 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       628 1 2 1 1 51 TYR H    . 51 . HN   1 1 
       629 1 1 1 1 50 VAL HA   . 50 . HA   1 1 
       629 1 2 1 1 51 TYR QB   . 51 . HB#  1 1 
       630 1 1 1 1 50 VAL MG1  . 50 . HG1# 1 1 
       630 1 2 1 1 51 TYR HA   . 51 . HA   1 1 
       631 1 1 1 1 50 VAL MG2  . 50 . HG2# 1 1 
       631 1 2 1 1 51 TYR HA   . 51 . HA   1 1 
       632 1 1 1 1 51 TYR H    . 51 . HN   1 1 
       632 1 2 1 1 51 TYR QB   . 51 . HB#  1 1 
       633 1 1 1 1 51 TYR HB2  . 51 . HB2  1 1 
       633 1 2 1 1 51 TYR QE   . 51 . HE#  1 1 
       634 1 1 1 1 51 TYR H    . 51 . HN   1 1 
       634 1 2 1 1 51 TYR QD   . 51 . HD#  1 1 
       635 1 1 1 1 51 TYR HA   . 51 . HA   1 1 
       635 1 2 1 1 51 TYR HB2  . 51 . HB2  1 1 
       636 1 1 1 1 51 TYR HA   . 51 . HA   1 1 
       636 1 2 1 1 51 TYR HB3  . 51 . HB1  1 1 
       637 1 1 1 1 51 TYR QD   . 51 . HD#  1 1 
       637 1 2 1 1 52 ALA H    . 52 . HN   1 1 
       638 1 1 1 1 51 TYR HA   . 51 . HA   1 1 
       638 1 2 1 1 52 ALA H    . 52 . HN   1 1 
       639 1 1 1 1 51 TYR HB3  . 51 . HB1  1 1 
       639 1 2 1 1 52 ALA H    . 52 . HN   1 1 
       640 1 1 1 1 51 TYR HB2  . 51 . HB2  1 1 
       640 1 2 1 1 52 ALA H    . 52 . HN   1 1 
       641 1 1 1 1 51 TYR QD   . 51 . HD#  1 1 
       641 1 2 1 1 53 GLU QG   . 53 . HG#  1 1 
       642 1 1 1 1 51 TYR QD   . 51 . HD#  1 1 
       642 1 2 1 1 53 GLU HB2  . 53 . HB2  1 1 
       643 1 1 1 1 51 TYR QE   . 51 . HE#  1 1 
       643 1 2 1 1 53 GLU HA   . 53 . HA   1 1 
       644 1 1 1 1 51 TYR QE   . 51 . HE#  1 1 
       644 1 2 1 1 53 GLU QG   . 53 . HG#  1 1 
       645 1 1 1 1 51 TYR QE   . 51 . HE#  1 1 
       645 1 2 1 1 53 GLU HB2  . 53 . HB2  1 1 
       646 1 1 1 1 51 TYR QE   . 51 . HE#  1 1 
       646 1 2 1 1 53 GLU HB3  . 53 . HB1  1 1 
       647 1 1 1 1 51 TYR QD   . 51 . HD#  1 1 
       647 1 2 1 1 53 GLU HB3  . 53 . HB1  1 1 
       648 1 1 1 1 52 ALA H    . 52 . HN   1 1 
       648 1 2 1 1 52 ALA MB   . 52 . HB#  1 1 
       649 1 1 1 1 52 ALA MB   . 52 . HB#  1 1 
       649 1 2 1 1 53 GLU H    . 53 . HN   1 1 
       650 1 1 1 1 53 GLU H    . 53 . HN   1 1 
       650 1 2 1 1 53 GLU QG   . 53 . HG#  1 1 
       651 1 1 1 1 53 GLU QG   . 53 . HG#  1 1 
       651 1 2 1 1 54 GLU H    . 54 . HN   1 1 
       652 1 1 1 1 53 GLU HB3  . 53 . HB1  1 1 
       652 1 2 1 1 54 GLU H    . 54 . HN   1 1 
       653 1 1 1 1 53 GLU HB2  . 53 . HB2  1 1 
       653 1 2 1 1 54 GLU H    . 54 . HN   1 1 
       654 1 1 1 1 53 GLU HA   . 53 . HA   1 1 
       654 1 2 1 1 54 GLU H    . 54 . HN   1 1 
       655 1 1 1 1 54 GLU H    . 54 . HN   1 1 
       655 1 2 1 1 55 VAL H    . 55 . HN   1 1 
       656 1 1 1 1 54 GLU H    . 54 . HN   1 1 
       656 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       657 1 1 1 1 54 GLU HA   . 54 . HA   1 1 
       657 1 2 1 1 55 VAL H    . 55 . HN   1 1 
       658 1 1 1 1 54 GLU QG   . 54 . HG#  1 1 
       658 1 2 1 1 55 VAL H    . 55 . HN   1 1 
       659 1 1 1 1 55 VAL H    . 55 . HN   1 1 
       659 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       660 1 1 1 1 55 VAL HA   . 55 . HA   1 1 
       660 1 2 1 1 55 VAL QG   . 55 . HG## 1 1 
       661 1 1 1 1 55 VAL HA   . 55 . HA   1 1 
       661 1 2 1 1 56 LYS H    . 56 . HN   1 1 
       662 1 1 1 1 55 VAL QG   . 55 . HG## 1 1 
       662 1 2 1 1 56 LYS H    . 56 . HN   1 1 
       663 1 1 1 1 56 LYS HA   . 56 . HA   1 1 
       663 1 2 1 1 56 LYS QB   . 56 . HB#  1 1 
       664 1 1 1 1 56 LYS H    . 56 . HN   1 1 
       664 1 2 1 1 57 PRO QD   . 57 . HD#  1 1 
       665 1 1 1 1 56 LYS HA   . 56 . HA   1 1 
       665 1 2 1 1 57 PRO HD2  . 57 . HD2  1 1 
       666 1 1 1 1 56 LYS HA   . 56 . HA   1 1 
       666 1 2 1 1 57 PRO HD3  . 57 . HD1  1 1 
       667 1 1 1 1 57 PRO HA   . 57 . HA   1 1 
       667 1 2 1 1 58 ASP H    . 58 . HN   1 1 
       668 1 1 1 1 57 PRO QB   . 57 . HB#  1 1 
       668 1 2 1 1 58 ASP H    . 58 . HN   1 1 
       669 1 1 1 1 58 ASP H    . 58 . HN   1 1 
       669 1 2 1 1 58 ASP HB2  . 58 . HB2  1 1 
       670 1 1 1 1 58 ASP H    . 58 . HN   1 1 
       670 1 2 1 1 58 ASP HB3  . 58 . HB1  1 1 
       671 1 1 1 1 58 ASP HB2  . 58 . HB2  1 1 
       671 1 2 1 1 60 SER H    . 60 . HN   1 1 
       672 1 1 1 1 58 ASP HB3  . 58 . HB1  1 1 
       672 1 2 1 1 60 SER H    . 60 . HN   1 1 
       673 1 1 1 1 59 PRO HA   . 59 . HA   1 1 
       673 1 2 1 1 60 SER H    . 60 . HN   1 1 
       674 1 1 1 1 59 PRO QB   . 59 . HB#  1 1 
       674 1 2 1 1 60 SER H    . 60 . HN   1 1 
       675 1 1 1 1 60 SER H    . 60 . HN   1 1 
       675 1 2 1 1 61 ASN H    . 61 . HN   1 1 
       676 1 1 1 1 60 SER HB2  . 60 . HB2  1 1 
       676 1 2 1 1 61 ASN H    . 61 . HN   1 1 
       677 1 1 1 1 60 SER HB3  . 60 . HB1  1 1 
       677 1 2 1 1 61 ASN H    . 61 . HN   1 1 
       678 1 1 1 1 61 ASN HA   . 61 . HA   1 1 
       678 1 2 1 1 62 LYS H    . 62 . HN   1 1 
       679 1 1 1 1 61 ASN HB3  . 61 . HB1  1 1 
       679 1 2 1 1 62 LYS H    . 62 . HN   1 1 
       680 1 1 1 1 61 ASN HB2  . 61 . HB2  1 1 
       680 1 2 1 1 62 LYS H    . 62 . HN   1 1 
       681 1 1 1 1 62 LYS HA   . 62 . HA   1 1 
       681 1 2 1 1 63 LYS H    . 63 . HN   1 1 
       682 1 1 1 1 63 LYS HA   . 63 . HA   1 1 
       682 1 2 1 1 64 THR H    . 64 . HN   1 1 
       683 1 1 1 1 64 THR H    . 64 . HN   1 1 
       683 1 2 1 1 64 THR MG   . 64 . HG2# 1 1 
       684 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       684 1 2 1 1 65 THR H    . 65 . HN   1 1 
       685 1 1 1 1 64 THR HB   . 64 . HB   1 1 
       685 1 2 1 1 65 THR H    . 65 . HN   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . 5.0 1.8 5.0 1 1 
         2 1 . . . . . 6.0 1.8 6.0 1 1 
         3 1 . . . . . 4.5 1.8 4.5 1 1 
         4 1 . . . . . 2.8 1.8 2.8 1 1 
         5 1 . . . . . 4.5 1.8 4.5 1 1 
         6 1 . . . . . 4.5 1.8 4.5 1 1 
         7 1 . . . . . 2.8 1.8 2.8 1 1 
         8 1 . . . . . 4.5 1.8 4.5 1 1 
         9 1 . . . . . 5.0 1.8 5.0 1 1 
        10 1 . . . . . 4.5 1.8 4.5 1 1 
        11 1 . . . . . 3.4 1.8 3.4 1 1 
        12 1 . . . . . 3.4 1.8 3.4 1 1 
        13 1 . . . . . 4.5 1.8 4.5 1 1 
        14 1 . . . . . 2.8 1.8 2.8 1 1 
        15 1 . . . . . 4.5 1.8 4.5 1 1 
        16 1 . . . . . 3.4 1.8 3.4 1 1 
        17 1 . . . . . 2.8 1.8 2.8 1 1 
        18 1 . . . . . 4.5 1.8 4.5 1 1 
        19 1 . . . . . 4.5 1.8 4.5 1 1 
        20 1 . . . . . 5.0 1.8 5.0 1 1 
        21 1 . . . . . 5.0 1.8 5.0 1 1 
        22 1 . . . . . 5.0 1.8 5.0 1 1 
        23 1 . . . . . 6.0 1.8 6.0 1 1 
        24 1 . . . . . 5.0 1.8 5.0 1 1 
        25 1 . . . . . 3.4 1.8 3.4 1 1 
        26 1 . . . . . 3.4 1.8 3.4 1 1 
        27 1 . . . . . 4.5 1.8 4.5 1 1 
        28 1 . . . . . 4.5 1.8 4.5 1 1 
        29 1 . . . . . 3.4 1.8 3.4 1 1 
        30 1 . . . . . 4.5 1.8 4.5 1 1 
        31 1 . . . . . 3.4 1.8 3.4 1 1 
        32 1 . . . . . 4.5 1.8 4.5 1 1 
        33 1 . . . . . 4.5 1.8 4.5 1 1 
        34 1 . . . . . 4.5 1.8 4.5 1 1 
        35 1 . . . . . 5.0 1.8 5.0 1 1 
        36 1 . . . . . 3.4 1.8 3.4 1 1 
        37 1 . . . . . 6.0 1.8 6.0 1 1 
        38 1 . . . . . 3.4 1.8 3.4 1 1 
        39 1 . . . . . 3.4 1.8 3.4 1 1 
        40 1 . . . . . 3.4 1.8 3.4 1 1 
        41 1 . . . . . 4.5 1.8 4.5 1 1 
        42 1 . . . . . 3.4 1.8 3.4 1 1 
        43 1 . . . . . 3.4 1.8 3.4 1 1 
        44 1 . . . . . 4.5 1.8 4.5 1 1 
        45 1 . . . . . 4.5 1.8 4.5 1 1 
        46 1 . . . . . 6.0 1.8 6.0 1 1 
        47 1 . . . . . 5.0 1.8 5.0 1 1 
        48 1 . . . . . 5.0 1.8 5.0 1 1 
        49 1 . . . . . 5.0 1.8 5.0 1 1 
        50 1 . . . . . 6.0 1.8 6.0 1 1 
        51 1 . . . . . 6.0 1.8 6.0 1 1 
        52 1 . . . . . 4.5 1.8 4.5 1 1 
        53 1 . . . . . 6.0 1.8 6.0 1 1 
        54 1 . . . . . 5.0 1.8 5.0 1 1 
        55 1 . . . . . 6.0 1.8 6.0 1 1 
        56 1 . . . . . 4.5 1.8 4.5 1 1 
        57 1 . . . . . 6.0 1.8 6.0 1 1 
        58 1 . . . . . 4.5 1.8 4.5 1 1 
        59 1 . . . . . 6.0 1.8 6.0 1 1 
        60 1 . . . . . 5.0 1.8 5.0 1 1 
        61 1 . . . . . 2.8 1.8 2.8 1 1 
        62 1 . . . . . 3.4 1.8 3.4 1 1 
        63 1 . . . . . 2.8 1.8 2.8 1 1 
        64 1 . . . . . 4.5 1.8 4.5 1 1 
        65 1 . . . . . 6.0 1.8 6.0 1 1 
        66 1 . . . . . 4.5 1.8 4.5 1 1 
        67 1 . . . . . 4.5 1.8 4.5 1 1 
        68 1 . . . . . 3.4 1.8 3.4 1 1 
        69 1 . . . . . 4.5 1.8 4.5 1 1 
        70 1 . . . . . 6.0 1.8 6.0 1 1 
        71 1 . . . . . 3.4 1.8 3.4 1 1 
        72 1 . . . . . 4.5 1.8 4.5 1 1 
        73 1 . . . . . 4.5 1.8 4.5 1 1 
        74 1 . . . . . 3.4 1.8 3.4 1 1 
        75 1 . . . . . 6.0 1.8 6.0 1 1 
        76 1 . . . . . 2.8 1.8 2.8 1 1 
        77 1 . . . . . 6.0 1.8 6.0 1 1 
        78 1 . . . . . 4.5 1.8 4.5 1 1 
        79 1 . . . . . 6.0 1.8 6.0 1 1 
        80 1 . . . . . 4.5 1.8 4.5 1 1 
        81 1 . . . . . 4.5 1.8 4.5 1 1 
        82 1 . . . . . 3.4 1.8 3.4 1 1 
        83 1 . . . . . 5.0 1.8 5.0 1 1 
        84 1 . . . . . 5.0 1.8 5.0 1 1 
        85 1 . . . . . 5.0 1.8 5.0 1 1 
        86 1 . . . . . 5.0 1.8 5.0 1 1 
        87 1 . . . . . 4.5 1.8 4.5 1 1 
        88 1 . . . . . 4.5 1.8 4.5 1 1 
        89 1 . . . . . 4.5 1.8 4.5 1 1 
        90 1 . . . . . 4.5 1.8 4.5 1 1 
        91 1 . . . . . 3.4 1.8 3.4 1 1 
        92 1 . . . . . 6.0 1.8 6.0 1 1 
        93 1 . . . . . 6.0 1.8 6.0 1 1 
        94 1 . . . . . 6.0 1.8 6.0 1 1 
        95 1 . . . . . 3.4 1.8 3.4 1 1 
        96 1 . . . . . 6.0 1.8 6.0 1 1 
        97 1 . . . . . 4.5 1.8 4.5 1 1 
        98 1 . . . . . 4.5 1.8 4.5 1 1 
        99 1 . . . . . 5.0 1.8 5.0 1 1 
       100 1 . . . . . 4.5 1.8 4.5 1 1 
       101 1 . . . . . 4.5 1.8 4.5 1 1 
       102 1 . . . . . 6.0 1.8 6.0 1 1 
       103 1 . . . . . 3.4 1.8 3.4 1 1 
       104 1 . . . . . 3.4 1.8 3.4 1 1 
       105 1 . . . . . 6.0 1.8 6.0 1 1 
       106 1 . . . . . 4.5 1.8 4.5 1 1 
       107 1 . . . . . 4.5 1.8 4.5 1 1 
       108 1 . . . . . 4.5 1.8 4.5 1 1 
       109 1 . . . . . 4.5 1.8 4.5 1 1 
       110 1 . . . . . 4.5 1.8 4.5 1 1 
       111 1 . . . . . 6.0 1.8 6.0 1 1 
       112 1 . . . . . 6.0 1.8 6.0 1 1 
       113 1 . . . . . 5.0 1.8 5.0 1 1 
       114 1 . . . . . 5.0 1.8 5.0 1 1 
       115 1 . . . . . 2.8 1.8 2.8 1 1 
       116 1 . . . . . 3.4 1.8 3.4 1 1 
       117 1 . . . . . 4.5 1.8 4.5 1 1 
       118 1 . . . . . 4.5 1.8 4.5 1 1 
       119 1 . . . . . 5.0 1.8 5.0 1 1 
       120 1 . . . . . 4.5 1.8 4.5 1 1 
       121 1 . . . . . 4.5 1.8 4.5 1 1 
       122 1 . . . . . 6.0 1.8 6.0 1 1 
       123 1 . . . . . 6.0 1.8 6.0 1 1 
       124 1 . . . . . 4.5 1.8 4.5 1 1 
       125 1 . . . . . 5.0 1.8 5.0 1 1 
       126 1 . . . . . 6.0 1.8 6.0 1 1 
       127 1 . . . . . 3.4 1.8 3.4 1 1 
       128 1 . . . . . 6.0 1.8 6.0 1 1 
       129 1 . . . . . 6.0 1.8 6.0 1 1 
       130 1 . . . . . 4.5 1.8 4.5 1 1 
       131 1 . . . . . 3.4 1.8 3.4 1 1 
       132 1 . . . . . 3.4 1.8 3.4 1 1 
       133 1 . . . . . 2.8 1.8 2.8 1 1 
       134 1 . . . . . 5.0 1.8 5.0 1 1 
       135 1 . . . . . 4.5 1.8 4.5 1 1 
       136 1 . . . . . 4.5 1.8 4.5 1 1 
       137 1 . . . . . 3.4 1.8 3.4 1 1 
       138 1 . . . . . 3.4 1.8 3.4 1 1 
       139 1 . . . . . 6.0 1.8 6.0 1 1 
       140 1 . . . . . 4.5 1.8 4.5 1 1 
       141 1 . . . . . 6.0 1.8 6.0 1 1 
       142 1 . . . . . 6.0 1.8 6.0 1 1 
       143 1 . . . . . 4.5 1.8 4.5 1 1 
       144 1 . . . . . 4.5 1.8 4.5 1 1 
       145 1 . . . . . 3.4 1.8 3.4 1 1 
       146 1 . . . . . 4.5 1.8 4.5 1 1 
       147 1 . . . . . 6.0 1.8 6.0 1 1 
       148 1 . . . . . 2.8 1.8 2.8 1 1 
       149 1 . . . . . 3.4 1.8 3.4 1 1 
       150 1 . . . . . 6.0 1.8 6.0 1 1 
       151 1 . . . . . 4.5 1.8 4.5 1 1 
       152 1 . . . . . 3.4 1.8 3.4 1 1 
       153 1 . . . . . 4.5 1.8 4.5 1 1 
       154 1 . . . . . 4.5 1.8 4.5 1 1 
       155 1 . . . . . 3.4 1.8 3.4 1 1 
       156 1 . . . . . 6.0 1.8 6.0 1 1 
       157 1 . . . . . 3.4 1.8 3.4 1 1 
       158 1 . . . . . 4.5 1.8 4.5 1 1 
       159 1 . . . . . 3.4 1.8 3.4 1 1 
       160 1 . . . . . 3.4 1.8 3.4 1 1 
       161 1 . . . . . 2.8 1.8 2.8 1 1 
       162 1 . . . . . 3.4 1.8 3.4 1 1 
       163 1 . . . . . 5.0 1.8 5.0 1 1 
       164 1 . . . . . 2.8 1.8 2.8 1 1 
       165 1 . . . . . 4.5 1.8 4.5 1 1 
       166 1 . . . . . 6.0 1.8 6.0 1 1 
       167 1 . . . . . 5.0 1.8 5.0 1 1 
       168 1 . . . . . 6.0 1.8 6.0 1 1 
       169 1 . . . . . 4.5 1.8 4.5 1 1 
       170 1 . . . . . 4.5 1.8 4.5 1 1 
       171 1 . . . . . 2.8 1.8 2.8 1 1 
       172 1 . . . . . 4.5 1.8 4.5 1 1 
       173 1 . . . . . 4.5 1.8 4.5 1 1 
       174 1 . . . . . 3.4 1.8 3.4 1 1 
       175 1 . . . . . 3.4 1.8 3.4 1 1 
       176 1 . . . . . 4.5 1.8 4.5 1 1 
       177 1 . . . . . 3.4 1.8 3.4 1 1 
       178 1 . . . . . 3.4 1.8 3.4 1 1 
       179 1 . . . . . 2.8 1.8 2.8 1 1 
       180 1 . . . . . 4.5 1.8 4.5 1 1 
       181 1 . . . . . 6.0 1.8 6.0 1 1 
       182 1 . . . . . 3.4 1.8 3.4 1 1 
       183 1 . . . . . 6.0 1.8 6.0 1 1 
       184 1 . . . . . 6.0 1.8 6.0 1 1 
       185 1 . . . . . 3.4 1.8 3.4 1 1 
       186 1 . . . . . 3.4 1.8 3.4 1 1 
       187 1 . . . . . 6.0 1.8 6.0 1 1 
       188 1 . . . . . 3.4 1.8 3.4 1 1 
       189 1 . . . . . 4.5 1.8 4.5 1 1 
       190 1 . . . . . 3.4 1.8 3.4 1 1 
       191 1 . . . . . 2.8 1.8 2.8 1 1 
       192 1 . . . . . 5.0 1.8 5.0 1 1 
       193 1 . . . . . 6.0 1.8 6.0 1 1 
       194 1 . . . . . 5.0 1.8 5.0 1 1 
       195 1 . . . . . 6.0 1.8 6.0 1 1 
       196 1 . . . . . 6.0 1.8 6.0 1 1 
       197 1 . . . . . 6.0 1.8 6.0 1 1 
       198 1 . . . . . 6.0 1.8 6.0 1 1 
       199 1 . . . . . 6.0 1.8 6.0 1 1 
       200 1 . . . . . 4.5 1.8 4.5 1 1 
       201 1 . . . . . 6.0 1.8 6.0 1 1 
       202 1 . . . . . 5.0 1.8 5.0 1 1 
       203 1 . . . . . 5.0 1.8 5.0 1 1 
       204 1 . . . . . 6.0 1.8 6.0 1 1 
       205 1 . . . . . 3.4 1.8 3.4 1 1 
       206 1 . . . . . 3.4 1.8 3.4 1 1 
       207 1 . . . . . 2.8 1.8 2.8 1 1 
       208 1 . . . . . 2.8 1.8 2.8 1 1 
       209 1 . . . . . 6.0 1.8 6.0 1 1 
       210 1 . . . . . 4.5 1.8 4.5 1 1 
       211 1 . . . . . 4.5 1.8 4.5 1 1 
       212 1 . . . . . 4.5 1.8 4.5 1 1 
       213 1 . . . . . 3.4 1.8 3.4 1 1 
       214 1 . . . . . 4.5 1.8 4.5 1 1 
       215 1 . . . . . 3.4 1.8 3.4 1 1 
       216 1 . . . . . 3.4 1.8 3.4 1 1 
       217 1 . . . . . 4.5 1.8 4.5 1 1 
       218 1 . . . . . 3.4 1.8 3.4 1 1 
       219 1 . . . . . 3.4 1.8 3.4 1 1 
       220 1 . . . . . 3.4 1.8 3.4 1 1 
       221 1 . . . . . 3.4 1.8 3.4 1 1 
       222 1 . . . . . 3.4 1.8 3.4 1 1 
       223 1 . . . . . 6.0 1.8 6.0 1 1 
       224 1 . . . . . 4.5 1.8 4.5 1 1 
       225 1 . . . . . 6.0 1.8 6.0 1 1 
       226 1 . . . . . 5.0 1.8 5.0 1 1 
       227 1 . . . . . 4.5 1.8 4.5 1 1 
       228 1 . . . . . 3.4 1.8 3.4 1 1 
       229 1 . . . . . 2.8 1.8 2.8 1 1 
       230 1 . . . . . 4.5 1.8 4.5 1 1 
       231 1 . . . . . 3.4 1.8 3.4 1 1 
       232 1 . . . . . 6.0 1.8 6.0 1 1 
       233 1 . . . . . 6.0 1.8 6.0 1 1 
       234 1 . . . . . 6.0 1.8 6.0 1 1 
       235 1 . . . . . 5.0 1.8 5.0 1 1 
       236 1 . . . . . 5.0 1.8 5.0 1 1 
       237 1 . . . . . 6.0 1.8 6.0 1 1 
       238 1 . . . . . 6.0 1.8 6.0 1 1 
       239 1 . . . . . 4.5 1.8 4.5 1 1 
       240 1 . . . . . 6.0 1.8 6.0 1 1 
       241 1 . . . . . 5.0 1.8 5.0 1 1 
       242 1 . . . . . 4.5 1.8 4.5 1 1 
       243 1 . . . . . 4.5 1.8 4.5 1 1 
       244 1 . . . . . 3.4 1.8 3.4 1 1 
       245 1 . . . . . 2.8 1.8 2.8 1 1 
       246 1 . . . . . 4.5 1.8 4.5 1 1 
       247 1 . . . . . 6.0 1.8 6.0 1 1 
       248 1 . . . . . 4.5 1.8 4.5 1 1 
       249 1 . . . . . 4.5 1.8 4.5 1 1 
       250 1 . . . . . 6.0 1.8 6.0 1 1 
       251 1 . . . . . 4.5 1.8 4.5 1 1 
       252 1 . . . . . 5.0 1.8 5.0 1 1 
       253 1 . . . . . 5.0 1.8 5.0 1 1 
       254 1 . . . . . 5.0 1.8 5.0 1 1 
       255 1 . . . . . 6.0 1.8 6.0 1 1 
       256 1 . . . . . 4.5 1.8 4.5 1 1 
       257 1 . . . . . 5.0 1.8 5.0 1 1 
       258 1 . . . . . 5.0 1.8 5.0 1 1 
       259 1 . . . . . 3.4 1.8 3.4 1 1 
       260 1 . . . . . 4.5 1.8 4.5 1 1 
       261 1 . . . . . 5.0 1.8 5.0 1 1 
       262 1 . . . . . 5.0 1.8 5.0 1 1 
       263 1 . . . . . 2.8 1.8 2.8 1 1 
       264 1 . . . . . 5.0 1.8 5.0 1 1 
       265 1 . . . . . 5.0 1.8 5.0 1 1 
       266 1 . . . . . 3.4 1.8 3.4 1 1 
       267 1 . . . . . 3.4 1.8 3.4 1 1 
       268 1 . . . . . 6.0 1.8 6.0 1 1 
       269 1 . . . . . 4.5 1.8 4.5 1 1 
       270 1 . . . . . 2.8 1.8 2.8 1 1 
       271 1 . . . . . 5.0 1.8 5.0 1 1 
       272 1 . . . . . 5.0 1.8 5.0 1 1 
       273 1 . . . . . 6.0 1.8 6.0 1 1 
       274 1 . . . . . 4.5 1.8 4.5 1 1 
       275 1 . . . . . 3.4 1.8 3.4 1 1 
       276 1 . . . . . 3.4 1.8 3.4 1 1 
       277 1 . . . . . 5.0 1.8 5.0 1 1 
       278 1 . . . . . 5.0 1.8 5.0 1 1 
       279 1 . . . . . 2.8 1.8 2.8 1 1 
       280 1 . . . . . 3.4 1.8 3.4 1 1 
       281 1 . . . . . 2.8 1.8 2.8 1 1 
       282 1 . . . . . 4.5 1.8 4.5 1 1 
       283 1 . . . . . 3.4 1.8 3.4 1 1 
       284 1 . . . . . 4.5 1.8 4.5 1 1 
       285 1 . . . . . 5.0 1.8 5.0 1 1 
       286 1 . . . . . 6.0 1.8 6.0 1 1 
       287 1 . . . . . 5.0 1.8 5.0 1 1 
       288 1 . . . . . 5.0 1.8 5.0 1 1 
       289 1 . . . . . 6.0 1.8 6.0 1 1 
       290 1 . . . . . 5.0 1.8 5.0 1 1 
       291 1 . . . . . 4.5 1.8 4.5 1 1 
       292 1 . . . . . 6.0 1.8 6.0 1 1 
       293 1 . . . . . 6.0 1.8 6.0 1 1 
       294 1 . . . . . 6.0 1.8 6.0 1 1 
       295 1 . . . . . 6.0 1.8 6.0 1 1 
       296 1 . . . . . 5.0 1.8 5.0 1 1 
       297 1 . . . . . 5.0 1.8 5.0 1 1 
       298 1 . . . . . 4.5 1.8 4.5 1 1 
       299 1 . . . . . 4.5 1.8 4.5 1 1 
       300 1 . . . . . 3.4 1.8 3.4 1 1 
       301 1 . . . . . 3.4 1.8 3.4 1 1 
       302 1 . . . . . 5.0 1.8 5.0 1 1 
       303 1 . . . . . 5.0 1.8 5.0 1 1 
       304 1 . . . . . 6.0 1.8 6.0 1 1 
       305 1 . . . . . 6.0 1.8 6.0 1 1 
       306 1 . . . . . 5.0 1.8 5.0 1 1 
       307 1 . . . . . 5.0 1.8 5.0 1 1 
       308 1 . . . . . 4.5 1.8 4.5 1 1 
       309 1 . . . . . 5.0 1.8 5.0 1 1 
       310 1 . . . . . 5.0 1.8 5.0 1 1 
       311 1 . . . . . 4.5 1.8 4.5 1 1 
       312 1 . . . . . 4.5 1.8 4.5 1 1 
       313 1 . . . . . 6.0 1.8 6.0 1 1 
       314 1 . . . . . 6.0 1.8 6.0 1 1 
       315 1 . . . . . 4.5 1.8 4.5 1 1 
       316 1 . . . . . 4.5 1.8 4.5 1 1 
       317 1 . . . . . 6.0 1.8 6.0 1 1 
       318 1 . . . . . 4.5 1.8 4.5 1 1 
       319 1 . . . . . 4.5 1.8 4.5 1 1 
       320 1 . . . . . 4.5 1.8 4.5 1 1 
       321 1 . . . . . 3.4 1.8 3.4 1 1 
       322 1 . . . . . 3.4 1.8 3.4 1 1 
       323 1 . . . . . 6.0 1.8 6.0 1 1 
       324 1 . . . . . 3.4 1.8 3.4 1 1 
       325 1 . . . . . 2.8 1.8 2.8 1 1 
       326 1 . . . . . 3.4 1.8 3.4 1 1 
       327 1 . . . . . 3.4 1.8 3.4 1 1 
       328 1 . . . . . 5.0 1.8 5.0 1 1 
       329 1 . . . . . 4.5 1.8 4.5 1 1 
       330 1 . . . . . 6.0 1.8 6.0 1 1 
       331 1 . . . . . 6.0 1.8 6.0 1 1 
       332 1 . . . . . 6.0 1.8 6.0 1 1 
       333 1 . . . . . 6.0 1.8 6.0 1 1 
       334 1 . . . . . 3.4 1.8 3.4 1 1 
       335 1 . . . . . 3.4 1.8 3.4 1 1 
       336 1 . . . . . 3.4 1.8 3.4 1 1 
       337 1 . . . . . 4.5 1.8 4.5 1 1 
       338 1 . . . . . 2.8 1.8 2.8 1 1 
       339 1 . . . . . 4.5 1.8 4.5 1 1 
       340 1 . . . . . 4.5 1.8 4.5 1 1 
       341 1 . . . . . 4.5 1.8 4.5 1 1 
       342 1 . . . . . 3.4 1.8 3.4 1 1 
       343 1 . . . . . 6.0 1.8 6.0 1 1 
       344 1 . . . . . 6.0 1.8 6.0 1 1 
       345 1 . . . . . 4.5 1.8 4.5 1 1 
       346 1 . . . . . 4.5 1.8 4.5 1 1 
       347 1 . . . . . 5.0 1.8 5.0 1 1 
       348 1 . . . . . 3.4 1.8 3.4 1 1 
       349 1 . . . . . 2.8 1.8 2.8 1 1 
       350 1 . . . . . 3.4 1.8 3.4 1 1 
       351 1 . . . . . 3.4 1.8 3.4 1 1 
       352 1 . . . . . 3.4 1.8 3.4 1 1 
       353 1 . . . . . 4.5 1.8 4.5 1 1 
       354 1 . . . . . 6.0 1.8 6.0 1 1 
       355 1 . . . . . 6.0 1.8 6.0 1 1 
       356 1 . . . . . 4.5 1.8 4.5 1 1 
       357 1 . . . . . 3.4 1.8 3.4 1 1 
       358 1 . . . . . 4.5 1.8 4.5 1 1 
       359 1 . . . . . 6.0 1.8 6.0 1 1 
       360 1 . . . . . 2.8 1.8 2.8 1 1 
       361 1 . . . . . 5.0 1.8 5.0 1 1 
       362 1 . . . . . 4.5 1.8 4.5 1 1 
       363 1 . . . . . 6.0 1.8 6.0 1 1 
       364 1 . . . . . 6.0 1.8 6.0 1 1 
       365 1 . . . . . 6.0 1.8 6.0 1 1 
       366 1 . . . . . 3.4 1.8 3.4 1 1 
       367 1 . . . . . 6.0 1.8 6.0 1 1 
       368 1 . . . . . 6.0 1.8 6.0 1 1 
       369 1 . . . . . 2.8 1.8 2.8 1 1 
       370 1 . . . . . 3.4 1.8 3.4 1 1 
       371 1 . . . . . 3.4 1.8 3.4 1 1 
       372 1 . . . . . 3.4 1.8 3.4 1 1 
       373 1 . . . . . 4.5 1.8 4.5 1 1 
       374 1 . . . . . 4.5 1.8 4.5 1 1 
       375 1 . . . . . 4.5 1.8 4.5 1 1 
       376 1 . . . . . 3.4 1.8 3.4 1 1 
       377 1 . . . . . 6.0 1.8 6.0 1 1 
       378 1 . . . . . 4.5 1.8 4.5 1 1 
       379 1 . . . . . 3.4 1.8 3.4 1 1 
       380 1 . . . . . 4.5 1.8 4.5 1 1 
       381 1 . . . . . 3.4 1.8 3.4 1 1 
       382 1 . . . . . 2.8 1.8 2.8 1 1 
       383 1 . . . . . 4.5 1.8 4.5 1 1 
       384 1 . . . . . 4.5 1.8 4.5 1 1 
       385 1 . . . . . 4.5 1.8 4.5 1 1 
       386 1 . . . . . 4.5 1.8 4.5 1 1 
       387 1 . . . . . 3.4 1.8 3.4 1 1 
       388 1 . . . . . 3.4 1.8 3.4 1 1 
       389 1 . . . . . 4.5 1.8 4.5 1 1 
       390 1 . . . . . 4.5 1.8 4.5 1 1 
       391 1 . . . . . 5.0 1.8 5.0 1 1 
       392 1 . . . . . 6.0 1.8 6.0 1 1 
       393 1 . . . . . 3.4 1.8 3.4 1 1 
       394 1 . . . . . 3.4 1.8 3.4 1 1 
       395 1 . . . . . 3.4 1.8 3.4 1 1 
       396 1 . . . . . 6.0 1.8 6.0 1 1 
       397 1 . . . . . 4.5 1.8 4.5 1 1 
       398 1 . . . . . 3.4 1.8 3.4 1 1 
       399 1 . . . . . 6.0 1.8 6.0 1 1 
       400 1 . . . . . 4.5 1.8 4.5 1 1 
       401 1 . . . . . 6.0 1.8 6.0 1 1 
       402 1 . . . . . 3.4 1.8 3.4 1 1 
       403 1 . . . . . 5.0 1.8 5.0 1 1 
       404 1 . . . . . 2.8 1.8 2.8 1 1 
       405 1 . . . . . 2.8 1.8 2.8 1 1 
       406 1 . . . . . 3.4 1.8 3.4 1 1 
       407 1 . . . . . 4.5 1.8 4.5 1 1 
       408 1 . . . . . 6.0 1.8 6.0 1 1 
       409 1 . . . . . 6.0 1.8 6.0 1 1 
       410 1 . . . . . 5.0 1.8 5.0 1 1 
       411 1 . . . . . 5.0 1.8 5.0 1 1 
       412 1 . . . . . 6.0 1.8 6.0 1 1 
       413 1 . . . . . 6.0 1.8 6.0 1 1 
       414 1 . . . . . 6.0 1.8 6.0 1 1 
       415 1 . . . . . 2.8 1.8 2.8 1 1 
       416 1 . . . . . 4.5 1.8 4.5 1 1 
       417 1 . . . . . 3.4 1.8 3.4 1 1 
       418 1 . . . . . 4.5 1.8 4.5 1 1 
       419 1 . . . . . 6.0 1.8 6.0 1 1 
       420 1 . . . . . 2.8 1.8 2.8 1 1 
       421 1 . . . . . 3.4 1.8 3.4 1 1 
       422 1 . . . . . 6.0 1.8 6.0 1 1 
       423 1 . . . . . 3.4 1.8 3.4 1 1 
       424 1 . . . . . 6.0 1.8 6.0 1 1 
       425 1 . . . . . 3.4 1.8 3.4 1 1 
       426 1 . . . . . 6.0 1.8 6.0 1 1 
       427 1 . . . . . 3.4 1.8 3.4 1 1 
       428 1 . . . . . 3.4 1.8 3.4 1 1 
       429 1 . . . . . 4.5 1.8 4.5 1 1 
       430 1 . . . . . 6.0 1.8 6.0 1 1 
       431 1 . . . . . 4.5 1.8 4.5 1 1 
       432 1 . . . . . 4.5 1.8 4.5 1 1 
       433 1 . . . . . 3.4 1.8 3.4 1 1 
       434 1 . . . . . 2.8 1.8 2.8 1 1 
       435 1 . . . . . 3.4 1.8 3.4 1 1 
       436 1 . . . . . 3.4 1.8 3.4 1 1 
       437 1 . . . . . 3.4 1.8 3.4 1 1 
       438 1 . . . . . 2.8 1.8 2.8 1 1 
       439 1 . . . . . 3.4 1.8 3.4 1 1 
       440 1 . . . . . 6.0 1.8 6.0 1 1 
       441 1 . . . . . 2.8 1.8 2.8 1 1 
       442 1 . . . . . 4.5 1.8 4.5 1 1 
       443 1 . . . . . 3.4 1.8 3.4 1 1 
       444 1 . . . . . 3.4 1.8 3.4 1 1 
       445 1 . . . . . 4.5 1.8 4.5 1 1 
       446 1 . . . . . 4.5 1.8 4.5 1 1 
       447 1 . . . . . 5.0 1.8 5.0 1 1 
       448 1 . . . . . 6.0 1.8 6.0 1 1 
       449 1 . . . . . 3.4 1.8 3.4 1 1 
       450 1 . . . . . 6.0 1.8 6.0 1 1 
       451 1 . . . . . 4.5 1.8 4.5 1 1 
       452 1 . . . . . 4.5 1.8 4.5 1 1 
       453 1 . . . . . 3.4 1.8 3.4 1 1 
       454 1 . . . . . 6.0 1.8 6.0 1 1 
       455 1 . . . . . 5.0 1.8 5.0 1 1 
       456 1 . . . . . 4.5 1.8 4.5 1 1 
       457 1 . . . . . 6.0 1.8 6.0 1 1 
       458 1 . . . . . 4.5 1.8 4.5 1 1 
       459 1 . . . . . 6.0 1.8 6.0 1 1 
       460 1 . . . . . 3.4 1.8 3.4 1 1 
       461 1 . . . . . 3.4 1.8 3.4 1 1 
       462 1 . . . . . 3.4 1.8 3.4 1 1 
       463 1 . . . . . 2.8 1.8 2.8 1 1 
       464 1 . . . . . 3.4 1.8 3.4 1 1 
       465 1 . . . . . 3.4 1.8 3.4 1 1 
       466 1 . . . . . 6.0 1.8 6.0 1 1 
       467 1 . . . . . 3.4 1.8 3.4 1 1 
       468 1 . . . . . 4.5 1.8 4.5 1 1 
       469 1 . . . . . 2.8 1.8 2.8 1 1 
       470 1 . . . . . 2.8 1.8 2.8 1 1 
       471 1 . . . . . 3.4 1.8 3.4 1 1 
       472 1 . . . . . 3.4 1.8 3.4 1 1 
       473 1 . . . . . 4.5 1.8 4.5 1 1 
       474 1 . . . . . 2.8 1.8 2.8 1 1 
       475 1 . . . . . 2.8 1.8 2.8 1 1 
       476 1 . . . . . 6.0 1.8 6.0 1 1 
       477 1 . . . . . 5.0 1.8 5.0 1 1 
       478 1 . . . . . 6.0 1.8 6.0 1 1 
       479 1 . . . . . 2.8 1.8 2.8 1 1 
       480 1 . . . . . 4.5 1.8 4.5 1 1 
       481 1 . . . . . 4.5 1.8 4.5 1 1 
       482 1 . . . . . 6.0 1.8 6.0 1 1 
       483 1 . . . . . 6.0 1.8 6.0 1 1 
       484 1 . . . . . 4.5 1.8 4.5 1 1 
       485 1 . . . . . 4.5 1.8 4.5 1 1 
       486 1 . . . . . 4.5 1.8 4.5 1 1 
       487 1 . . . . . 5.0 1.8 5.0 1 1 
       488 1 . . . . . 5.0 1.8 5.0 1 1 
       489 1 . . . . . 2.8 1.8 2.8 1 1 
       490 1 . . . . . 6.0 1.8 6.0 1 1 
       491 1 . . . . . 6.0 1.8 6.0 1 1 
       492 1 . . . . . 6.0 1.8 6.0 1 1 
       493 1 . . . . . 3.4 1.8 3.4 1 1 
       494 1 . . . . . 2.8 1.8 2.8 1 1 
       495 1 . . . . . 4.5 1.8 4.5 1 1 
       496 1 . . . . . 6.0 1.8 6.0 1 1 
       497 1 . . . . . 6.0 1.8 6.0 1 1 
       498 1 . . . . . 6.0 1.8 6.0 1 1 
       499 1 . . . . . 4.5 1.8 4.5 1 1 
       500 1 . . . . . 4.5 1.8 4.5 1 1 
       501 1 . . . . . 6.0 1.8 6.0 1 1 
       502 1 . . . . . 6.0 1.8 6.0 1 1 
       503 1 . . . . . 3.4 1.8 3.4 1 1 
       504 1 . . . . . 6.0 1.8 6.0 1 1 
       505 1 . . . . . 4.5 1.8 4.5 1 1 
       506 1 . . . . . 5.0 1.8 5.0 1 1 
       507 1 . . . . . 5.0 1.8 5.0 1 1 
       508 1 . . . . . 6.0 1.8 6.0 1 1 
       509 1 . . . . . 6.0 1.8 6.0 1 1 
       510 1 . . . . . 3.4 1.8 3.4 1 1 
       511 1 . . . . . 3.4 1.8 3.4 1 1 
       512 1 . . . . . 3.4 1.8 3.4 1 1 
       513 1 . . . . . 2.8 1.8 2.8 1 1 
       514 1 . . . . . 4.5 1.8 4.5 1 1 
       515 1 . . . . . 2.8 1.8 2.8 1 1 
       516 1 . . . . . 3.4 1.8 3.4 1 1 
       517 1 . . . . . 4.5 1.8 4.5 1 1 
       518 1 . . . . . 3.4 1.8 3.4 1 1 
       519 1 . . . . . 6.0 1.8 6.0 1 1 
       520 1 . . . . . 6.0 1.8 6.0 1 1 
       521 1 . . . . . 4.5 1.8 4.5 1 1 
       522 1 . . . . . 3.4 1.8 3.4 1 1 
       523 1 . . . . . 4.5 1.8 4.5 1 1 
       524 1 . . . . . 3.4 1.8 3.4 1 1 
       525 1 . . . . . 4.5 1.8 4.5 1 1 
       526 1 . . . . . 4.5 1.8 4.5 1 1 
       527 1 . . . . . 6.0 1.8 6.0 1 1 
       528 1 . . . . . 6.0 1.8 6.0 1 1 
       529 1 . . . . . 6.0 1.8 6.0 1 1 
       530 1 . . . . . 6.0 1.8 6.0 1 1 
       531 1 . . . . . 6.0 1.8 6.0 1 1 
       532 1 . . . . . 6.0 1.8 6.0 1 1 
       533 1 . . . . . 6.0 1.8 6.0 1 1 
       534 1 . . . . . 5.0 1.8 5.0 1 1 
       535 1 . . . . . 5.0 1.8 5.0 1 1 
       536 1 . . . . . 5.0 1.8 5.0 1 1 
       537 1 . . . . . 5.0 1.8 5.0 1 1 
       538 1 . . . . . 5.0 1.8 5.0 1 1 
       539 1 . . . . . 6.0 1.8 6.0 1 1 
       540 1 . . . . . 6.0 1.8 6.0 1 1 
       541 1 . . . . . 5.0 1.8 5.0 1 1 
       542 1 . . . . . 6.0 1.8 6.0 1 1 
       543 1 . . . . . 6.0 1.8 6.0 1 1 
       544 1 . . . . . 3.4 1.8 3.4 1 1 
       545 1 . . . . . 4.5 1.8 4.5 1 1 
       546 1 . . . . . 4.5 1.8 4.5 1 1 
       547 1 . . . . . 6.0 1.8 6.0 1 1 
       548 1 . . . . . 6.0 1.8 6.0 1 1 
       549 1 . . . . . 6.0 1.8 6.0 1 1 
       550 1 . . . . . 3.4 1.8 3.4 1 1 
       551 1 . . . . . 4.5 1.8 4.5 1 1 
       552 1 . . . . . 4.5 1.8 4.5 1 1 
       553 1 . . . . . 4.5 1.8 4.5 1 1 
       554 1 . . . . . 3.4 1.8 3.4 1 1 
       555 1 . . . . . 6.0 1.8 6.0 1 1 
       556 1 . . . . . 6.0 1.8 6.0 1 1 
       557 1 . . . . . 6.0 1.8 6.0 1 1 
       558 1 . . . . . 2.8 1.8 2.8 1 1 
       559 1 . . . . . 3.4 1.8 3.4 1 1 
       560 1 . . . . . 6.0 1.8 6.0 1 1 
       561 1 . . . . . 5.0 1.8 5.0 1 1 
       562 1 . . . . . 5.0 1.8 5.0 1 1 
       563 1 . . . . . 4.5 1.8 4.5 1 1 
       564 1 . . . . . 4.5 1.8 4.5 1 1 
       565 1 . . . . . 5.0 1.8 5.0 1 1 
       566 1 . . . . . 3.4 1.8 3.4 1 1 
       567 1 . . . . . 3.4 1.8 3.4 1 1 
       568 1 . . . . . 3.4 1.8 3.4 1 1 
       569 1 . . . . . 6.0 1.8 6.0 1 1 
       570 1 . . . . . 6.0 1.8 6.0 1 1 
       571 1 . . . . . 4.5 1.8 4.5 1 1 
       572 1 . . . . . 5.0 1.8 5.0 1 1 
       573 1 . . . . . 4.5 1.8 4.5 1 1 
       574 1 . . . . . 4.5 1.8 4.5 1 1 
       575 1 . . . . . 4.5 1.8 4.5 1 1 
       576 1 . . . . . 6.0 1.8 6.0 1 1 
       577 1 . . . . . 6.0 1.8 6.0 1 1 
       578 1 . . . . . 4.5 1.8 4.5 1 1 
       579 1 . . . . . 4.5 1.8 4.5 1 1 
       580 1 . . . . . 4.5 1.8 4.5 1 1 
       581 1 . . . . . 5.0 1.8 5.0 1 1 
       582 1 . . . . . 5.0 1.8 5.0 1 1 
       583 1 . . . . . 3.4 1.8 3.4 1 1 
       584 1 . . . . . 4.5 1.8 4.5 1 1 
       585 1 . . . . . 6.0 1.8 6.0 1 1 
       586 1 . . . . . 6.0 1.8 6.0 1 1 
       587 1 . . . . . 2.8 1.8 2.8 1 1 
       588 1 . . . . . 3.4 1.8 3.4 1 1 
       589 1 . . . . . 3.4 1.8 3.4 1 1 
       590 1 . . . . . 4.5 1.8 4.5 1 1 
       591 1 . . . . . 4.5 1.8 4.5 1 1 
       592 1 . . . . . 5.0 1.8 5.0 1 1 
       593 1 . . . . . 4.5 1.8 4.5 1 1 
       594 1 . . . . . 6.0 1.8 6.0 1 1 
       595 1 . . . . . 6.0 1.8 6.0 1 1 
       596 1 . . . . . 3.4 1.8 3.4 1 1 
       597 1 . . . . . 3.4 1.8 3.4 1 1 
       598 1 . . . . . 2.8 1.8 2.8 1 1 
       599 1 . . . . . 2.8 1.8 2.8 1 1 
       600 1 . . . . . 2.8 1.8 2.8 1 1 
       601 1 . . . . . 3.4 1.8 3.4 1 1 
       602 1 . . . . . 4.5 1.8 4.5 1 1 
       603 1 . . . . . 4.5 1.8 4.5 1 1 
       604 1 . . . . . 6.0 1.8 6.0 1 1 
       605 1 . . . . . 4.5 1.8 4.5 1 1 
       606 1 . . . . . 6.0 1.8 6.0 1 1 
       607 1 . . . . . 4.5 1.8 4.5 1 1 
       608 1 . . . . . 5.0 1.8 5.0 1 1 
       609 1 . . . . . 2.8 1.8 2.8 1 1 
       610 1 . . . . . 2.8 1.8 2.8 1 1 
       611 1 . . . . . 4.5 1.8 4.5 1 1 
       612 1 . . . . . 4.5 1.8 4.5 1 1 
       613 1 . . . . . 2.8 1.8 2.8 1 1 
       614 1 . . . . . 2.8 1.8 2.8 1 1 
       615 1 . . . . . 2.8 1.8 2.8 1 1 
       616 1 . . . . . 4.5 1.8 4.5 1 1 
       617 1 . . . . . 4.5 1.8 4.5 1 1 
       618 1 . . . . . 6.0 1.8 6.0 1 1 
       619 1 . . . . . 6.0 1.8 6.0 1 1 
       620 1 . . . . . 3.4 1.8 3.4 1 1 
       621 1 . . . . . 4.5 1.8 4.5 1 1 
       622 1 . . . . . 4.5 1.8 4.5 1 1 
       623 1 . . . . . 3.4 1.8 3.4 1 1 
       624 1 . . . . . 3.4 1.8 3.4 1 1 
       625 1 . . . . . 6.0 1.8 6.0 1 1 
       626 1 . . . . . 2.8 1.8 2.8 1 1 
       627 1 . . . . . 4.5 1.8 4.5 1 1 
       628 1 . . . . . 4.5 1.8 4.5 1 1 
       629 1 . . . . . 6.0 1.8 6.0 1 1 
       630 1 . . . . . 6.0 1.8 6.0 1 1 
       631 1 . . . . . 6.0 1.8 6.0 1 1 
       632 1 . . . . . 3.4 1.8 3.4 1 1 
       633 1 . . . . . 4.5 1.8 4.5 1 1 
       634 1 . . . . . 4.5 1.8 4.5 1 1 
       635 1 . . . . . 2.8 1.8 2.8 1 1 
       636 1 . . . . . 2.8 1.8 2.8 1 1 
       637 1 . . . . . 4.5 1.8 4.5 1 1 
       638 1 . . . . . 3.4 1.8 3.4 1 1 
       639 1 . . . . . 5.0 1.8 5.0 1 1 
       640 1 . . . . . 5.0 1.8 5.0 1 1 
       641 1 . . . . . 4.5 1.8 4.5 1 1 
       642 1 . . . . . 6.0 1.8 6.0 1 1 
       643 1 . . . . . 6.0 1.8 6.0 1 1 
       644 1 . . . . . 3.4 1.8 3.4 1 1 
       645 1 . . . . . 4.5 1.8 4.5 1 1 
       646 1 . . . . . 4.5 1.8 4.5 1 1 
       647 1 . . . . . 6.0 1.8 6.0 1 1 
       648 1 . . . . . 2.8 1.8 2.8 1 1 
       649 1 . . . . . 3.4 1.8 3.4 1 1 
       650 1 . . . . . 3.4 1.8 3.4 1 1 
       651 1 . . . . . 3.4 1.8 3.4 1 1 
       652 1 . . . . . 6.0 1.8 6.0 1 1 
       653 1 . . . . . 6.0 1.8 6.0 1 1 
       654 1 . . . . . 2.8 1.8 2.8 1 1 
       655 1 . . . . . 4.5 1.8 4.5 1 1 
       656 1 . . . . . 6.0 1.8 6.0 1 1 
       657 1 . . . . . 4.5 1.8 4.5 1 1 
       658 1 . . . . . 6.0 1.8 6.0 1 1 
       659 1 . . . . . 2.8 1.8 2.8 1 1 
       660 1 . . . . . 2.8 1.8 2.8 1 1 
       661 1 . . . . . 2.8 1.8 2.8 1 1 
       662 1 . . . . . 3.4 1.8 3.4 1 1 
       663 1 . . . . . 2.8 1.8 2.8 1 1 
       664 1 . . . . . 6.0 1.8 6.0 1 1 
       665 1 . . . . . 2.8 1.8 2.8 1 1 
       666 1 . . . . . 2.8 1.8 2.8 1 1 
       667 1 . . . . . 2.8 1.8 2.8 1 1 
       668 1 . . . . . 3.4 1.8 3.4 1 1 
       669 1 . . . . . 3.4 1.8 3.4 1 1 
       670 1 . . . . . 3.4 1.8 3.4 1 1 
       671 1 . . . . . 6.0 1.8 6.0 1 1 
       672 1 . . . . . 6.0 1.8 6.0 1 1 
       673 1 . . . . . 2.8 1.8 2.8 1 1 
       674 1 . . . . . 4.5 1.8 4.5 1 1 
       675 1 . . . . . 3.4 1.8 3.4 1 1 
       676 1 . . . . . 6.0 1.8 6.0 1 1 
       677 1 . . . . . 6.0 1.8 6.0 1 1 
       678 1 . . . . . 2.8 1.8 2.8 1 1 
       679 1 . . . . . 6.0 1.8 6.0 1 1 
       680 1 . . . . . 6.0 1.8 6.0 1 1 
       681 1 . . . . . 6.0 1.8 6.0 1 1 
       682 1 . . . . . 6.0 1.8 6.0 1 1 
       683 1 . . . . . 4.5 1.8 4.5 1 1 
       684 1 . . . . . 2.8 1.8 2.8 1 1 
       685 1 . . . . . 6.0 1.8 6.0 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1 41 PHE H . 41 . HN 1 2 
        1 1 2 1 1 53 GLU O . 53 . O  1 2 
        2 1 1 1 1 41 PHE N . 41 . N  1 2 
        2 1 2 1 1 53 GLU O . 53 . O  1 2 
        3 1 1 1 1  5 ILE O .  5 . O  1 2 
        3 1 2 1 1 42 LEU H . 42 . HN 1 2 
        4 1 1 1 1  5 ILE O .  5 . O  1 2 
        4 1 2 1 1 42 LEU N . 42 . N  1 2 
        5 1 1 1 1 43 THR H . 43 . HN 1 2 
        5 1 2 1 1 51 TYR O . 51 . O  1 2 
        6 1 1 1 1 43 THR N . 43 . N  1 2 
        6 1 2 1 1 51 TYR O . 51 . O  1 2 
        7 1 1 1 1  3 GLN O .  3 . O  1 2 
        7 1 2 1 1 44 ILE H . 44 . HN 1 2 
        8 1 1 1 1  3 GLN O .  3 . O  1 2 
        8 1 2 1 1 44 ILE N . 44 . N  1 2 
        9 1 1 1 1 45 ASN N . 45 . N  1 2 
        9 1 2 1 1 49 SER O . 49 . O  1 2 
       10 1 1 1 1 43 THR O . 43 . O  1 2 
       10 1 2 1 1 51 TYR H . 51 . HN 1 2 
       11 1 1 1 1 43 THR O . 43 . O  1 2 
       11 1 2 1 1 51 TYR N . 51 . N  1 2 
       12 1 1 1 1 29 ALA O . 29 . O  1 2 
       12 1 2 1 1 33 TRP H . 33 . HN 1 2 
       13 1 1 1 1 29 ALA O . 29 . O  1 2 
       13 1 2 1 1 33 TRP N . 33 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . 2.5 1.8 2.5 1 2 
        2 1 . . . . . 3.5 1.8 3.5 1 2 
        3 1 . . . . . 2.5 1.8 2.5 1 2 
        4 1 . . . . . 3.5 1.8 3.5 1 2 
        5 1 . . . . . 2.5 1.8 2.5 1 2 
        6 1 . . . . . 3.5 1.8 3.5 1 2 
        7 1 . . . . . 2.5 1.8 2.5 1 2 
        8 1 . . . . . 3.5 1.8 3.5 1 2 
        9 1 . . . . . 3.5 1.8 3.5 1 2 
       10 1 . . . . . 2.5 1.8 2.5 1 2 
       11 1 . . . . . 3.5 1.8 3.5 1 2 
       12 1 . . . . . 2.5 1.8 2.5 1 2 
       13 1 . . . . . 3.5 1.8 3.5 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

        1 . 1 1  2 GLU C 1 1  3 GLN N  1 1  3 GLN CA 1 1  3 GLN C      -160.0 -80.0 .  2 . C .  3 . N  .  3 . CA .  3 . C   1 1 
        2 . 1 1  3 GLN C 1 1  4 ARG N  1 1  4 ARG CA 1 1  4 ARG C      -160.0 -80.0 .  3 . C .  4 . N  .  4 . CA .  4 . C   1 1 
        3 . 1 1  4 ARG C 1 1  5 ILE N  1 1  5 ILE CA 1 1  5 ILE C      -160.0 -80.0 .  4 . C .  5 . N  .  5 . CA .  5 . C   1 1 
        4 . 1 1  5 ILE C 1 1  6 THR N  1 1  6 THR CA 1 1  6 THR C   -89.99999 -40.0 .  5 . C .  6 . N  .  6 . CA .  6 . C   1 1 
        5 . 1 1  6 THR C 1 1  7 LEU N  1 1  7 LEU CA 1 1  7 LEU C   -89.99999 -40.0 .  6 . C .  7 . N  .  7 . CA .  7 . C   1 1 
        6 . 1 1  7 LEU C 1 1  8 LYS N  1 1  8 LYS CA 1 1  8 LYS C   -89.99999 -40.0 .  7 . C .  8 . N  .  8 . CA .  8 . C   1 1 
        7 . 1 1  8 LYS C 1 1  9 ASP N  1 1  9 ASP CA 1 1  9 ASP C   -89.99999 -40.0 .  8 . C .  9 . N  .  9 . CA .  9 . C   1 1 
        8 . 1 1  9 ASP C 1 1 10 TYR N  1 1 10 TYR CA 1 1 10 TYR C   -89.99999 -40.0 .  9 . C . 10 . N  . 10 . CA . 10 . C   1 1 
        9 . 1 1 10 TYR C 1 1 11 ALA N  1 1 11 ALA CA 1 1 11 ALA C   -89.99999 -40.0 . 10 . C . 11 . N  . 11 . CA . 11 . C   1 1 
       10 . 1 1 11 ALA C 1 1 12 MET N  1 1 12 MET CA 1 1 12 MET C   -89.99999 -40.0 . 11 . C . 12 . N  . 12 . CA . 12 . C   1 1 
       11 . 1 1 12 MET C 1 1 13 ARG N  1 1 13 ARG CA 1 1 13 ARG C   -89.99999 -40.0 . 12 . C . 13 . N  . 13 . CA . 13 . C   1 1 
       12 . 1 1 13 ARG C 1 1 14 PHE N  1 1 14 PHE CA 1 1 14 PHE C      -160.0 -80.0 . 13 . C . 14 . N  . 14 . CA . 14 . C   1 1 
       13 . 1 1 15 GLY C 1 1 16 GLN N  1 1 16 GLN CA 1 1 16 GLN C   -89.99999 -40.0 . 15 . C . 16 . N  . 16 . CA . 16 . C   1 1 
       14 . 1 1 16 GLN C 1 1 17 THR N  1 1 17 THR CA 1 1 17 THR C   -89.99999 -40.0 . 16 . C . 17 . N  . 17 . CA . 17 . C   1 1 
       15 . 1 1 17 THR C 1 1 18 LYS N  1 1 18 LYS CA 1 1 18 LYS C   -89.99999 -40.0 . 17 . C . 18 . N  . 18 . CA . 18 . C   1 1 
       16 . 1 1 18 LYS C 1 1 19 THR N  1 1 19 THR CA 1 1 19 THR C   -89.99999 -40.0 . 18 . C . 19 . N  . 19 . CA . 19 . C   1 1 
       17 . 1 1 19 THR C 1 1 20 ALA N  1 1 20 ALA CA 1 1 20 ALA C   -89.99999 -40.0 . 19 . C . 20 . N  . 20 . CA . 20 . C   1 1 
       18 . 1 1 20 ALA C 1 1 21 LYS N  1 1 21 LYS CA 1 1 21 LYS C   -89.99999 -40.0 . 20 . C . 21 . N  . 21 . CA . 21 . C   1 1 
       19 . 1 1 21 LYS C 1 1 22 ASP N  1 1 22 ASP CA 1 1 22 ASP C   -89.99999 -40.0 . 21 . C . 22 . N  . 22 . CA . 22 . C   1 1 
       20 . 1 1 22 ASP C 1 1 23 LEU N  1 1 23 LEU CA 1 1 23 LEU C      -160.0 -80.0 . 22 . C . 23 . N  . 23 . CA . 23 . C   1 1 
       21 . 1 1 24 GLY C 1 1 25 VAL N  1 1 25 VAL CA 1 1 25 VAL C      -160.0 -80.0 . 24 . C . 25 . N  . 25 . CA . 25 . C   1 1 
       22 . 1 1 26 GLN C 1 1 27 GLN N  1 1 27 GLN CA 1 1 27 GLN C   -89.99999 -40.0 . 26 . C . 27 . N  . 27 . CA . 27 . C   1 1 
       23 . 1 1 27 GLN C 1 1 28 SER N  1 1 28 SER CA 1 1 28 SER C   -89.99999 -40.0 . 27 . C . 28 . N  . 28 . CA . 28 . C   1 1 
       24 . 1 1 29 ALA C 1 1 30 ILE N  1 1 30 ILE CA 1 1 30 ILE C   -89.99999 -40.0 . 29 . C . 30 . N  . 30 . CA . 30 . C   1 1 
       25 . 1 1 30 ILE C 1 1 31 ASN N  1 1 31 ASN CA 1 1 31 ASN C   -89.99999 -40.0 . 30 . C . 31 . N  . 31 . CA . 31 . C   1 1 
       26 . 1 1 31 ASN C 1 1 32 LYS N  1 1 32 LYS CA 1 1 32 LYS C   -89.99999 -40.0 . 31 . C . 32 . N  . 32 . CA . 32 . C   1 1 
       27 . 1 1 32 LYS C 1 1 33 TRP N  1 1 33 TRP CA 1 1 33 TRP C   -89.99999 -40.0 . 32 . C . 33 . N  . 33 . CA . 33 . C   1 1 
       28 . 1 1 33 TRP C 1 1 34 ILE N  1 1 34 ILE CA 1 1 34 ILE C   -89.99999 -40.0 . 33 . C . 34 . N  . 34 . CA . 34 . C   1 1 
       29 . 1 1 34 ILE C 1 1 35 HIS N  1 1 35 HIS CA 1 1 35 HIS C   -89.99999 -40.0 . 34 . C . 35 . N  . 35 . CA . 35 . C   1 1 
       30 . 1 1 37 GLY C 1 1 38 ARG N  1 1 38 ARG CA 1 1 38 ARG C   -89.99999 -40.0 . 37 . C . 38 . N  . 38 . CA . 38 . C   1 1 
       31 . 1 1 39 LYS C 1 1 40 ILE N  1 1 40 ILE CA 1 1 40 ILE C      -160.0 -80.0 . 39 . C . 40 . N  . 40 . CA . 40 . C   1 1 
       32 . 1 1 40 ILE C 1 1 41 PHE N  1 1 41 PHE CA 1 1 41 PHE C      -160.0 -80.0 . 40 . C . 41 . N  . 41 . CA . 41 . C   1 1 
       33 . 1 1 41 PHE C 1 1 42 LEU N  1 1 42 LEU CA 1 1 42 LEU C      -160.0 -80.0 . 41 . C . 42 . N  . 42 . CA . 42 . C   1 1 
       34 . 1 1 42 LEU C 1 1 43 THR N  1 1 43 THR CA 1 1 43 THR C      -160.0 -80.0 . 42 . C . 43 . N  . 43 . CA . 43 . C   1 1 
       35 . 1 1 43 THR C 1 1 44 ILE N  1 1 44 ILE CA 1 1 44 ILE C      -160.0 -80.0 . 43 . C . 44 . N  . 44 . CA . 44 . C   1 1 
       36 . 1 1 44 ILE C 1 1 45 ASN N  1 1 45 ASN CA 1 1 45 ASN C      -160.0 -80.0 . 44 . C . 45 . N  . 45 . CA . 45 . C   1 1 
       37 . 1 1 45 ASN C 1 1 46 ALA N  1 1 46 ALA CA 1 1 46 ALA C   -89.99999 -40.0 . 45 . C . 46 . N  . 46 . CA . 46 . C   1 1 
       38 . 1 1 46 ALA C 1 1 47 ASP N  1 1 47 ASP CA 1 1 47 ASP C      -160.0 -80.0 . 46 . C . 47 . N  . 47 . CA . 47 . C   1 1 
       39 . 1 1 49 SER C 1 1 50 VAL N  1 1 50 VAL CA 1 1 50 VAL C      -160.0 -80.0 . 49 . C . 50 . N  . 50 . CA . 50 . C   1 1 
       40 . 1 1 50 VAL C 1 1 51 TYR N  1 1 51 TYR CA 1 1 51 TYR C      -160.0 -80.0 . 50 . C . 51 . N  . 51 . CA . 51 . C   1 1 
       41 . 1 1 51 TYR C 1 1 52 ALA N  1 1 52 ALA CA 1 1 52 ALA C      -160.0 -80.0 . 51 . C . 52 . N  . 52 . CA . 52 . C   1 1 
       42 . 1 1 52 ALA C 1 1 53 GLU N  1 1 53 GLU CA 1 1 53 GLU C      -160.0 -80.0 . 52 . C . 53 . N  . 53 . CA . 53 . C   1 1 
       43 . 1 1 53 GLU C 1 1 54 GLU N  1 1 54 GLU CA 1 1 54 GLU C      -160.0 -80.0 . 53 . C . 54 . N  . 54 . CA . 54 . C   1 1 
       44 . 1 1 54 GLU C 1 1 55 VAL N  1 1 55 VAL CA 1 1 55 VAL C      -160.0 -80.0 . 54 . C . 55 . N  . 55 . CA . 55 . C   1 1 
       45 . 1 1 55 VAL C 1 1 56 LYS N  1 1 56 LYS CA 1 1 56 LYS C      -160.0 -80.0 . 55 . C . 56 . N  . 56 . CA . 56 . C   1 1 
       46 . 1 1 60 SER C 1 1 61 ASN N  1 1 61 ASN CA 1 1 61 ASN C      -160.0 -80.0 . 60 . C . 61 . N  . 61 . CA . 61 . C   1 1 
       47 . 1 1 61 ASN C 1 1 62 LYS N  1 1 62 LYS CA 1 1 62 LYS C      -160.0 -80.0 . 61 . C . 62 . N  . 62 . CA . 62 . C   1 1 
       48 . 1 1 62 LYS C 1 1 63 LYS N  1 1 63 LYS CA 1 1 63 LYS C      -160.0 -80.0 . 62 . C . 63 . N  . 63 . CA . 63 . C   1 1 
       49 . 1 1 63 LYS C 1 1 64 THR N  1 1 64 THR CA 1 1 64 THR C      -160.0 -80.0 . 63 . C . 64 . N  . 64 . CA . 64 . C   1 1 
       50 . 1 1 64 THR C 1 1 65 THR N  1 1 65 THR CA 1 1 65 THR C      -160.0 -80.0 . 64 . C . 65 . N  . 65 . CA . 65 . C   1 1 
       51 . 1 1  7 LEU N 1 1  7 LEU CA 1 1  7 LEU CB 1 1  7 LEU CG      140.0 220.0 .  7 . N .  7 . CA .  7 . CB .  7 . CG  1 1 
       52 . 1 1  8 LYS N 1 1  8 LYS CA 1 1  8 LYS CB 1 1  8 LYS CG      140.0 220.0 .  8 . N .  8 . CA .  8 . CB .  8 . CG  1 1 
       53 . 1 1 10 TYR N 1 1 10 TYR CA 1 1 10 TYR CB 1 1 10 TYR CG      140.0 220.0 . 10 . N . 10 . CA . 10 . CB . 10 . CG  1 1 
       54 . 1 1 13 ARG N 1 1 13 ARG CA 1 1 13 ARG CB 1 1 13 ARG CG      140.0 220.0 . 13 . N . 13 . CA . 13 . CB . 13 . CG  1 1 
       55 . 1 1 18 LYS N 1 1 18 LYS CA 1 1 18 LYS CB 1 1 18 LYS CG      140.0 220.0 . 18 . N . 18 . CA . 18 . CB . 18 . CG  1 1 
       56 . 1 1 54 GLU N 1 1 54 GLU CA 1 1 54 GLU CB 1 1 54 GLU CG      140.0 220.0 . 54 . N . 54 . CA . 54 . CB . 54 . CG  1 1 
       57 . 1 1  9 ASP N 1 1  9 ASP CA 1 1  9 ASP CB 1 1  9 ASP CG     -100.0 -20.0 .  9 . N .  9 . CA .  9 . CB .  9 . CG  1 1 
       58 . 1 1 14 PHE N 1 1 14 PHE CA 1 1 14 PHE CB 1 1 14 PHE CG     -100.0 -20.0 . 14 . N . 14 . CA . 14 . CB . 14 . CG  1 1 
       59 . 1 1 22 ASP N 1 1 22 ASP CA 1 1 22 ASP CB 1 1 22 ASP CG     -100.0 -20.0 . 22 . N . 22 . CA . 22 . CB . 22 . CG  1 1 
       60 . 1 1 33 TRP N 1 1 33 TRP CA 1 1 33 TRP CB 1 1 33 TRP CG     -100.0 -20.0 . 33 . N . 33 . CA . 33 . CB . 33 . CG  1 1 
       61 . 1 1 47 ASP N 1 1 47 ASP CA 1 1 47 ASP CB 1 1 47 ASP CG       20.0 100.0 . 47 . N . 47 . CA . 47 . CB . 47 . CG  1 1 
       62 . 1 1 17 THR N 1 1 17 THR CA 1 1 17 THR CB 1 1 17 THR OG1    -100.0 -20.0 . 17 . N . 17 . CA . 17 . CB . 17 . OG1 1 1 
       63 . 1 1 19 THR N 1 1 19 THR CA 1 1 19 THR CB 1 1 19 THR OG1    -100.0 -20.0 . 19 . N . 19 . CA . 19 . CB . 19 . OG1 1 1 
       64 . 1 1 43 THR N 1 1 43 THR CA 1 1 43 THR CB 1 1 43 THR OG1    -100.0 -20.0 . 43 . N . 43 . CA . 43 . CB . 43 . OG1 1 1 
       65 . 1 1  5 ILE N 1 1  5 ILE CA 1 1  5 ILE CB 1 1  5 ILE CG1    -100.0 -20.0 .  5 . N .  5 . CA .  5 . CB .  5 . CG1 1 1 
       66 . 1 1 34 ILE N 1 1 34 ILE CA 1 1 34 ILE CB 1 1 34 ILE CG1    -100.0 -20.0 . 34 . N . 34 . CA . 34 . CB . 34 . CG1 1 1 
       67 . 1 1 40 ILE N 1 1 40 ILE CA 1 1 40 ILE CB 1 1 40 ILE CG1    -100.0 -20.0 . 40 . N . 40 . CA . 40 . CB . 40 . CG1 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 MET C    C   4.356  12.191   4.050 1.00 . A A .  1 MET C    1 1 
        1     2 1 1  1 MET CA   C   5.513  12.565   4.974 1.00 . A A .  1 MET CA   1 1 
        1     3 1 1  1 MET CB   C   5.778  11.436   5.973 1.00 . A A .  1 MET CB   1 1 
        1     4 1 1  1 MET CE   C   4.734  10.617   9.568 1.00 . A A .  1 MET CE   1 1 
        1     5 1 1  1 MET CG   C   4.578  11.099   6.844 1.00 . A A .  1 MET CG   1 1 
        1     6 1 1  1 MET H1   H   4.242  13.736   6.089 1.00 . A A .  1 MET H1   1 1 
        1     7 1 1  1 MET H2   H   5.317  14.610   5.077 1.00 . A A .  1 MET H2   1 1 
        1     8 1 1  1 MET H3   H   5.898  13.873   6.513 1.00 . A A .  1 MET H3   1 1 
        1     9 1 1  1 MET HA   H   6.399  12.728   4.379 1.00 . A A .  1 MET HA   1 1 
        1    10 1 1  1 MET HB2  H   6.061  10.547   5.429 1.00 . A A .  1 MET HB2  1 1 
        1    11 1 1  1 MET HB3  H   6.593  11.728   6.619 1.00 . A A .  1 MET HB3  1 1 
        1    12 1 1  1 MET HE1  H   4.732  10.998  10.579 1.00 . A A .  1 MET HE1  1 1 
        1    13 1 1  1 MET HE2  H   5.658  10.088   9.385 1.00 . A A .  1 MET HE2  1 1 
        1    14 1 1  1 MET HE3  H   3.900   9.944   9.434 1.00 . A A .  1 MET HE3  1 1 
        1    15 1 1  1 MET HG2  H   3.677  11.360   6.308 1.00 . A A .  1 MET HG2  1 1 
        1    16 1 1  1 MET HG3  H   4.582  10.038   7.042 1.00 . A A .  1 MET HG3  1 1 
        1    17 1 1  1 MET N    N   5.216  13.808   5.731 1.00 . A A .  1 MET N    1 1 
        1    18 1 1  1 MET O    O   3.194  12.447   4.362 1.00 . A A .  1 MET O    1 1 
        1    19 1 1  1 MET SD   S   4.590  11.981   8.416 1.00 . A A .  1 MET SD   1 1 
        1    20 1 1  2 GLU C    C   2.730  10.137   2.546 1.00 . A A .  2 GLU C    1 1 
        1    21 1 1  2 GLU CA   C   3.672  11.178   1.946 1.00 . A A .  2 GLU CA   1 1 
        1    22 1 1  2 GLU CB   C   4.336  10.619   0.686 1.00 . A A .  2 GLU CB   1 1 
        1    23 1 1  2 GLU CD   C   3.988  12.534  -0.929 1.00 . A A .  2 GLU CD   1 1 
        1    24 1 1  2 GLU CG   C   3.679  11.084  -0.604 1.00 . A A .  2 GLU CG   1 1 
        1    25 1 1  2 GLU H    H   5.629  11.407   2.722 1.00 . A A .  2 GLU H    1 1 
        1    26 1 1  2 GLU HA   H   3.097  12.053   1.680 1.00 . A A .  2 GLU HA   1 1 
        1    27 1 1  2 GLU HB2  H   5.370  10.931   0.670 1.00 . A A .  2 GLU HB2  1 1 
        1    28 1 1  2 GLU HB3  H   4.295   9.541   0.717 1.00 . A A .  2 GLU HB3  1 1 
        1    29 1 1  2 GLU HG2  H   4.035  10.467  -1.416 1.00 . A A .  2 GLU HG2  1 1 
        1    30 1 1  2 GLU HG3  H   2.610  10.971  -0.509 1.00 . A A .  2 GLU HG3  1 1 
        1    31 1 1  2 GLU N    N   4.684  11.585   2.914 1.00 . A A .  2 GLU N    1 1 
        1    32 1 1  2 GLU O    O   3.002   9.582   3.611 1.00 . A A .  2 GLU O    1 1 
        1    33 1 1  2 GLU OE1  O   4.585  13.221  -0.074 1.00 . A A .  2 GLU OE1  1 1 
        1    34 1 1  2 GLU OE2  O   3.629  12.982  -2.039 1.00 . A A .  2 GLU OE2  1 1 
        1    35 1 1  3 GLN C    C   0.792   7.583   1.574 1.00 . A A .  3 GLN C    1 1 
        1    36 1 1  3 GLN CA   C   0.643   8.907   2.319 1.00 . A A .  3 GLN CA   1 1 
        1    37 1 1  3 GLN CB   C  -0.774   9.459   2.135 1.00 . A A .  3 GLN CB   1 1 
        1    38 1 1  3 GLN CD   C  -2.671   9.269   3.795 1.00 . A A .  3 GLN CD   1 1 
        1    39 1 1  3 GLN CG   C  -1.391   9.991   3.419 1.00 . A A .  3 GLN CG   1 1 
        1    40 1 1  3 GLN H    H   1.464  10.355   1.013 1.00 . A A .  3 GLN H    1 1 
        1    41 1 1  3 GLN HA   H   0.821   8.735   3.370 1.00 . A A .  3 GLN HA   1 1 
        1    42 1 1  3 GLN HB2  H  -0.741  10.265   1.417 1.00 . A A .  3 GLN HB2  1 1 
        1    43 1 1  3 GLN HB3  H  -1.409   8.675   1.753 1.00 . A A .  3 GLN HB3  1 1 
        1    44 1 1  3 GLN HE21 H  -3.668  10.991   3.795 1.00 . A A .  3 GLN HE21 1 1 
        1    45 1 1  3 GLN HE22 H  -4.599   9.577   4.182 1.00 . A A .  3 GLN HE22 1 1 
        1    46 1 1  3 GLN HG2  H  -0.679   9.872   4.222 1.00 . A A .  3 GLN HG2  1 1 
        1    47 1 1  3 GLN HG3  H  -1.612  11.040   3.289 1.00 . A A .  3 GLN HG3  1 1 
        1    48 1 1  3 GLN N    N   1.625   9.879   1.855 1.00 . A A .  3 GLN N    1 1 
        1    49 1 1  3 GLN NE2  N  -3.755  10.022   3.940 1.00 . A A .  3 GLN NE2  1 1 
        1    50 1 1  3 GLN O    O  -0.195   6.920   1.258 1.00 . A A .  3 GLN O    1 1 
        1    51 1 1  3 GLN OE1  O  -2.684   8.048   3.954 1.00 . A A .  3 GLN OE1  1 1 
        1    52 1 1  4 ARG C    C   2.762   4.871   1.567 1.00 . A A .  4 ARG C    1 1 
        1    53 1 1  4 ARG CA   C   2.326   5.960   0.595 1.00 . A A .  4 ARG CA   1 1 
        1    54 1 1  4 ARG CB   C   3.409   6.183  -0.459 1.00 . A A .  4 ARG CB   1 1 
        1    55 1 1  4 ARG CD   C   5.372   7.715  -0.796 1.00 . A A .  4 ARG CD   1 1 
        1    56 1 1  4 ARG CG   C   4.730   6.677   0.110 1.00 . A A .  4 ARG CG   1 1 
        1    57 1 1  4 ARG CZ   C   6.035   7.873  -3.163 1.00 . A A .  4 ARG CZ   1 1 
        1    58 1 1  4 ARG H    H   2.781   7.777   1.584 1.00 . A A .  4 ARG H    1 1 
        1    59 1 1  4 ARG HA   H   1.422   5.640   0.102 1.00 . A A .  4 ARG HA   1 1 
        1    60 1 1  4 ARG HB2  H   3.590   5.250  -0.974 1.00 . A A .  4 ARG HB2  1 1 
        1    61 1 1  4 ARG HB3  H   3.051   6.910  -1.170 1.00 . A A .  4 ARG HB3  1 1 
        1    62 1 1  4 ARG HD2  H   4.660   8.507  -0.974 1.00 . A A .  4 ARG HD2  1 1 
        1    63 1 1  4 ARG HD3  H   6.241   8.119  -0.298 1.00 . A A .  4 ARG HD3  1 1 
        1    64 1 1  4 ARG HE   H   5.870   6.172  -2.132 1.00 . A A .  4 ARG HE   1 1 
        1    65 1 1  4 ARG HG2  H   4.551   7.118   1.079 1.00 . A A .  4 ARG HG2  1 1 
        1    66 1 1  4 ARG HG3  H   5.401   5.837   0.214 1.00 . A A .  4 ARG HG3  1 1 
        1    67 1 1  4 ARG HH11 H   5.651   9.652  -2.283 1.00 . A A .  4 ARG HH11 1 1 
        1    68 1 1  4 ARG HH12 H   6.120   9.735  -3.947 1.00 . A A .  4 ARG HH12 1 1 
        1    69 1 1  4 ARG HH21 H   6.486   6.279  -4.321 1.00 . A A .  4 ARG HH21 1 1 
        1    70 1 1  4 ARG HH22 H   6.595   7.820  -5.105 1.00 . A A .  4 ARG HH22 1 1 
        1    71 1 1  4 ARG N    N   2.038   7.205   1.302 1.00 . A A .  4 ARG N    1 1 
        1    72 1 1  4 ARG NE   N   5.780   7.147  -2.077 1.00 . A A .  4 ARG NE   1 1 
        1    73 1 1  4 ARG NH1  N   5.927   9.196  -3.127 1.00 . A A .  4 ARG NH1  1 1 
        1    74 1 1  4 ARG NH2  N   6.403   7.275  -4.289 1.00 . A A .  4 ARG NH2  1 1 
        1    75 1 1  4 ARG O    O   3.953   4.667   1.799 1.00 . A A .  4 ARG O    1 1 
        1    76 1 1  5 ILE C    C   2.451   1.828   2.380 1.00 . A A .  5 ILE C    1 1 
        1    77 1 1  5 ILE CA   C   2.053   3.110   3.085 1.00 . A A .  5 ILE CA   1 1 
        1    78 1 1  5 ILE CB   C   0.825   2.825   3.969 1.00 . A A .  5 ILE CB   1 1 
        1    79 1 1  5 ILE CD1  C  -1.214   4.085   4.808 1.00 . A A .  5 ILE CD1  1 1 
        1    80 1 1  5 ILE CG1  C   0.267   4.133   4.500 1.00 . A A .  5 ILE CG1  1 1 
        1    81 1 1  5 ILE CG2  C   1.186   1.891   5.114 1.00 . A A .  5 ILE CG2  1 1 
        1    82 1 1  5 ILE H    H   0.856   4.395   1.914 1.00 . A A .  5 ILE H    1 1 
        1    83 1 1  5 ILE HA   H   2.863   3.427   3.724 1.00 . A A .  5 ILE HA   1 1 
        1    84 1 1  5 ILE HB   H   0.075   2.339   3.361 1.00 . A A .  5 ILE HB   1 1 
        1    85 1 1  5 ILE HD11 H  -1.769   3.953   3.890 1.00 . A A .  5 ILE HD11 1 1 
        1    86 1 1  5 ILE HD12 H  -1.513   5.010   5.280 1.00 . A A .  5 ILE HD12 1 1 
        1    87 1 1  5 ILE HD13 H  -1.415   3.260   5.473 1.00 . A A .  5 ILE HD13 1 1 
        1    88 1 1  5 ILE HG12 H   0.789   4.396   5.401 1.00 . A A .  5 ILE HG12 1 1 
        1    89 1 1  5 ILE HG13 H   0.432   4.895   3.764 1.00 . A A .  5 ILE HG13 1 1 
        1    90 1 1  5 ILE HG21 H   1.270   0.881   4.742 1.00 . A A .  5 ILE HG21 1 1 
        1    91 1 1  5 ILE HG22 H   0.415   1.934   5.869 1.00 . A A .  5 ILE HG22 1 1 
        1    92 1 1  5 ILE HG23 H   2.128   2.197   5.544 1.00 . A A .  5 ILE HG23 1 1 
        1    93 1 1  5 ILE N    N   1.784   4.177   2.135 1.00 . A A .  5 ILE N    1 1 
        1    94 1 1  5 ILE O    O   2.232   1.663   1.181 1.00 . A A .  5 ILE O    1 1 
        1    95 1 1  6 THR C    C   2.336  -1.366   2.633 1.00 . A A .  6 THR C    1 1 
        1    96 1 1  6 THR CA   C   3.478  -0.359   2.621 1.00 . A A .  6 THR CA   1 1 
        1    97 1 1  6 THR CB   C   4.655  -0.892   3.438 1.00 . A A .  6 THR CB   1 1 
        1    98 1 1  6 THR CG2  C   6.000  -0.417   2.932 1.00 . A A .  6 THR CG2  1 1 
        1    99 1 1  6 THR H    H   3.174   1.137   4.092 1.00 . A A .  6 THR H    1 1 
        1   100 1 1  6 THR HA   H   3.798  -0.208   1.600 1.00 . A A .  6 THR HA   1 1 
        1   101 1 1  6 THR HB   H   4.649  -1.972   3.396 1.00 . A A .  6 THR HB   1 1 
        1   102 1 1  6 THR HG1  H   5.212  -0.951   5.315 1.00 . A A .  6 THR HG1  1 1 
        1   103 1 1  6 THR HG21 H   6.774  -0.743   3.610 1.00 . A A .  6 THR HG21 1 1 
        1   104 1 1  6 THR HG22 H   6.002   0.660   2.873 1.00 . A A .  6 THR HG22 1 1 
        1   105 1 1  6 THR HG23 H   6.182  -0.831   1.951 1.00 . A A .  6 THR HG23 1 1 
        1   106 1 1  6 THR N    N   3.038   0.928   3.145 1.00 . A A .  6 THR N    1 1 
        1   107 1 1  6 THR O    O   1.465  -1.324   3.503 1.00 . A A .  6 THR O    1 1 
        1   108 1 1  6 THR OG1  O   4.544  -0.499   4.794 1.00 . A A .  6 THR OG1  1 1 
        1   109 1 1  7 LEU C    C   1.207  -4.103   2.850 1.00 . A A .  7 LEU C    1 1 
        1   110 1 1  7 LEU CA   C   1.305  -3.293   1.561 1.00 . A A .  7 LEU CA   1 1 
        1   111 1 1  7 LEU CB   C   1.591  -4.222   0.380 1.00 . A A .  7 LEU CB   1 1 
        1   112 1 1  7 LEU CD1  C  -0.738  -4.434  -0.518 1.00 . A A .  7 LEU CD1  1 1 
        1   113 1 1  7 LEU CD2  C   0.945  -6.229  -0.972 1.00 . A A .  7 LEU CD2  1 1 
        1   114 1 1  7 LEU CG   C   0.464  -5.191   0.029 1.00 . A A .  7 LEU CG   1 1 
        1   115 1 1  7 LEU H    H   3.060  -2.257   0.997 1.00 . A A .  7 LEU H    1 1 
        1   116 1 1  7 LEU HA   H   0.363  -2.793   1.392 1.00 . A A .  7 LEU HA   1 1 
        1   117 1 1  7 LEU HB2  H   1.799  -3.611  -0.488 1.00 . A A .  7 LEU HB2  1 1 
        1   118 1 1  7 LEU HB3  H   2.474  -4.800   0.609 1.00 . A A .  7 LEU HB3  1 1 
        1   119 1 1  7 LEU HD11 H  -0.435  -3.850  -1.375 1.00 . A A .  7 LEU HD11 1 1 
        1   120 1 1  7 LEU HD12 H  -1.129  -3.778   0.245 1.00 . A A .  7 LEU HD12 1 1 
        1   121 1 1  7 LEU HD13 H  -1.501  -5.139  -0.814 1.00 . A A .  7 LEU HD13 1 1 
        1   122 1 1  7 LEU HD21 H   0.681  -5.916  -1.971 1.00 . A A .  7 LEU HD21 1 1 
        1   123 1 1  7 LEU HD22 H   0.479  -7.179  -0.758 1.00 . A A .  7 LEU HD22 1 1 
        1   124 1 1  7 LEU HD23 H   2.017  -6.330  -0.898 1.00 . A A .  7 LEU HD23 1 1 
        1   125 1 1  7 LEU HG   H   0.151  -5.707   0.926 1.00 . A A .  7 LEU HG   1 1 
        1   126 1 1  7 LEU N    N   2.341  -2.274   1.662 1.00 . A A .  7 LEU N    1 1 
        1   127 1 1  7 LEU O    O   0.129  -4.559   3.229 1.00 . A A .  7 LEU O    1 1 
        1   128 1 1  8 LYS C    C   1.710  -4.262   5.896 1.00 . A A .  8 LYS C    1 1 
        1   129 1 1  8 LYS CA   C   2.386  -5.031   4.766 1.00 . A A .  8 LYS CA   1 1 
        1   130 1 1  8 LYS CB   C   3.834  -5.348   5.144 1.00 . A A .  8 LYS CB   1 1 
        1   131 1 1  8 LYS CD   C   4.919  -6.686   6.977 1.00 . A A .  8 LYS CD   1 1 
        1   132 1 1  8 LYS CE   C   5.130  -8.074   7.562 1.00 . A A .  8 LYS CE   1 1 
        1   133 1 1  8 LYS CG   C   4.017  -6.729   5.753 1.00 . A A .  8 LYS CG   1 1 
        1   134 1 1  8 LYS H    H   3.169  -3.893   3.168 1.00 . A A .  8 LYS H    1 1 
        1   135 1 1  8 LYS HA   H   1.856  -5.957   4.607 1.00 . A A .  8 LYS HA   1 1 
        1   136 1 1  8 LYS HB2  H   4.447  -5.286   4.256 1.00 . A A .  8 LYS HB2  1 1 
        1   137 1 1  8 LYS HB3  H   4.177  -4.615   5.858 1.00 . A A .  8 LYS HB3  1 1 
        1   138 1 1  8 LYS HD2  H   5.878  -6.277   6.692 1.00 . A A .  8 LYS HD2  1 1 
        1   139 1 1  8 LYS HD3  H   4.464  -6.054   7.724 1.00 . A A .  8 LYS HD3  1 1 
        1   140 1 1  8 LYS HE2  H   5.683  -7.981   8.485 1.00 . A A .  8 LYS HE2  1 1 
        1   141 1 1  8 LYS HE3  H   4.166  -8.515   7.765 1.00 . A A .  8 LYS HE3  1 1 
        1   142 1 1  8 LYS HG2  H   3.051  -7.115   6.044 1.00 . A A .  8 LYS HG2  1 1 
        1   143 1 1  8 LYS HG3  H   4.459  -7.383   5.013 1.00 . A A .  8 LYS HG3  1 1 
        1   144 1 1  8 LYS HZ1  H   6.754  -8.487   6.314 1.00 . A A .  8 LYS HZ1  1 1 
        1   145 1 1  8 LYS HZ2  H   5.301  -9.186   5.802 1.00 . A A .  8 LYS HZ2  1 1 
        1   146 1 1  8 LYS HZ3  H   6.139  -9.847   7.114 1.00 . A A .  8 LYS HZ3  1 1 
        1   147 1 1  8 LYS N    N   2.341  -4.279   3.520 1.00 . A A .  8 LYS N    1 1 
        1   148 1 1  8 LYS NZ   N   5.884  -8.961   6.633 1.00 . A A .  8 LYS NZ   1 1 
        1   149 1 1  8 LYS O    O   0.829  -4.787   6.578 1.00 . A A .  8 LYS O    1 1 
        1   150 1 1  9 ASP C    C   0.063  -1.993   6.955 1.00 . A A .  9 ASP C    1 1 
        1   151 1 1  9 ASP CA   C   1.565  -2.174   7.141 1.00 . A A .  9 ASP CA   1 1 
        1   152 1 1  9 ASP CB   C   2.251  -0.807   7.153 1.00 . A A .  9 ASP CB   1 1 
        1   153 1 1  9 ASP CG   C   3.746  -0.909   7.378 1.00 . A A .  9 ASP CG   1 1 
        1   154 1 1  9 ASP H    H   2.835  -2.654   5.517 1.00 . A A .  9 ASP H    1 1 
        1   155 1 1  9 ASP HA   H   1.742  -2.661   8.088 1.00 . A A .  9 ASP HA   1 1 
        1   156 1 1  9 ASP HB2  H   2.079  -0.318   6.204 1.00 . A A .  9 ASP HB2  1 1 
        1   157 1 1  9 ASP HB3  H   1.825  -0.204   7.942 1.00 . A A .  9 ASP HB3  1 1 
        1   158 1 1  9 ASP N    N   2.128  -3.016   6.092 1.00 . A A .  9 ASP N    1 1 
        1   159 1 1  9 ASP O    O  -0.725  -2.300   7.848 1.00 . A A .  9 ASP O    1 1 
        1   160 1 1  9 ASP OD1  O   4.221  -2.008   7.731 1.00 . A A .  9 ASP OD1  1 1 
        1   161 1 1  9 ASP OD2  O   4.444   0.113   7.203 1.00 . A A .  9 ASP OD2  1 1 
        1   162 1 1 10 TYR C    C  -2.545  -2.544   5.618 1.00 . A A . 10 TYR C    1 1 
        1   163 1 1 10 TYR CA   C  -1.734  -1.258   5.486 1.00 . A A . 10 TYR CA   1 1 
        1   164 1 1 10 TYR CB   C  -1.885  -0.687   4.075 1.00 . A A . 10 TYR CB   1 1 
        1   165 1 1 10 TYR CD1  C  -4.385  -0.592   3.737 1.00 . A A . 10 TYR CD1  1 1 
        1   166 1 1 10 TYR CD2  C  -3.178   1.463   3.798 1.00 . A A . 10 TYR CD2  1 1 
        1   167 1 1 10 TYR CE1  C  -5.564   0.102   3.545 1.00 . A A . 10 TYR CE1  1 1 
        1   168 1 1 10 TYR CE2  C  -4.354   2.164   3.607 1.00 . A A . 10 TYR CE2  1 1 
        1   169 1 1 10 TYR CG   C  -3.174   0.076   3.866 1.00 . A A . 10 TYR CG   1 1 
        1   170 1 1 10 TYR CZ   C  -5.544   1.479   3.482 1.00 . A A . 10 TYR CZ   1 1 
        1   171 1 1 10 TYR H    H   0.351  -1.259   5.118 1.00 . A A . 10 TYR H    1 1 
        1   172 1 1 10 TYR HA   H  -2.109  -0.537   6.196 1.00 . A A . 10 TYR HA   1 1 
        1   173 1 1 10 TYR HB2  H  -1.066  -0.014   3.877 1.00 . A A . 10 TYR HB2  1 1 
        1   174 1 1 10 TYR HB3  H  -1.859  -1.499   3.362 1.00 . A A . 10 TYR HB3  1 1 
        1   175 1 1 10 TYR HD1  H  -4.397  -1.670   3.788 1.00 . A A . 10 TYR HD1  1 1 
        1   176 1 1 10 TYR HD2  H  -2.244   1.997   3.896 1.00 . A A . 10 TYR HD2  1 1 
        1   177 1 1 10 TYR HE1  H  -6.497  -0.436   3.448 1.00 . A A . 10 TYR HE1  1 1 
        1   178 1 1 10 TYR HE2  H  -4.338   3.243   3.557 1.00 . A A . 10 TYR HE2  1 1 
        1   179 1 1 10 TYR HH   H  -6.814   2.832   3.982 1.00 . A A . 10 TYR HH   1 1 
        1   180 1 1 10 TYR N    N  -0.326  -1.487   5.789 1.00 . A A . 10 TYR N    1 1 
        1   181 1 1 10 TYR O    O  -3.670  -2.531   6.115 1.00 . A A . 10 TYR O    1 1 
        1   182 1 1 10 TYR OH   O  -6.717   2.173   3.291 1.00 . A A . 10 TYR OH   1 1 
        1   183 1 1 11 ALA C    C  -2.870  -5.376   6.675 1.00 . A A . 11 ALA C    1 1 
        1   184 1 1 11 ALA CA   C  -2.640  -4.944   5.231 1.00 . A A . 11 ALA CA   1 1 
        1   185 1 1 11 ALA CB   C  -1.834  -5.996   4.485 1.00 . A A . 11 ALA CB   1 1 
        1   186 1 1 11 ALA H    H  -1.070  -3.600   4.776 1.00 . A A . 11 ALA H    1 1 
        1   187 1 1 11 ALA HA   H  -3.597  -4.845   4.740 1.00 . A A . 11 ALA HA   1 1 
        1   188 1 1 11 ALA HB1  H  -0.837  -6.045   4.900 1.00 . A A . 11 ALA HB1  1 1 
        1   189 1 1 11 ALA HB2  H  -1.776  -5.733   3.440 1.00 . A A . 11 ALA HB2  1 1 
        1   190 1 1 11 ALA HB3  H  -2.314  -6.958   4.589 1.00 . A A . 11 ALA HB3  1 1 
        1   191 1 1 11 ALA N    N  -1.967  -3.652   5.165 1.00 . A A . 11 ALA N    1 1 
        1   192 1 1 11 ALA O    O  -3.987  -5.720   7.060 1.00 . A A . 11 ALA O    1 1 
        1   193 1 1 12 MET C    C  -2.590  -4.689   9.707 1.00 . A A . 12 MET C    1 1 
        1   194 1 1 12 MET CA   C  -1.892  -5.756   8.870 1.00 . A A . 12 MET CA   1 1 
        1   195 1 1 12 MET CB   C  -0.493  -6.028   9.428 1.00 . A A . 12 MET CB   1 1 
        1   196 1 1 12 MET CE   C   2.063  -6.772  11.117 1.00 . A A . 12 MET CE   1 1 
        1   197 1 1 12 MET CG   C  -0.243  -7.490   9.760 1.00 . A A . 12 MET CG   1 1 
        1   198 1 1 12 MET H    H  -0.942  -5.084   7.106 1.00 . A A . 12 MET H    1 1 
        1   199 1 1 12 MET HA   H  -2.468  -6.663   8.916 1.00 . A A . 12 MET HA   1 1 
        1   200 1 1 12 MET HB2  H   0.239  -5.718   8.698 1.00 . A A . 12 MET HB2  1 1 
        1   201 1 1 12 MET HB3  H  -0.356  -5.449  10.329 1.00 . A A . 12 MET HB3  1 1 
        1   202 1 1 12 MET HE1  H   2.180  -7.314  12.044 1.00 . A A . 12 MET HE1  1 1 
        1   203 1 1 12 MET HE2  H   1.333  -5.988  11.248 1.00 . A A . 12 MET HE2  1 1 
        1   204 1 1 12 MET HE3  H   3.010  -6.338  10.832 1.00 . A A . 12 MET HE3  1 1 
        1   205 1 1 12 MET HG2  H  -0.690  -7.708  10.718 1.00 . A A . 12 MET HG2  1 1 
        1   206 1 1 12 MET HG3  H  -0.708  -8.102   9.000 1.00 . A A . 12 MET HG3  1 1 
        1   207 1 1 12 MET N    N  -1.806  -5.362   7.469 1.00 . A A . 12 MET N    1 1 
        1   208 1 1 12 MET O    O  -3.132  -4.978  10.773 1.00 . A A . 12 MET O    1 1 
        1   209 1 1 12 MET SD   S   1.512  -7.894   9.836 1.00 . A A . 12 MET SD   1 1 
        1   210 1 1 13 ARG C    C  -4.691  -2.271   9.638 1.00 . A A . 13 ARG C    1 1 
        1   211 1 1 13 ARG CA   C  -3.193  -2.341   9.925 1.00 . A A . 13 ARG CA   1 1 
        1   212 1 1 13 ARG CB   C  -2.524  -1.023   9.530 1.00 . A A . 13 ARG CB   1 1 
        1   213 1 1 13 ARG CD   C  -1.864   1.217  10.452 1.00 . A A . 13 ARG CD   1 1 
        1   214 1 1 13 ARG CG   C  -2.952   0.157  10.386 1.00 . A A . 13 ARG CG   1 1 
        1   215 1 1 13 ARG CZ   C  -1.970   2.037  12.774 1.00 . A A . 13 ARG CZ   1 1 
        1   216 1 1 13 ARG H    H  -2.118  -3.288   8.367 1.00 . A A . 13 ARG H    1 1 
        1   217 1 1 13 ARG HA   H  -3.052  -2.498  10.983 1.00 . A A . 13 ARG HA   1 1 
        1   218 1 1 13 ARG HB2  H  -1.452  -1.136   9.621 1.00 . A A . 13 ARG HB2  1 1 
        1   219 1 1 13 ARG HB3  H  -2.770  -0.800   8.499 1.00 . A A . 13 ARG HB3  1 1 
        1   220 1 1 13 ARG HD2  H  -0.925   0.738  10.687 1.00 . A A . 13 ARG HD2  1 1 
        1   221 1 1 13 ARG HD3  H  -1.790   1.699   9.489 1.00 . A A . 13 ARG HD3  1 1 
        1   222 1 1 13 ARG HE   H  -2.485   3.096  11.163 1.00 . A A . 13 ARG HE   1 1 
        1   223 1 1 13 ARG HG2  H  -3.842   0.596   9.960 1.00 . A A . 13 ARG HG2  1 1 
        1   224 1 1 13 ARG HG3  H  -3.161  -0.196  11.388 1.00 . A A . 13 ARG HG3  1 1 
        1   225 1 1 13 ARG HH11 H  -1.302   0.137  12.587 1.00 . A A . 13 ARG HH11 1 1 
        1   226 1 1 13 ARG HH12 H  -1.384   0.739  14.209 1.00 . A A . 13 ARG HH12 1 1 
        1   227 1 1 13 ARG HH21 H  -2.593   3.889  13.294 1.00 . A A . 13 ARG HH21 1 1 
        1   228 1 1 13 ARG HH22 H  -2.115   2.870  14.610 1.00 . A A . 13 ARG HH22 1 1 
        1   229 1 1 13 ARG N    N  -2.569  -3.455   9.219 1.00 . A A . 13 ARG N    1 1 
        1   230 1 1 13 ARG NE   N  -2.147   2.228  11.469 1.00 . A A . 13 ARG NE   1 1 
        1   231 1 1 13 ARG NH1  N  -1.514   0.876  13.227 1.00 . A A . 13 ARG NH1  1 1 
        1   232 1 1 13 ARG NH2  N  -2.249   3.013  13.630 1.00 . A A . 13 ARG NH2  1 1 
        1   233 1 1 13 ARG O    O  -5.514  -2.526  10.516 1.00 . A A . 13 ARG O    1 1 
        1   234 1 1 14 PHE C    C  -7.031  -3.148   7.676 1.00 . A A . 14 PHE C    1 1 
        1   235 1 1 14 PHE CA   C  -6.419  -1.786   7.999 1.00 . A A . 14 PHE CA   1 1 
        1   236 1 1 14 PHE CB   C  -6.492  -0.872   6.786 1.00 . A A . 14 PHE CB   1 1 
        1   237 1 1 14 PHE CD1  C  -6.599   1.487   7.622 1.00 . A A . 14 PHE CD1  1 1 
        1   238 1 1 14 PHE CD2  C  -4.558   0.719   6.672 1.00 . A A . 14 PHE CD2  1 1 
        1   239 1 1 14 PHE CE1  C  -6.032   2.714   7.852 1.00 . A A . 14 PHE CE1  1 1 
        1   240 1 1 14 PHE CE2  C  -3.989   1.946   6.901 1.00 . A A . 14 PHE CE2  1 1 
        1   241 1 1 14 PHE CG   C  -5.872   0.471   7.027 1.00 . A A . 14 PHE CG   1 1 
        1   242 1 1 14 PHE CZ   C  -4.727   2.941   7.490 1.00 . A A . 14 PHE CZ   1 1 
        1   243 1 1 14 PHE H    H  -4.340  -1.706   7.752 1.00 . A A . 14 PHE H    1 1 
        1   244 1 1 14 PHE HA   H  -6.970  -1.335   8.809 1.00 . A A . 14 PHE HA   1 1 
        1   245 1 1 14 PHE HB2  H  -5.972  -1.337   5.959 1.00 . A A . 14 PHE HB2  1 1 
        1   246 1 1 14 PHE HB3  H  -7.517  -0.725   6.520 1.00 . A A . 14 PHE HB3  1 1 
        1   247 1 1 14 PHE HD1  H  -7.615   1.312   7.905 1.00 . A A . 14 PHE HD1  1 1 
        1   248 1 1 14 PHE HD2  H  -3.978  -0.052   6.213 1.00 . A A . 14 PHE HD2  1 1 
        1   249 1 1 14 PHE HE1  H  -6.611   3.500   8.315 1.00 . A A . 14 PHE HE1  1 1 
        1   250 1 1 14 PHE HE2  H  -2.961   2.127   6.619 1.00 . A A . 14 PHE HE2  1 1 
        1   251 1 1 14 PHE HZ   H  -4.289   3.889   7.668 1.00 . A A . 14 PHE HZ   1 1 
        1   252 1 1 14 PHE N    N  -5.036  -1.909   8.406 1.00 . A A . 14 PHE N    1 1 
        1   253 1 1 14 PHE O    O  -8.232  -3.354   7.842 1.00 . A A . 14 PHE O    1 1 
        1   254 1 1 15 GLY C    C  -6.413  -5.763   5.430 1.00 . A A . 15 GLY C    1 1 
        1   255 1 1 15 GLY CA   C  -6.677  -5.402   6.878 1.00 . A A . 15 GLY CA   1 1 
        1   256 1 1 15 GLY H    H  -5.248  -3.854   7.103 1.00 . A A . 15 GLY H    1 1 
        1   257 1 1 15 GLY HA2  H  -6.184  -6.123   7.513 1.00 . A A . 15 GLY HA2  1 1 
        1   258 1 1 15 GLY HA3  H  -7.742  -5.445   7.060 1.00 . A A . 15 GLY HA3  1 1 
        1   259 1 1 15 GLY N    N  -6.197  -4.074   7.216 1.00 . A A . 15 GLY N    1 1 
        1   260 1 1 15 GLY O    O  -6.028  -4.910   4.631 1.00 . A A . 15 GLY O    1 1 
        1   261 1 1 16 GLN C    C  -7.666  -7.346   2.888 1.00 . A A . 16 GLN C    1 1 
        1   262 1 1 16 GLN CA   C  -6.402  -7.503   3.729 1.00 . A A . 16 GLN CA   1 1 
        1   263 1 1 16 GLN CB   C  -5.960  -8.968   3.739 1.00 . A A . 16 GLN CB   1 1 
        1   264 1 1 16 GLN CD   C  -4.311 -10.593   4.747 1.00 . A A . 16 GLN CD   1 1 
        1   265 1 1 16 GLN CG   C  -4.551  -9.174   4.270 1.00 . A A . 16 GLN CG   1 1 
        1   266 1 1 16 GLN H    H  -6.927  -7.664   5.774 1.00 . A A . 16 GLN H    1 1 
        1   267 1 1 16 GLN HA   H  -5.617  -6.903   3.292 1.00 . A A . 16 GLN HA   1 1 
        1   268 1 1 16 GLN HB2  H  -6.642  -9.532   4.359 1.00 . A A . 16 GLN HB2  1 1 
        1   269 1 1 16 GLN HB3  H  -6.002  -9.350   2.731 1.00 . A A . 16 GLN HB3  1 1 
        1   270 1 1 16 GLN HE21 H  -4.103 -11.214   2.866 1.00 . A A . 16 GLN HE21 1 1 
        1   271 1 1 16 GLN HE22 H  -3.936 -12.434   4.090 1.00 . A A . 16 GLN HE22 1 1 
        1   272 1 1 16 GLN HG2  H  -3.847  -8.952   3.482 1.00 . A A . 16 GLN HG2  1 1 
        1   273 1 1 16 GLN HG3  H  -4.390  -8.498   5.097 1.00 . A A . 16 GLN HG3  1 1 
        1   274 1 1 16 GLN N    N  -6.620  -7.032   5.092 1.00 . A A . 16 GLN N    1 1 
        1   275 1 1 16 GLN NE2  N  -4.095 -11.505   3.807 1.00 . A A . 16 GLN NE2  1 1 
        1   276 1 1 16 GLN O    O  -7.596  -7.175   1.671 1.00 . A A . 16 GLN O    1 1 
        1   277 1 1 16 GLN OE1  O  -4.316 -10.866   5.948 1.00 . A A . 16 GLN OE1  1 1 
        1   278 1 1 17 THR C    C -10.410  -5.804   2.577 1.00 . A A . 17 THR C    1 1 
        1   279 1 1 17 THR CA   C -10.090  -7.270   2.860 1.00 . A A . 17 THR CA   1 1 
        1   280 1 1 17 THR CB   C -11.210  -7.891   3.699 1.00 . A A . 17 THR CB   1 1 
        1   281 1 1 17 THR CG2  C -12.570  -7.826   3.031 1.00 . A A . 17 THR CG2  1 1 
        1   282 1 1 17 THR H    H  -8.811  -7.543   4.516 1.00 . A A . 17 THR H    1 1 
        1   283 1 1 17 THR HA   H -10.020  -7.799   1.922 1.00 . A A . 17 THR HA   1 1 
        1   284 1 1 17 THR HB   H -11.280  -7.361   4.638 1.00 . A A . 17 THR HB   1 1 
        1   285 1 1 17 THR HG1  H -10.620  -9.337   4.877 1.00 . A A . 17 THR HG1  1 1 
        1   286 1 1 17 THR HG21 H -12.820  -6.796   2.829 1.00 . A A . 17 THR HG21 1 1 
        1   287 1 1 17 THR HG22 H -13.310  -8.257   3.685 1.00 . A A . 17 THR HG22 1 1 
        1   288 1 1 17 THR HG23 H -12.540  -8.379   2.104 1.00 . A A . 17 THR HG23 1 1 
        1   289 1 1 17 THR N    N  -8.820  -7.405   3.546 1.00 . A A . 17 THR N    1 1 
        1   290 1 1 17 THR O    O -10.800  -5.447   1.465 1.00 . A A . 17 THR O    1 1 
        1   291 1 1 17 THR OG1  O -10.940  -9.252   3.976 1.00 . A A . 17 THR OG1  1 1 
        1   292 1 1 18 LYS C    C  -9.646  -2.917   2.359 1.00 . A A . 18 LYS C    1 1 
        1   293 1 1 18 LYS CA   C -10.510  -3.534   3.451 1.00 . A A . 18 LYS CA   1 1 
        1   294 1 1 18 LYS CB   C -10.260  -2.817   4.780 1.00 . A A . 18 LYS CB   1 1 
        1   295 1 1 18 LYS CD   C -10.350  -0.535   5.830 1.00 . A A . 18 LYS CD   1 1 
        1   296 1 1 18 LYS CE   C -10.870   0.876   5.624 1.00 . A A . 18 LYS CE   1 1 
        1   297 1 1 18 LYS CG   C -11.060  -1.534   4.937 1.00 . A A . 18 LYS CG   1 1 
        1   298 1 1 18 LYS H    H  -9.935  -5.307   4.452 1.00 . A A . 18 LYS H    1 1 
        1   299 1 1 18 LYS HA   H -11.550  -3.417   3.177 1.00 . A A . 18 LYS HA   1 1 
        1   300 1 1 18 LYS HB2  H -10.530  -3.481   5.589 1.00 . A A . 18 LYS HB2  1 1 
        1   301 1 1 18 LYS HB3  H  -9.219  -2.572   4.856 1.00 . A A . 18 LYS HB3  1 1 
        1   302 1 1 18 LYS HD2  H -10.490  -0.815   6.860 1.00 . A A . 18 LYS HD2  1 1 
        1   303 1 1 18 LYS HD3  H  -9.296  -0.553   5.598 1.00 . A A . 18 LYS HD3  1 1 
        1   304 1 1 18 LYS HE2  H -10.320   1.551   6.258 1.00 . A A . 18 LYS HE2  1 1 
        1   305 1 1 18 LYS HE3  H -10.730   1.154   4.589 1.00 . A A . 18 LYS HE3  1 1 
        1   306 1 1 18 LYS HG2  H -11.210  -1.090   3.962 1.00 . A A . 18 LYS HG2  1 1 
        1   307 1 1 18 LYS HG3  H -12.020  -1.770   5.373 1.00 . A A . 18 LYS HG3  1 1 
        1   308 1 1 18 LYS HZ1  H -12.850   0.206   5.506 1.00 . A A . 18 LYS HZ1  1 1 
        1   309 1 1 18 LYS HZ2  H -12.700   1.888   5.610 1.00 . A A . 18 LYS HZ2  1 1 
        1   310 1 1 18 LYS HZ3  H -12.460   0.933   6.984 1.00 . A A . 18 LYS HZ3  1 1 
        1   311 1 1 18 LYS N    N -10.240  -4.961   3.589 1.00 . A A . 18 LYS N    1 1 
        1   312 1 1 18 LYS NZ   N -12.320   0.982   5.954 1.00 . A A . 18 LYS NZ   1 1 
        1   313 1 1 18 LYS O    O -10.070  -2.002   1.655 1.00 . A A . 18 LYS O    1 1 
        1   314 1 1 19 THR C    C  -7.899  -3.383  -0.176 1.00 . A A . 19 THR C    1 1 
        1   315 1 1 19 THR CA   C  -7.496  -2.919   1.219 1.00 . A A . 19 THR CA   1 1 
        1   316 1 1 19 THR CB   C  -6.073  -3.386   1.531 1.00 . A A . 19 THR CB   1 1 
        1   317 1 1 19 THR CG2  C  -5.017  -2.682   0.706 1.00 . A A . 19 THR CG2  1 1 
        1   318 1 1 19 THR H    H  -8.140  -4.150   2.817 1.00 . A A . 19 THR H    1 1 
        1   319 1 1 19 THR HA   H  -7.525  -1.841   1.251 1.00 . A A . 19 THR HA   1 1 
        1   320 1 1 19 THR HB   H  -5.999  -4.445   1.330 1.00 . A A . 19 THR HB   1 1 
        1   321 1 1 19 THR HG1  H  -5.271  -3.921   3.236 1.00 . A A . 19 THR HG1  1 1 
        1   322 1 1 19 THR HG21 H  -4.823  -3.251  -0.191 1.00 . A A . 19 THR HG21 1 1 
        1   323 1 1 19 THR HG22 H  -4.107  -2.598   1.282 1.00 . A A . 19 THR HG22 1 1 
        1   324 1 1 19 THR HG23 H  -5.367  -1.696   0.440 1.00 . A A . 19 THR HG23 1 1 
        1   325 1 1 19 THR N    N  -8.425  -3.423   2.225 1.00 . A A . 19 THR N    1 1 
        1   326 1 1 19 THR O    O  -8.064  -2.572  -1.087 1.00 . A A . 19 THR O    1 1 
        1   327 1 1 19 THR OG1  O  -5.765  -3.171   2.898 1.00 . A A . 19 THR OG1  1 1 
        1   328 1 1 20 ALA C    C  -9.767  -4.692  -2.108 1.00 . A A . 20 ALA C    1 1 
        1   329 1 1 20 ALA CA   C  -8.441  -5.266  -1.620 1.00 . A A . 20 ALA CA   1 1 
        1   330 1 1 20 ALA CB   C  -8.527  -6.781  -1.515 1.00 . A A . 20 ALA CB   1 1 
        1   331 1 1 20 ALA H    H  -7.911  -5.288   0.429 1.00 . A A . 20 ALA H    1 1 
        1   332 1 1 20 ALA HA   H  -7.670  -5.023  -2.337 1.00 . A A . 20 ALA HA   1 1 
        1   333 1 1 20 ALA HB1  H  -8.137  -7.228  -2.417 1.00 . A A . 20 ALA HB1  1 1 
        1   334 1 1 20 ALA HB2  H  -9.559  -7.075  -1.385 1.00 . A A . 20 ALA HB2  1 1 
        1   335 1 1 20 ALA HB3  H  -7.948  -7.117  -0.667 1.00 . A A . 20 ALA HB3  1 1 
        1   336 1 1 20 ALA N    N  -8.057  -4.694  -0.336 1.00 . A A . 20 ALA N    1 1 
        1   337 1 1 20 ALA O    O -10.030  -4.665  -3.308 1.00 . A A . 20 ALA O    1 1 
        1   338 1 1 21 LYS C    C -11.740  -2.244  -2.049 1.00 . A A . 21 LYS C    1 1 
        1   339 1 1 21 LYS CA   C -11.890  -3.664  -1.506 1.00 . A A . 21 LYS CA   1 1 
        1   340 1 1 21 LYS CB   C -12.800  -3.661  -0.278 1.00 . A A . 21 LYS CB   1 1 
        1   341 1 1 21 LYS CD   C -15.220  -4.318  -0.397 1.00 . A A . 21 LYS CD   1 1 
        1   342 1 1 21 LYS CE   C -15.720  -4.441  -1.828 1.00 . A A . 21 LYS CE   1 1 
        1   343 1 1 21 LYS CG   C -13.790  -4.813  -0.256 1.00 . A A . 21 LYS CG   1 1 
        1   344 1 1 21 LYS H    H -10.320  -4.283  -0.230 1.00 . A A . 21 LYS H    1 1 
        1   345 1 1 21 LYS HA   H -12.330  -4.283  -2.272 1.00 . A A . 21 LYS HA   1 1 
        1   346 1 1 21 LYS HB2  H -12.190  -3.727   0.610 1.00 . A A . 21 LYS HB2  1 1 
        1   347 1 1 21 LYS HB3  H -13.350  -2.734  -0.254 1.00 . A A . 21 LYS HB3  1 1 
        1   348 1 1 21 LYS HD2  H -15.860  -4.907   0.244 1.00 . A A . 21 LYS HD2  1 1 
        1   349 1 1 21 LYS HD3  H -15.270  -3.282  -0.097 1.00 . A A . 21 LYS HD3  1 1 
        1   350 1 1 21 LYS HE2  H -15.670  -3.470  -2.300 1.00 . A A . 21 LYS HE2  1 1 
        1   351 1 1 21 LYS HE3  H -15.080  -5.133  -2.360 1.00 . A A . 21 LYS HE3  1 1 
        1   352 1 1 21 LYS HG2  H -13.570  -5.481  -1.075 1.00 . A A . 21 LYS HG2  1 1 
        1   353 1 1 21 LYS HG3  H -13.700  -5.341   0.680 1.00 . A A . 21 LYS HG3  1 1 
        1   354 1 1 21 LYS HZ1  H -17.610  -4.731  -0.996 1.00 . A A . 21 LYS HZ1  1 1 
        1   355 1 1 21 LYS HZ2  H -17.140  -5.956  -2.061 1.00 . A A . 21 LYS HZ2  1 1 
        1   356 1 1 21 LYS HZ3  H -17.630  -4.457  -2.665 1.00 . A A . 21 LYS HZ3  1 1 
        1   357 1 1 21 LYS N    N -10.590  -4.234  -1.170 1.00 . A A . 21 LYS N    1 1 
        1   358 1 1 21 LYS NZ   N -17.120  -4.931  -1.893 1.00 . A A . 21 LYS NZ   1 1 
        1   359 1 1 21 LYS O    O -12.310  -1.905  -3.088 1.00 . A A . 21 LYS O    1 1 
        1   360 1 1 22 ASP C    C  -9.937   0.027  -3.029 1.00 . A A . 22 ASP C    1 1 
        1   361 1 1 22 ASP CA   C -10.760  -0.038  -1.749 1.00 . A A . 22 ASP CA   1 1 
        1   362 1 1 22 ASP CB   C -10.060   0.738  -0.633 1.00 . A A . 22 ASP CB   1 1 
        1   363 1 1 22 ASP CG   C -11.020   1.584   0.175 1.00 . A A . 22 ASP CG   1 1 
        1   364 1 1 22 ASP H    H -10.550  -1.745  -0.518 1.00 . A A . 22 ASP H    1 1 
        1   365 1 1 22 ASP HA   H -11.720   0.409  -1.935 1.00 . A A . 22 ASP HA   1 1 
        1   366 1 1 22 ASP HB2  H  -9.581   0.038   0.036 1.00 . A A . 22 ASP HB2  1 1 
        1   367 1 1 22 ASP HB3  H  -9.317   1.390  -1.069 1.00 . A A . 22 ASP HB3  1 1 
        1   368 1 1 22 ASP N    N -10.980  -1.418  -1.339 1.00 . A A . 22 ASP N    1 1 
        1   369 1 1 22 ASP O    O -10.100   0.941  -3.839 1.00 . A A . 22 ASP O    1 1 
        1   370 1 1 22 ASP OD1  O -11.650   2.496  -0.409 1.00 . A A . 22 ASP OD1  1 1 
        1   371 1 1 22 ASP OD2  O -11.150   1.336   1.393 1.00 . A A . 22 ASP OD2  1 1 
        1   372 1 1 23 LEU C    C  -8.954  -1.571  -5.582 1.00 . A A . 23 LEU C    1 1 
        1   373 1 1 23 LEU CA   C  -8.198  -0.997  -4.388 1.00 . A A . 23 LEU CA   1 1 
        1   374 1 1 23 LEU CB   C  -6.951  -1.840  -4.108 1.00 . A A . 23 LEU CB   1 1 
        1   375 1 1 23 LEU CD1  C  -5.685  -1.272  -2.018 1.00 . A A . 23 LEU CD1  1 1 
        1   376 1 1 23 LEU CD2  C  -4.468  -1.493  -4.192 1.00 . A A . 23 LEU CD2  1 1 
        1   377 1 1 23 LEU CG   C  -5.766  -1.067  -3.522 1.00 . A A . 23 LEU CG   1 1 
        1   378 1 1 23 LEU H    H  -8.965  -1.646  -2.526 1.00 . A A . 23 LEU H    1 1 
        1   379 1 1 23 LEU HA   H  -7.894   0.013  -4.621 1.00 . A A . 23 LEU HA   1 1 
        1   380 1 1 23 LEU HB2  H  -7.222  -2.624  -3.416 1.00 . A A . 23 LEU HB2  1 1 
        1   381 1 1 23 LEU HB3  H  -6.635  -2.293  -5.035 1.00 . A A . 23 LEU HB3  1 1 
        1   382 1 1 23 LEU HD11 H  -5.566  -2.324  -1.805 1.00 . A A . 23 LEU HD11 1 1 
        1   383 1 1 23 LEU HD12 H  -6.590  -0.911  -1.554 1.00 . A A . 23 LEU HD12 1 1 
        1   384 1 1 23 LEU HD13 H  -4.837  -0.729  -1.626 1.00 . A A . 23 LEU HD13 1 1 
        1   385 1 1 23 LEU HD21 H  -4.199  -2.483  -3.857 1.00 . A A . 23 LEU HD21 1 1 
        1   386 1 1 23 LEU HD22 H  -3.683  -0.798  -3.929 1.00 . A A . 23 LEU HD22 1 1 
        1   387 1 1 23 LEU HD23 H  -4.600  -1.498  -5.264 1.00 . A A . 23 LEU HD23 1 1 
        1   388 1 1 23 LEU HG   H  -5.908  -0.011  -3.707 1.00 . A A . 23 LEU HG   1 1 
        1   389 1 1 23 LEU N    N  -9.051  -0.946  -3.207 1.00 . A A . 23 LEU N    1 1 
        1   390 1 1 23 LEU O    O  -8.660  -1.243  -6.731 1.00 . A A . 23 LEU O    1 1 
        1   391 1 1 24 GLY C    C -10.060  -4.295  -6.912 1.00 . A A . 24 GLY C    1 1 
        1   392 1 1 24 GLY CA   C -10.710  -3.034  -6.368 1.00 . A A . 24 GLY CA   1 1 
        1   393 1 1 24 GLY H    H -10.120  -2.655  -4.369 1.00 . A A . 24 GLY H    1 1 
        1   394 1 1 24 GLY HA2  H -11.690  -3.281  -5.984 1.00 . A A . 24 GLY HA2  1 1 
        1   395 1 1 24 GLY HA3  H -10.810  -2.322  -7.171 1.00 . A A . 24 GLY HA3  1 1 
        1   396 1 1 24 GLY N    N  -9.929  -2.430  -5.305 1.00 . A A . 24 GLY N    1 1 
        1   397 1 1 24 GLY O    O -10.270  -4.655  -8.070 1.00 . A A . 24 GLY O    1 1 
        1   398 1 1 25 VAL C    C  -9.117  -7.387  -5.681 1.00 . A A . 25 VAL C    1 1 
        1   399 1 1 25 VAL CA   C  -8.605  -6.192  -6.477 1.00 . A A . 25 VAL CA   1 1 
        1   400 1 1 25 VAL CB   C  -7.081  -6.079  -6.288 1.00 . A A . 25 VAL CB   1 1 
        1   401 1 1 25 VAL CG1  C  -6.482  -5.134  -7.317 1.00 . A A . 25 VAL CG1  1 1 
        1   402 1 1 25 VAL CG2  C  -6.752  -5.620  -4.876 1.00 . A A . 25 VAL CG2  1 1 
        1   403 1 1 25 VAL H    H  -9.156  -4.628  -5.164 1.00 . A A . 25 VAL H    1 1 
        1   404 1 1 25 VAL HA   H  -8.806  -6.357  -7.526 1.00 . A A . 25 VAL HA   1 1 
        1   405 1 1 25 VAL HB   H  -6.646  -7.057  -6.435 1.00 . A A . 25 VAL HB   1 1 
        1   406 1 1 25 VAL HG11 H  -5.525  -4.779  -6.966 1.00 . A A . 25 VAL HG11 1 1 
        1   407 1 1 25 VAL HG12 H  -7.146  -4.294  -7.463 1.00 . A A . 25 VAL HG12 1 1 
        1   408 1 1 25 VAL HG13 H  -6.350  -5.656  -8.253 1.00 . A A . 25 VAL HG13 1 1 
        1   409 1 1 25 VAL HG21 H  -7.573  -5.863  -4.216 1.00 . A A . 25 VAL HG21 1 1 
        1   410 1 1 25 VAL HG22 H  -6.590  -4.553  -4.872 1.00 . A A . 25 VAL HG22 1 1 
        1   411 1 1 25 VAL HG23 H  -5.857  -6.121  -4.534 1.00 . A A . 25 VAL HG23 1 1 
        1   412 1 1 25 VAL N    N  -9.283  -4.965  -6.074 1.00 . A A . 25 VAL N    1 1 
        1   413 1 1 25 VAL O    O -10.000  -7.251  -4.836 1.00 . A A . 25 VAL O    1 1 
        1   414 1 1 26 GLN C    C  -7.975 -10.105  -4.141 1.00 . A A . 26 GLN C    1 1 
        1   415 1 1 26 GLN CA   C  -8.951  -9.778  -5.264 1.00 . A A . 26 GLN CA   1 1 
        1   416 1 1 26 GLN CB   C  -9.024 -10.948  -6.248 1.00 . A A . 26 GLN CB   1 1 
        1   417 1 1 26 GLN CD   C -11.440 -10.686  -6.906 1.00 . A A . 26 GLN CD   1 1 
        1   418 1 1 26 GLN CG   C -10.000 -10.728  -7.382 1.00 . A A . 26 GLN CG   1 1 
        1   419 1 1 26 GLN H    H  -7.853  -8.606  -6.636 1.00 . A A . 26 GLN H    1 1 
        1   420 1 1 26 GLN HA   H  -9.929  -9.616  -4.839 1.00 . A A . 26 GLN HA   1 1 
        1   421 1 1 26 GLN HB2  H  -8.045 -11.105  -6.675 1.00 . A A . 26 GLN HB2  1 1 
        1   422 1 1 26 GLN HB3  H  -9.319 -11.837  -5.711 1.00 . A A . 26 GLN HB3  1 1 
        1   423 1 1 26 GLN HE21 H -12.090 -10.686  -8.786 1.00 . A A . 26 GLN HE21 1 1 
        1   424 1 1 26 GLN HE22 H -13.320 -10.645  -7.569 1.00 . A A . 26 GLN HE22 1 1 
        1   425 1 1 26 GLN HG2  H  -9.779  -9.789  -7.864 1.00 . A A . 26 GLN HG2  1 1 
        1   426 1 1 26 GLN HG3  H  -9.903 -11.531  -8.094 1.00 . A A . 26 GLN HG3  1 1 
        1   427 1 1 26 GLN N    N  -8.553  -8.560  -5.956 1.00 . A A . 26 GLN N    1 1 
        1   428 1 1 26 GLN NE2  N -12.380 -10.671  -7.849 1.00 . A A . 26 GLN NE2  1 1 
        1   429 1 1 26 GLN O    O  -6.770  -9.892  -4.268 1.00 . A A . 26 GLN O    1 1 
        1   430 1 1 26 GLN OE1  O -11.710 -10.670  -5.705 1.00 . A A . 26 GLN OE1  1 1 
        1   431 1 1 27 GLN C    C  -6.617 -12.004  -2.274 1.00 . A A . 27 GLN C    1 1 
        1   432 1 1 27 GLN CA   C  -7.684 -10.984  -1.892 1.00 . A A . 27 GLN CA   1 1 
        1   433 1 1 27 GLN CB   C  -8.562 -11.542  -0.768 1.00 . A A . 27 GLN CB   1 1 
        1   434 1 1 27 GLN CD   C -10.470 -11.095   0.814 1.00 . A A . 27 GLN CD   1 1 
        1   435 1 1 27 GLN CG   C  -9.782 -10.687  -0.468 1.00 . A A . 27 GLN CG   1 1 
        1   436 1 1 27 GLN H    H  -9.474 -10.771  -3.005 1.00 . A A . 27 GLN H    1 1 
        1   437 1 1 27 GLN HA   H  -7.198 -10.088  -1.544 1.00 . A A . 27 GLN HA   1 1 
        1   438 1 1 27 GLN HB2  H  -8.899 -12.529  -1.046 1.00 . A A . 27 GLN HB2  1 1 
        1   439 1 1 27 GLN HB3  H  -7.969 -11.614   0.132 1.00 . A A . 27 GLN HB3  1 1 
        1   440 1 1 27 GLN HE21 H -11.650  -9.497   0.712 1.00 . A A . 27 GLN HE21 1 1 
        1   441 1 1 27 GLN HE22 H -11.910 -10.536   2.069 1.00 . A A . 27 GLN HE22 1 1 
        1   442 1 1 27 GLN HG2  H  -9.471  -9.657  -0.379 1.00 . A A . 27 GLN HG2  1 1 
        1   443 1 1 27 GLN HG3  H -10.480 -10.781  -1.286 1.00 . A A . 27 GLN HG3  1 1 
        1   444 1 1 27 GLN N    N  -8.506 -10.625  -3.042 1.00 . A A . 27 GLN N    1 1 
        1   445 1 1 27 GLN NE2  N -11.450 -10.296   1.241 1.00 . A A . 27 GLN NE2  1 1 
        1   446 1 1 27 GLN O    O  -5.605 -12.144  -1.586 1.00 . A A . 27 GLN O    1 1 
        1   447 1 1 27 GLN OE1  O -10.140 -12.118   1.415 1.00 . A A . 27 GLN OE1  1 1 
        1   448 1 1 28 SER C    C  -4.589 -13.078  -4.267 1.00 . A A . 28 SER C    1 1 
        1   449 1 1 28 SER CA   C  -5.906 -13.720  -3.846 1.00 . A A . 28 SER CA   1 1 
        1   450 1 1 28 SER CB   C  -6.504 -14.499  -5.018 1.00 . A A . 28 SER CB   1 1 
        1   451 1 1 28 SER H    H  -7.671 -12.559  -3.878 1.00 . A A . 28 SER H    1 1 
        1   452 1 1 28 SER HA   H  -5.716 -14.403  -3.032 1.00 . A A . 28 SER HA   1 1 
        1   453 1 1 28 SER HB2  H  -7.217 -13.874  -5.536 1.00 . A A . 28 SER HB2  1 1 
        1   454 1 1 28 SER HB3  H  -5.716 -14.788  -5.697 1.00 . A A . 28 SER HB3  1 1 
        1   455 1 1 28 SER HG   H  -6.520 -16.347  -4.369 1.00 . A A . 28 SER HG   1 1 
        1   456 1 1 28 SER N    N  -6.848 -12.714  -3.373 1.00 . A A . 28 SER N    1 1 
        1   457 1 1 28 SER O    O  -3.511 -13.597  -3.977 1.00 . A A . 28 SER O    1 1 
        1   458 1 1 28 SER OG   O  -7.169 -15.668  -4.568 1.00 . A A . 28 SER OG   1 1 
        1   459 1 1 29 ALA C    C  -2.740 -10.607  -4.250 1.00 . A A . 29 ALA C    1 1 
        1   460 1 1 29 ALA CA   C  -3.498 -11.230  -5.417 1.00 . A A . 29 ALA CA   1 1 
        1   461 1 1 29 ALA CB   C  -3.886 -10.161  -6.427 1.00 . A A . 29 ALA CB   1 1 
        1   462 1 1 29 ALA H    H  -5.569 -11.577  -5.156 1.00 . A A . 29 ALA H    1 1 
        1   463 1 1 29 ALA HA   H  -2.853 -11.942  -5.911 1.00 . A A . 29 ALA HA   1 1 
        1   464 1 1 29 ALA HB1  H  -4.829 -10.424  -6.884 1.00 . A A . 29 ALA HB1  1 1 
        1   465 1 1 29 ALA HB2  H  -3.123 -10.091  -7.188 1.00 . A A . 29 ALA HB2  1 1 
        1   466 1 1 29 ALA HB3  H  -3.982  -9.209  -5.925 1.00 . A A . 29 ALA HB3  1 1 
        1   467 1 1 29 ALA N    N  -4.681 -11.943  -4.953 1.00 . A A . 29 ALA N    1 1 
        1   468 1 1 29 ALA O    O  -1.509 -10.564  -4.249 1.00 . A A . 29 ALA O    1 1 
        1   469 1 1 30 ILE C    C  -1.985 -10.500  -1.344 1.00 . A A . 30 ILE C    1 1 
        1   470 1 1 30 ILE CA   C  -2.873  -9.508  -2.084 1.00 . A A . 30 ILE CA   1 1 
        1   471 1 1 30 ILE CB   C  -3.941  -8.968  -1.111 1.00 . A A . 30 ILE CB   1 1 
        1   472 1 1 30 ILE CD1  C  -4.361  -6.982  -2.651 1.00 . A A . 30 ILE CD1  1 1 
        1   473 1 1 30 ILE CG1  C  -4.972  -8.119  -1.860 1.00 . A A . 30 ILE CG1  1 1 
        1   474 1 1 30 ILE CG2  C  -3.284  -8.158  -0.004 1.00 . A A . 30 ILE CG2  1 1 
        1   475 1 1 30 ILE H    H  -4.456 -10.191  -3.313 1.00 . A A . 30 ILE H    1 1 
        1   476 1 1 30 ILE HA   H  -2.268  -8.680  -2.421 1.00 . A A . 30 ILE HA   1 1 
        1   477 1 1 30 ILE HB   H  -4.439  -9.810  -0.658 1.00 . A A . 30 ILE HB   1 1 
        1   478 1 1 30 ILE HD11 H  -5.066  -6.167  -2.710 1.00 . A A . 30 ILE HD11 1 1 
        1   479 1 1 30 ILE HD12 H  -4.122  -7.326  -3.647 1.00 . A A . 30 ILE HD12 1 1 
        1   480 1 1 30 ILE HD13 H  -3.460  -6.645  -2.161 1.00 . A A . 30 ILE HD13 1 1 
        1   481 1 1 30 ILE HG12 H  -5.515  -8.746  -2.548 1.00 . A A . 30 ILE HG12 1 1 
        1   482 1 1 30 ILE HG13 H  -5.660  -7.693  -1.147 1.00 . A A . 30 ILE HG13 1 1 
        1   483 1 1 30 ILE HG21 H  -2.758  -8.822   0.665 1.00 . A A . 30 ILE HG21 1 1 
        1   484 1 1 30 ILE HG22 H  -4.041  -7.619   0.545 1.00 . A A . 30 ILE HG22 1 1 
        1   485 1 1 30 ILE HG23 H  -2.585  -7.457  -0.437 1.00 . A A . 30 ILE HG23 1 1 
        1   486 1 1 30 ILE N    N  -3.480 -10.127  -3.257 1.00 . A A . 30 ILE N    1 1 
        1   487 1 1 30 ILE O    O  -0.854 -10.183  -0.974 1.00 . A A . 30 ILE O    1 1 
        1   488 1 1 31 ASN C    C  -0.496 -13.120  -1.209 1.00 . A A . 31 ASN C    1 1 
        1   489 1 1 31 ASN CA   C  -1.759 -12.747  -0.439 1.00 . A A . 31 ASN CA   1 1 
        1   490 1 1 31 ASN CB   C  -2.638 -13.987  -0.244 1.00 . A A . 31 ASN CB   1 1 
        1   491 1 1 31 ASN CG   C  -2.481 -14.594   1.136 1.00 . A A . 31 ASN CG   1 1 
        1   492 1 1 31 ASN H    H  -3.409 -11.898  -1.453 1.00 . A A . 31 ASN H    1 1 
        1   493 1 1 31 ASN HA   H  -1.476 -12.364   0.529 1.00 . A A . 31 ASN HA   1 1 
        1   494 1 1 31 ASN HB2  H  -3.672 -13.710  -0.380 1.00 . A A . 31 ASN HB2  1 1 
        1   495 1 1 31 ASN HB3  H  -2.368 -14.730  -0.979 1.00 . A A . 31 ASN HB3  1 1 
        1   496 1 1 31 ASN HD21 H  -3.324 -12.991   1.960 1.00 . A A . 31 ASN HD21 1 1 
        1   497 1 1 31 ASN HD22 H  -2.836 -14.240   3.063 1.00 . A A . 31 ASN HD22 1 1 
        1   498 1 1 31 ASN N    N  -2.503 -11.705  -1.133 1.00 . A A . 31 ASN N    1 1 
        1   499 1 1 31 ASN ND2  N  -2.926 -13.868   2.155 1.00 . A A . 31 ASN ND2  1 1 
        1   500 1 1 31 ASN O    O   0.541 -13.406  -0.615 1.00 . A A . 31 ASN O    1 1 
        1   501 1 1 31 ASN OD1  O  -1.968 -15.703   1.284 1.00 . A A . 31 ASN OD1  1 1 
        1   502 1 1 32 LYS C    C   1.580 -12.345  -3.389 1.00 . A A . 32 LYS C    1 1 
        1   503 1 1 32 LYS CA   C   0.537 -13.455  -3.386 1.00 . A A . 32 LYS CA   1 1 
        1   504 1 1 32 LYS CB   C   0.065 -13.726  -4.815 1.00 . A A . 32 LYS CB   1 1 
        1   505 1 1 32 LYS CD   C  -0.116 -16.228  -4.664 1.00 . A A . 32 LYS CD   1 1 
        1   506 1 1 32 LYS CE   C   0.784 -16.607  -5.828 1.00 . A A . 32 LYS CE   1 1 
        1   507 1 1 32 LYS CG   C  -0.857 -14.928  -4.933 1.00 . A A . 32 LYS CG   1 1 
        1   508 1 1 32 LYS H    H  -1.449 -12.881  -2.950 1.00 . A A . 32 LYS H    1 1 
        1   509 1 1 32 LYS HA   H   0.983 -14.346  -2.990 1.00 . A A . 32 LYS HA   1 1 
        1   510 1 1 32 LYS HB2  H  -0.463 -12.856  -5.178 1.00 . A A . 32 LYS HB2  1 1 
        1   511 1 1 32 LYS HB3  H   0.929 -13.898  -5.439 1.00 . A A . 32 LYS HB3  1 1 
        1   512 1 1 32 LYS HD2  H   0.489 -16.109  -3.778 1.00 . A A . 32 LYS HD2  1 1 
        1   513 1 1 32 LYS HD3  H  -0.837 -17.017  -4.507 1.00 . A A . 32 LYS HD3  1 1 
        1   514 1 1 32 LYS HE2  H   1.296 -15.721  -6.175 1.00 . A A . 32 LYS HE2  1 1 
        1   515 1 1 32 LYS HE3  H   1.510 -17.330  -5.486 1.00 . A A . 32 LYS HE3  1 1 
        1   516 1 1 32 LYS HG2  H  -1.658 -14.828  -4.216 1.00 . A A . 32 LYS HG2  1 1 
        1   517 1 1 32 LYS HG3  H  -1.268 -14.959  -5.932 1.00 . A A . 32 LYS HG3  1 1 
        1   518 1 1 32 LYS HZ1  H  -0.895 -17.566  -6.617 1.00 . A A . 32 LYS HZ1  1 1 
        1   519 1 1 32 LYS HZ2  H   0.552 -17.969  -7.394 1.00 . A A . 32 LYS HZ2  1 1 
        1   520 1 1 32 LYS HZ3  H  -0.170 -16.467  -7.681 1.00 . A A . 32 LYS HZ3  1 1 
        1   521 1 1 32 LYS N    N  -0.595 -13.114  -2.534 1.00 . A A . 32 LYS N    1 1 
        1   522 1 1 32 LYS NZ   N   0.013 -17.193  -6.959 1.00 . A A . 32 LYS NZ   1 1 
        1   523 1 1 32 LYS O    O   2.765 -12.594  -3.616 1.00 . A A . 32 LYS O    1 1 
        1   524 1 1 33 TRP C    C   2.946 -10.004  -1.924 1.00 . A A . 33 TRP C    1 1 
        1   525 1 1 33 TRP CA   C   2.012  -9.973  -3.129 1.00 . A A . 33 TRP CA   1 1 
        1   526 1 1 33 TRP CB   C   1.155  -8.719  -3.110 1.00 . A A . 33 TRP CB   1 1 
        1   527 1 1 33 TRP CD1  C   0.756  -9.055  -5.587 1.00 . A A . 33 TRP CD1  1 1 
        1   528 1 1 33 TRP CD2  C  -0.559  -7.517  -4.663 1.00 . A A . 33 TRP CD2  1 1 
        1   529 1 1 33 TRP CE2  C  -0.869  -7.598  -6.031 1.00 . A A . 33 TRP CE2  1 1 
        1   530 1 1 33 TRP CE3  C  -1.259  -6.622  -3.862 1.00 . A A . 33 TRP CE3  1 1 
        1   531 1 1 33 TRP CG   C   0.491  -8.445  -4.412 1.00 . A A . 33 TRP CG   1 1 
        1   532 1 1 33 TRP CH2  C  -2.532  -5.939  -5.809 1.00 . A A . 33 TRP CH2  1 1 
        1   533 1 1 33 TRP CZ2  C  -1.855  -6.813  -6.618 1.00 . A A . 33 TRP CZ2  1 1 
        1   534 1 1 33 TRP CZ3  C  -2.242  -5.840  -4.441 1.00 . A A . 33 TRP CZ3  1 1 
        1   535 1 1 33 TRP H    H   0.178 -10.982  -2.980 1.00 . A A . 33 TRP H    1 1 
        1   536 1 1 33 TRP HA   H   2.599  -9.984  -4.035 1.00 . A A . 33 TRP HA   1 1 
        1   537 1 1 33 TRP HB2  H   0.381  -8.849  -2.383 1.00 . A A . 33 TRP HB2  1 1 
        1   538 1 1 33 TRP HB3  H   1.764  -7.870  -2.851 1.00 . A A . 33 TRP HB3  1 1 
        1   539 1 1 33 TRP HD1  H   1.501  -9.818  -5.699 1.00 . A A . 33 TRP HD1  1 1 
        1   540 1 1 33 TRP HE1  H  -0.037  -8.820  -7.518 1.00 . A A . 33 TRP HE1  1 1 
        1   541 1 1 33 TRP HE3  H  -1.047  -6.543  -2.807 1.00 . A A . 33 TRP HE3  1 1 
        1   542 1 1 33 TRP HH2  H  -3.306  -5.309  -6.220 1.00 . A A . 33 TRP HH2  1 1 
        1   543 1 1 33 TRP HZ2  H  -2.088  -6.881  -7.670 1.00 . A A . 33 TRP HZ2  1 1 
        1   544 1 1 33 TRP HZ3  H  -2.797  -5.138  -3.835 1.00 . A A . 33 TRP HZ3  1 1 
        1   545 1 1 33 TRP N    N   1.133 -11.122  -3.147 1.00 . A A . 33 TRP N    1 1 
        1   546 1 1 33 TRP NE1  N  -0.048  -8.547  -6.579 1.00 . A A . 33 TRP NE1  1 1 
        1   547 1 1 33 TRP O    O   4.145  -9.758  -2.048 1.00 . A A . 33 TRP O    1 1 
        1   548 1 1 34 ILE C    C   3.883 -11.723   0.599 1.00 . A A . 34 ILE C    1 1 
        1   549 1 1 34 ILE CA   C   3.174 -10.379   0.471 1.00 . A A . 34 ILE CA   1 1 
        1   550 1 1 34 ILE CB   C   2.292 -10.158   1.715 1.00 . A A . 34 ILE CB   1 1 
        1   551 1 1 34 ILE CD1  C   0.475  -8.667   2.691 1.00 . A A . 34 ILE CD1  1 1 
        1   552 1 1 34 ILE CG1  C   1.412  -8.920   1.530 1.00 . A A . 34 ILE CG1  1 1 
        1   553 1 1 34 ILE CG2  C   3.157 -10.018   2.958 1.00 . A A . 34 ILE CG2  1 1 
        1   554 1 1 34 ILE H    H   1.428 -10.502  -0.720 1.00 . A A . 34 ILE H    1 1 
        1   555 1 1 34 ILE HA   H   3.915  -9.593   0.436 1.00 . A A . 34 ILE HA   1 1 
        1   556 1 1 34 ILE HB   H   1.661 -11.024   1.840 1.00 . A A . 34 ILE HB   1 1 
        1   557 1 1 34 ILE HD11 H   0.908  -9.063   3.597 1.00 . A A . 34 ILE HD11 1 1 
        1   558 1 1 34 ILE HD12 H  -0.472  -9.154   2.502 1.00 . A A . 34 ILE HD12 1 1 
        1   559 1 1 34 ILE HD13 H   0.317  -7.604   2.802 1.00 . A A . 34 ILE HD13 1 1 
        1   560 1 1 34 ILE HG12 H   2.043  -8.051   1.419 1.00 . A A . 34 ILE HG12 1 1 
        1   561 1 1 34 ILE HG13 H   0.814  -9.042   0.639 1.00 . A A . 34 ILE HG13 1 1 
        1   562 1 1 34 ILE HG21 H   4.143  -9.681   2.676 1.00 . A A . 34 ILE HG21 1 1 
        1   563 1 1 34 ILE HG22 H   3.232 -10.976   3.454 1.00 . A A . 34 ILE HG22 1 1 
        1   564 1 1 34 ILE HG23 H   2.710  -9.300   3.630 1.00 . A A . 34 ILE HG23 1 1 
        1   565 1 1 34 ILE N    N   2.389 -10.312  -0.757 1.00 . A A . 34 ILE N    1 1 
        1   566 1 1 34 ILE O    O   4.910 -11.833   1.269 1.00 . A A . 34 ILE O    1 1 
        1   567 1 1 35 HIS C    C   5.269 -14.111  -0.685 1.00 . A A . 35 HIS C    1 1 
        1   568 1 1 35 HIS CA   C   3.907 -14.082  -0.005 1.00 . A A . 35 HIS CA   1 1 
        1   569 1 1 35 HIS CB   C   2.968 -15.082  -0.682 1.00 . A A . 35 HIS CB   1 1 
        1   570 1 1 35 HIS CD2  C   1.402 -16.996   0.087 1.00 . A A . 35 HIS CD2  1 1 
        1   571 1 1 35 HIS CE1  C   1.223 -16.442   2.201 1.00 . A A . 35 HIS CE1  1 1 
        1   572 1 1 35 HIS CG   C   2.142 -15.880   0.278 1.00 . A A . 35 HIS CG   1 1 
        1   573 1 1 35 HIS H    H   2.510 -12.597  -0.563 1.00 . A A . 35 HIS H    1 1 
        1   574 1 1 35 HIS HA   H   4.030 -14.357   1.028 1.00 . A A . 35 HIS HA   1 1 
        1   575 1 1 35 HIS HB2  H   2.294 -14.545  -1.332 1.00 . A A . 35 HIS HB2  1 1 
        1   576 1 1 35 HIS HB3  H   3.552 -15.771  -1.272 1.00 . A A . 35 HIS HB3  1 1 
        1   577 1 1 35 HIS HD1  H   2.425 -14.792   2.062 1.00 . A A . 35 HIS HD1  1 1 
        1   578 1 1 35 HIS HD2  H   1.275 -17.527  -0.846 1.00 . A A . 35 HIS HD2  1 1 
        1   579 1 1 35 HIS HE1  H   0.941 -16.443   3.243 1.00 . A A . 35 HIS HE1  1 1 
        1   580 1 1 35 HIS HE2  H   0.345 -18.148   1.488 1.00 . A A . 35 HIS HE2  1 1 
        1   581 1 1 35 HIS N    N   3.329 -12.746  -0.046 1.00 . A A . 35 HIS N    1 1 
        1   582 1 1 35 HIS ND1  N   2.009 -15.557   1.612 1.00 . A A . 35 HIS ND1  1 1 
        1   583 1 1 35 HIS NE2  N   0.842 -17.326   1.296 1.00 . A A . 35 HIS NE2  1 1 
        1   584 1 1 35 HIS O    O   6.137 -14.909  -0.331 1.00 . A A . 35 HIS O    1 1 
        1   585 1 1 36 ALA C    C   7.471 -11.887  -2.072 1.00 . A A . 36 ALA C    1 1 
        1   586 1 1 36 ALA CA   C   6.697 -13.161  -2.406 1.00 . A A . 36 ALA CA   1 1 
        1   587 1 1 36 ALA CB   C   6.420 -13.235  -3.899 1.00 . A A . 36 ALA CB   1 1 
        1   588 1 1 36 ALA H    H   4.711 -12.636  -1.897 1.00 . A A . 36 ALA H    1 1 
        1   589 1 1 36 ALA HA   H   7.297 -14.016  -2.135 1.00 . A A . 36 ALA HA   1 1 
        1   590 1 1 36 ALA HB1  H   6.174 -12.251  -4.268 1.00 . A A . 36 ALA HB1  1 1 
        1   591 1 1 36 ALA HB2  H   5.592 -13.906  -4.078 1.00 . A A . 36 ALA HB2  1 1 
        1   592 1 1 36 ALA HB3  H   7.297 -13.603  -4.410 1.00 . A A . 36 ALA HB3  1 1 
        1   593 1 1 36 ALA N    N   5.444 -13.240  -1.666 1.00 . A A . 36 ALA N    1 1 
        1   594 1 1 36 ALA O    O   8.486 -11.587  -2.699 1.00 . A A . 36 ALA O    1 1 
        1   595 1 1 37 GLY C    C   7.712  -8.898  -1.810 1.00 . A A . 37 GLY C    1 1 
        1   596 1 1 37 GLY CA   C   7.657  -9.914  -0.687 1.00 . A A . 37 GLY CA   1 1 
        1   597 1 1 37 GLY H    H   6.179 -11.425  -0.612 1.00 . A A . 37 GLY H    1 1 
        1   598 1 1 37 GLY HA2  H   7.128  -9.482   0.150 1.00 . A A . 37 GLY HA2  1 1 
        1   599 1 1 37 GLY HA3  H   8.665 -10.148  -0.380 1.00 . A A . 37 GLY HA3  1 1 
        1   600 1 1 37 GLY N    N   6.989 -11.141  -1.080 1.00 . A A . 37 GLY N    1 1 
        1   601 1 1 37 GLY O    O   8.771  -8.344  -2.105 1.00 . A A . 37 GLY O    1 1 
        1   602 1 1 38 ARG C    C   6.447  -6.262  -3.003 1.00 . A A . 38 ARG C    1 1 
        1   603 1 1 38 ARG CA   C   6.487  -7.691  -3.534 1.00 . A A . 38 ARG CA   1 1 
        1   604 1 1 38 ARG CB   C   5.248  -7.968  -4.391 1.00 . A A . 38 ARG CB   1 1 
        1   605 1 1 38 ARG CD   C   4.489  -7.314  -6.697 1.00 . A A . 38 ARG CD   1 1 
        1   606 1 1 38 ARG CG   C   5.547  -8.040  -5.882 1.00 . A A . 38 ARG CG   1 1 
        1   607 1 1 38 ARG CZ   C   4.138  -8.731  -8.684 1.00 . A A . 38 ARG CZ   1 1 
        1   608 1 1 38 ARG H    H   5.754  -9.123  -2.156 1.00 . A A . 38 ARG H    1 1 
        1   609 1 1 38 ARG HA   H   7.370  -7.813  -4.143 1.00 . A A . 38 ARG HA   1 1 
        1   610 1 1 38 ARG HB2  H   4.818  -8.910  -4.088 1.00 . A A . 38 ARG HB2  1 1 
        1   611 1 1 38 ARG HB3  H   4.526  -7.182  -4.228 1.00 . A A . 38 ARG HB3  1 1 
        1   612 1 1 38 ARG HD2  H   3.513  -7.616  -6.350 1.00 . A A . 38 ARG HD2  1 1 
        1   613 1 1 38 ARG HD3  H   4.608  -6.251  -6.553 1.00 . A A . 38 ARG HD3  1 1 
        1   614 1 1 38 ARG HE   H   5.036  -6.949  -8.694 1.00 . A A . 38 ARG HE   1 1 
        1   615 1 1 38 ARG HG2  H   6.507  -7.584  -6.069 1.00 . A A . 38 ARG HG2  1 1 
        1   616 1 1 38 ARG HG3  H   5.572  -9.077  -6.183 1.00 . A A . 38 ARG HG3  1 1 
        1   617 1 1 38 ARG HH11 H   3.428  -9.513  -6.959 1.00 . A A . 38 ARG HH11 1 1 
        1   618 1 1 38 ARG HH12 H   3.194 -10.490  -8.370 1.00 . A A . 38 ARG HH12 1 1 
        1   619 1 1 38 ARG HH21 H   4.729  -8.232 -10.550 1.00 . A A . 38 ARG HH21 1 1 
        1   620 1 1 38 ARG HH22 H   3.933  -9.763 -10.408 1.00 . A A . 38 ARG HH22 1 1 
        1   621 1 1 38 ARG N    N   6.566  -8.651  -2.437 1.00 . A A . 38 ARG N    1 1 
        1   622 1 1 38 ARG NE   N   4.597  -7.614  -8.123 1.00 . A A . 38 ARG NE   1 1 
        1   623 1 1 38 ARG NH1  N   3.537  -9.654  -7.943 1.00 . A A . 38 ARG NH1  1 1 
        1   624 1 1 38 ARG NH2  N   4.278  -8.925  -9.987 1.00 . A A . 38 ARG NH2  1 1 
        1   625 1 1 38 ARG O    O   5.472  -5.852  -2.373 1.00 . A A . 38 ARG O    1 1 
        1   626 1 1 39 LYS C    C   6.521  -3.270  -3.475 1.00 . A A . 39 LYS C    1 1 
        1   627 1 1 39 LYS CA   C   7.595  -4.126  -2.810 1.00 . A A . 39 LYS CA   1 1 
        1   628 1 1 39 LYS CB   C   8.983  -3.554  -3.108 1.00 . A A . 39 LYS CB   1 1 
        1   629 1 1 39 LYS CD   C  10.982  -2.284  -2.264 1.00 . A A . 39 LYS CD   1 1 
        1   630 1 1 39 LYS CE   C  11.972  -3.438  -2.218 1.00 . A A . 39 LYS CE   1 1 
        1   631 1 1 39 LYS CG   C   9.567  -2.749  -1.958 1.00 . A A . 39 LYS CG   1 1 
        1   632 1 1 39 LYS H    H   8.257  -5.894  -3.768 1.00 . A A . 39 LYS H    1 1 
        1   633 1 1 39 LYS HA   H   7.434  -4.117  -1.742 1.00 . A A . 39 LYS HA   1 1 
        1   634 1 1 39 LYS HB2  H   9.657  -4.368  -3.328 1.00 . A A . 39 LYS HB2  1 1 
        1   635 1 1 39 LYS HB3  H   8.917  -2.910  -3.972 1.00 . A A . 39 LYS HB3  1 1 
        1   636 1 1 39 LYS HD2  H  11.001  -1.846  -3.251 1.00 . A A . 39 LYS HD2  1 1 
        1   637 1 1 39 LYS HD3  H  11.273  -1.543  -1.533 1.00 . A A . 39 LYS HD3  1 1 
        1   638 1 1 39 LYS HE2  H  11.580  -4.255  -2.804 1.00 . A A . 39 LYS HE2  1 1 
        1   639 1 1 39 LYS HE3  H  12.909  -3.107  -2.643 1.00 . A A . 39 LYS HE3  1 1 
        1   640 1 1 39 LYS HG2  H   8.945  -1.884  -1.784 1.00 . A A . 39 LYS HG2  1 1 
        1   641 1 1 39 LYS HG3  H   9.586  -3.367  -1.071 1.00 . A A . 39 LYS HG3  1 1 
        1   642 1 1 39 LYS HZ1  H  12.612  -3.144  -0.252 1.00 . A A . 39 LYS HZ1  1 1 
        1   643 1 1 39 LYS HZ2  H  12.874  -4.712  -0.830 1.00 . A A . 39 LYS HZ2  1 1 
        1   644 1 1 39 LYS HZ3  H  11.315  -4.221  -0.397 1.00 . A A . 39 LYS HZ3  1 1 
        1   645 1 1 39 LYS N    N   7.511  -5.510  -3.262 1.00 . A A . 39 LYS N    1 1 
        1   646 1 1 39 LYS NZ   N  12.210  -3.912  -0.827 1.00 . A A . 39 LYS NZ   1 1 
        1   647 1 1 39 LYS O    O   6.520  -3.096  -4.694 1.00 . A A . 39 LYS O    1 1 
        1   648 1 1 40 ILE C    C   4.137  -0.835  -2.163 1.00 . A A . 40 ILE C    1 1 
        1   649 1 1 40 ILE CA   C   4.530  -1.902  -3.176 1.00 . A A . 40 ILE CA   1 1 
        1   650 1 1 40 ILE CB   C   3.285  -2.741  -3.525 1.00 . A A . 40 ILE CB   1 1 
        1   651 1 1 40 ILE CD1  C   2.495  -4.797  -4.796 1.00 . A A . 40 ILE CD1  1 1 
        1   652 1 1 40 ILE CG1  C   3.675  -3.945  -4.385 1.00 . A A . 40 ILE CG1  1 1 
        1   653 1 1 40 ILE CG2  C   2.249  -1.887  -4.240 1.00 . A A . 40 ILE CG2  1 1 
        1   654 1 1 40 ILE H    H   5.665  -2.915  -1.705 1.00 . A A . 40 ILE H    1 1 
        1   655 1 1 40 ILE HA   H   4.878  -1.420  -4.078 1.00 . A A . 40 ILE HA   1 1 
        1   656 1 1 40 ILE HB   H   2.849  -3.095  -2.603 1.00 . A A . 40 ILE HB   1 1 
        1   657 1 1 40 ILE HD11 H   2.441  -4.843  -5.873 1.00 . A A . 40 ILE HD11 1 1 
        1   658 1 1 40 ILE HD12 H   1.586  -4.361  -4.408 1.00 . A A . 40 ILE HD12 1 1 
        1   659 1 1 40 ILE HD13 H   2.615  -5.794  -4.398 1.00 . A A . 40 ILE HD13 1 1 
        1   660 1 1 40 ILE HG12 H   4.159  -3.595  -5.284 1.00 . A A . 40 ILE HG12 1 1 
        1   661 1 1 40 ILE HG13 H   4.361  -4.568  -3.831 1.00 . A A . 40 ILE HG13 1 1 
        1   662 1 1 40 ILE HG21 H   1.814  -1.189  -3.540 1.00 . A A . 40 ILE HG21 1 1 
        1   663 1 1 40 ILE HG22 H   1.476  -2.521  -4.644 1.00 . A A . 40 ILE HG22 1 1 
        1   664 1 1 40 ILE HG23 H   2.725  -1.342  -5.043 1.00 . A A . 40 ILE HG23 1 1 
        1   665 1 1 40 ILE N    N   5.610  -2.739  -2.666 1.00 . A A . 40 ILE N    1 1 
        1   666 1 1 40 ILE O    O   4.429  -0.957  -0.972 1.00 . A A . 40 ILE O    1 1 
        1   667 1 1 41 PHE C    C   1.672   1.832  -2.213 1.00 . A A . 41 PHE C    1 1 
        1   668 1 1 41 PHE CA   C   3.027   1.295  -1.770 1.00 . A A . 41 PHE CA   1 1 
        1   669 1 1 41 PHE CB   C   4.053   2.431  -1.763 1.00 . A A . 41 PHE CB   1 1 
        1   670 1 1 41 PHE CD1  C   6.360   1.445  -1.812 1.00 . A A . 41 PHE CD1  1 1 
        1   671 1 1 41 PHE CD2  C   5.553   2.338   0.248 1.00 . A A . 41 PHE CD2  1 1 
        1   672 1 1 41 PHE CE1  C   7.553   1.106  -1.201 1.00 . A A . 41 PHE CE1  1 1 
        1   673 1 1 41 PHE CE2  C   6.743   2.002   0.864 1.00 . A A . 41 PHE CE2  1 1 
        1   674 1 1 41 PHE CG   C   5.349   2.064  -1.095 1.00 . A A . 41 PHE CG   1 1 
        1   675 1 1 41 PHE CZ   C   7.745   1.385   0.138 1.00 . A A . 41 PHE CZ   1 1 
        1   676 1 1 41 PHE H    H   3.260   0.247  -3.596 1.00 . A A . 41 PHE H    1 1 
        1   677 1 1 41 PHE HA   H   2.935   0.901  -0.771 1.00 . A A . 41 PHE HA   1 1 
        1   678 1 1 41 PHE HB2  H   4.273   2.715  -2.781 1.00 . A A . 41 PHE HB2  1 1 
        1   679 1 1 41 PHE HB3  H   3.635   3.279  -1.238 1.00 . A A . 41 PHE HB3  1 1 
        1   680 1 1 41 PHE HD1  H   6.212   1.228  -2.858 1.00 . A A . 41 PHE HD1  1 1 
        1   681 1 1 41 PHE HD2  H   4.771   2.820   0.816 1.00 . A A . 41 PHE HD2  1 1 
        1   682 1 1 41 PHE HE1  H   8.334   0.624  -1.769 1.00 . A A . 41 PHE HE1  1 1 
        1   683 1 1 41 PHE HE2  H   6.890   2.221   1.911 1.00 . A A . 41 PHE HE2  1 1 
        1   684 1 1 41 PHE HZ   H   8.676   1.122   0.618 1.00 . A A . 41 PHE HZ   1 1 
        1   685 1 1 41 PHE N    N   3.467   0.209  -2.638 1.00 . A A . 41 PHE N    1 1 
        1   686 1 1 41 PHE O    O   1.536   2.375  -3.310 1.00 . A A . 41 PHE O    1 1 
        1   687 1 1 42 LEU C    C  -0.892   3.540  -1.041 1.00 . A A . 42 LEU C    1 1 
        1   688 1 1 42 LEU CA   C  -0.668   2.160  -1.650 1.00 . A A . 42 LEU CA   1 1 
        1   689 1 1 42 LEU CB   C  -1.717   1.168  -1.137 1.00 . A A . 42 LEU CB   1 1 
        1   690 1 1 42 LEU CD1  C  -3.199   0.566   0.794 1.00 . A A . 42 LEU CD1  1 1 
        1   691 1 1 42 LEU CD2  C  -0.753   0.051   0.891 1.00 . A A . 42 LEU CD2  1 1 
        1   692 1 1 42 LEU CG   C  -1.807   1.024   0.383 1.00 . A A . 42 LEU CG   1 1 
        1   693 1 1 42 LEU H    H   0.848   1.249  -0.491 1.00 . A A . 42 LEU H    1 1 
        1   694 1 1 42 LEU HA   H  -0.756   2.239  -2.723 1.00 . A A . 42 LEU HA   1 1 
        1   695 1 1 42 LEU HB2  H  -2.683   1.480  -1.505 1.00 . A A . 42 LEU HB2  1 1 
        1   696 1 1 42 LEU HB3  H  -1.493   0.197  -1.553 1.00 . A A . 42 LEU HB3  1 1 
        1   697 1 1 42 LEU HD11 H  -3.783   0.350  -0.089 1.00 . A A . 42 LEU HD11 1 1 
        1   698 1 1 42 LEU HD12 H  -3.682   1.347   1.361 1.00 . A A . 42 LEU HD12 1 1 
        1   699 1 1 42 LEU HD13 H  -3.123  -0.324   1.400 1.00 . A A . 42 LEU HD13 1 1 
        1   700 1 1 42 LEU HD21 H  -0.452  -0.604   0.087 1.00 . A A . 42 LEU HD21 1 1 
        1   701 1 1 42 LEU HD22 H  -1.163  -0.536   1.699 1.00 . A A . 42 LEU HD22 1 1 
        1   702 1 1 42 LEU HD23 H   0.105   0.602   1.247 1.00 . A A . 42 LEU HD23 1 1 
        1   703 1 1 42 LEU HG   H  -1.625   1.985   0.841 1.00 . A A . 42 LEU HG   1 1 
        1   704 1 1 42 LEU N    N   0.675   1.683  -1.350 1.00 . A A . 42 LEU N    1 1 
        1   705 1 1 42 LEU O    O  -0.624   3.761   0.140 1.00 . A A . 42 LEU O    1 1 
        1   706 1 1 43 THR C    C  -3.092   6.058  -1.102 1.00 . A A . 43 THR C    1 1 
        1   707 1 1 43 THR CA   C  -1.617   5.833  -1.400 1.00 . A A . 43 THR CA   1 1 
        1   708 1 1 43 THR CB   C  -1.136   6.838  -2.447 1.00 . A A . 43 THR CB   1 1 
        1   709 1 1 43 THR CG2  C  -0.979   8.242  -1.901 1.00 . A A . 43 THR CG2  1 1 
        1   710 1 1 43 THR H    H  -1.556   4.241  -2.792 1.00 . A A . 43 THR H    1 1 
        1   711 1 1 43 THR HA   H  -1.053   5.980  -0.492 1.00 . A A . 43 THR HA   1 1 
        1   712 1 1 43 THR HB   H  -1.857   6.875  -3.252 1.00 . A A . 43 THR HB   1 1 
        1   713 1 1 43 THR HG1  H   0.785   6.496  -2.303 1.00 . A A . 43 THR HG1  1 1 
        1   714 1 1 43 THR HG21 H  -1.889   8.798  -2.073 1.00 . A A . 43 THR HG21 1 1 
        1   715 1 1 43 THR HG22 H  -0.157   8.732  -2.403 1.00 . A A . 43 THR HG22 1 1 
        1   716 1 1 43 THR HG23 H  -0.779   8.195  -0.842 1.00 . A A . 43 THR HG23 1 1 
        1   717 1 1 43 THR N    N  -1.371   4.472  -1.859 1.00 . A A . 43 THR N    1 1 
        1   718 1 1 43 THR O    O  -3.964   5.642  -1.866 1.00 . A A . 43 THR O    1 1 
        1   719 1 1 43 THR OG1  O   0.112   6.445  -2.985 1.00 . A A . 43 THR OG1  1 1 
        1   720 1 1 44 ILE C    C  -5.199   8.357  -0.131 1.00 . A A . 44 ILE C    1 1 
        1   721 1 1 44 ILE CA   C  -4.738   7.011   0.417 1.00 . A A . 44 ILE CA   1 1 
        1   722 1 1 44 ILE CB   C  -4.889   7.015   1.950 1.00 . A A . 44 ILE CB   1 1 
        1   723 1 1 44 ILE CD1  C  -4.382   5.680   4.057 1.00 . A A . 44 ILE CD1  1 1 
        1   724 1 1 44 ILE CG1  C  -4.267   5.753   2.550 1.00 . A A . 44 ILE CG1  1 1 
        1   725 1 1 44 ILE CG2  C  -6.355   7.126   2.338 1.00 . A A . 44 ILE CG2  1 1 
        1   726 1 1 44 ILE H    H  -2.626   7.032   0.581 1.00 . A A . 44 ILE H    1 1 
        1   727 1 1 44 ILE HA   H  -5.372   6.234   0.016 1.00 . A A . 44 ILE HA   1 1 
        1   728 1 1 44 ILE HB   H  -4.373   7.881   2.338 1.00 . A A . 44 ILE HB   1 1 
        1   729 1 1 44 ILE HD11 H  -4.377   6.679   4.468 1.00 . A A . 44 ILE HD11 1 1 
        1   730 1 1 44 ILE HD12 H  -3.547   5.123   4.456 1.00 . A A . 44 ILE HD12 1 1 
        1   731 1 1 44 ILE HD13 H  -5.305   5.185   4.325 1.00 . A A . 44 ILE HD13 1 1 
        1   732 1 1 44 ILE HG12 H  -4.761   4.886   2.139 1.00 . A A . 44 ILE HG12 1 1 
        1   733 1 1 44 ILE HG13 H  -3.218   5.719   2.294 1.00 . A A . 44 ILE HG13 1 1 
        1   734 1 1 44 ILE HG21 H  -6.941   6.451   1.732 1.00 . A A . 44 ILE HG21 1 1 
        1   735 1 1 44 ILE HG22 H  -6.695   8.140   2.178 1.00 . A A . 44 ILE HG22 1 1 
        1   736 1 1 44 ILE HG23 H  -6.472   6.869   3.380 1.00 . A A . 44 ILE HG23 1 1 
        1   737 1 1 44 ILE N    N  -3.366   6.724   0.015 1.00 . A A . 44 ILE N    1 1 
        1   738 1 1 44 ILE O    O  -4.506   9.365   0.008 1.00 . A A . 44 ILE O    1 1 
        1   739 1 1 45 ASN C    C  -7.763  10.339  -0.291 1.00 . A A . 45 ASN C    1 1 
        1   740 1 1 45 ASN CA   C  -6.925   9.590  -1.321 1.00 . A A . 45 ASN CA   1 1 
        1   741 1 1 45 ASN CB   C  -7.776   9.268  -2.552 1.00 . A A . 45 ASN CB   1 1 
        1   742 1 1 45 ASN CG   C  -6.959   8.661  -3.675 1.00 . A A . 45 ASN CG   1 1 
        1   743 1 1 45 ASN H    H  -6.879   7.532  -0.833 1.00 . A A . 45 ASN H    1 1 
        1   744 1 1 45 ASN HA   H  -6.100  10.220  -1.622 1.00 . A A . 45 ASN HA   1 1 
        1   745 1 1 45 ASN HB2  H  -8.549   8.566  -2.273 1.00 . A A . 45 ASN HB2  1 1 
        1   746 1 1 45 ASN HB3  H  -8.235  10.177  -2.913 1.00 . A A . 45 ASN HB3  1 1 
        1   747 1 1 45 ASN HD21 H  -8.499   7.512  -4.203 1.00 . A A . 45 ASN HD21 1 1 
        1   748 1 1 45 ASN HD22 H  -7.059   7.333  -5.156 1.00 . A A . 45 ASN HD22 1 1 
        1   749 1 1 45 ASN N    N  -6.373   8.368  -0.754 1.00 . A A . 45 ASN N    1 1 
        1   750 1 1 45 ASN ND2  N  -7.567   7.743  -4.419 1.00 . A A . 45 ASN ND2  1 1 
        1   751 1 1 45 ASN O    O  -7.968   9.860   0.824 1.00 . A A . 45 ASN O    1 1 
        1   752 1 1 45 ASN OD1  O  -5.797   9.012  -3.874 1.00 . A A . 45 ASN OD1  1 1 
        1   753 1 1 46 ALA C    C -10.540  12.011   0.072 1.00 . A A . 46 ALA C    1 1 
        1   754 1 1 46 ALA CA   C  -9.062  12.334   0.220 1.00 . A A . 46 ALA CA   1 1 
        1   755 1 1 46 ALA CB   C  -8.815  13.811  -0.047 1.00 . A A . 46 ALA CB   1 1 
        1   756 1 1 46 ALA H    H  -8.048  11.847  -1.573 1.00 . A A . 46 ALA H    1 1 
        1   757 1 1 46 ALA HA   H  -8.759  12.121   1.235 1.00 . A A . 46 ALA HA   1 1 
        1   758 1 1 46 ALA HB1  H  -7.781  13.957  -0.323 1.00 . A A . 46 ALA HB1  1 1 
        1   759 1 1 46 ALA HB2  H  -9.034  14.379   0.845 1.00 . A A . 46 ALA HB2  1 1 
        1   760 1 1 46 ALA HB3  H  -9.453  14.142  -0.852 1.00 . A A . 46 ALA HB3  1 1 
        1   761 1 1 46 ALA N    N  -8.246  11.518  -0.671 1.00 . A A . 46 ALA N    1 1 
        1   762 1 1 46 ALA O    O -11.390  12.655   0.692 1.00 . A A . 46 ALA O    1 1 
        1   763 1 1 47 ASP C    C -12.550   9.293  -0.256 1.00 . A A . 47 ASP C    1 1 
        1   764 1 1 47 ASP CA   C -12.240  10.607  -0.969 1.00 . A A . 47 ASP CA   1 1 
        1   765 1 1 47 ASP CB   C -12.530  10.466  -2.468 1.00 . A A . 47 ASP CB   1 1 
        1   766 1 1 47 ASP CG   C -11.280  10.281  -3.309 1.00 . A A . 47 ASP CG   1 1 
        1   767 1 1 47 ASP H    H -10.150  10.529  -1.215 1.00 . A A . 47 ASP H    1 1 
        1   768 1 1 47 ASP HA   H -12.880  11.376  -0.560 1.00 . A A . 47 ASP HA   1 1 
        1   769 1 1 47 ASP HB2  H -13.170   9.607  -2.621 1.00 . A A . 47 ASP HB2  1 1 
        1   770 1 1 47 ASP HB3  H -13.050  11.354  -2.812 1.00 . A A . 47 ASP HB3  1 1 
        1   771 1 1 47 ASP N    N -10.860  11.010  -0.747 1.00 . A A . 47 ASP N    1 1 
        1   772 1 1 47 ASP O    O -13.710   8.969  -0.004 1.00 . A A . 47 ASP O    1 1 
        1   773 1 1 47 ASP OD1  O -10.670  11.298  -3.694 1.00 . A A . 47 ASP OD1  1 1 
        1   774 1 1 47 ASP OD2  O -10.920   9.118  -3.582 1.00 . A A . 47 ASP OD2  1 1 
        1   775 1 1 48 GLY C    C -11.210   6.091  -0.096 1.00 . A A . 48 GLY C    1 1 
        1   776 1 1 48 GLY CA   C -11.680   7.268   0.740 1.00 . A A . 48 GLY CA   1 1 
        1   777 1 1 48 GLY H    H -10.600   8.847  -0.164 1.00 . A A . 48 GLY H    1 1 
        1   778 1 1 48 GLY HA2  H -11.120   7.285   1.665 1.00 . A A . 48 GLY HA2  1 1 
        1   779 1 1 48 GLY HA3  H -12.730   7.138   0.967 1.00 . A A . 48 GLY HA3  1 1 
        1   780 1 1 48 GLY N    N -11.500   8.539   0.063 1.00 . A A . 48 GLY N    1 1 
        1   781 1 1 48 GLY O    O -11.430   4.937   0.270 1.00 . A A . 48 GLY O    1 1 
        1   782 1 1 49 SER C    C  -8.576   5.091  -1.870 1.00 . A A . 49 SER C    1 1 
        1   783 1 1 49 SER CA   C -10.060   5.334  -2.102 1.00 . A A . 49 SER CA   1 1 
        1   784 1 1 49 SER CB   C -10.310   5.707  -3.560 1.00 . A A . 49 SER CB   1 1 
        1   785 1 1 49 SER H    H -10.410   7.318  -1.460 1.00 . A A . 49 SER H    1 1 
        1   786 1 1 49 SER HA   H -10.600   4.429  -1.880 1.00 . A A . 49 SER HA   1 1 
        1   787 1 1 49 SER HB2  H -10.750   6.687  -3.603 1.00 . A A . 49 SER HB2  1 1 
        1   788 1 1 49 SER HB3  H  -9.380   5.709  -4.095 1.00 . A A . 49 SER HB3  1 1 
        1   789 1 1 49 SER HG   H -10.900   3.886  -3.982 1.00 . A A . 49 SER HG   1 1 
        1   790 1 1 49 SER N    N -10.560   6.380  -1.219 1.00 . A A . 49 SER N    1 1 
        1   791 1 1 49 SER O    O  -7.915   5.858  -1.168 1.00 . A A . 49 SER O    1 1 
        1   792 1 1 49 SER OG   O -11.190   4.782  -4.180 1.00 . A A . 49 SER OG   1 1 
        1   793 1 1 50 VAL C    C  -6.126   2.948  -3.549 1.00 . A A . 50 VAL C    1 1 
        1   794 1 1 50 VAL CA   C  -6.643   3.682  -2.316 1.00 . A A . 50 VAL CA   1 1 
        1   795 1 1 50 VAL CB   C  -6.389   2.803  -1.071 1.00 . A A . 50 VAL CB   1 1 
        1   796 1 1 50 VAL CG1  C  -4.986   3.038  -0.536 1.00 . A A . 50 VAL CG1  1 1 
        1   797 1 1 50 VAL CG2  C  -7.426   3.071   0.012 1.00 . A A . 50 VAL CG2  1 1 
        1   798 1 1 50 VAL H    H  -8.631   3.448  -3.010 1.00 . A A . 50 VAL H    1 1 
        1   799 1 1 50 VAL HA   H  -6.089   4.602  -2.200 1.00 . A A . 50 VAL HA   1 1 
        1   800 1 1 50 VAL HB   H  -6.467   1.768  -1.366 1.00 . A A . 50 VAL HB   1 1 
        1   801 1 1 50 VAL HG11 H  -4.898   2.599   0.447 1.00 . A A . 50 VAL HG11 1 1 
        1   802 1 1 50 VAL HG12 H  -4.798   4.100  -0.473 1.00 . A A . 50 VAL HG12 1 1 
        1   803 1 1 50 VAL HG13 H  -4.266   2.584  -1.200 1.00 . A A . 50 VAL HG13 1 1 
        1   804 1 1 50 VAL HG21 H  -8.417   2.998  -0.412 1.00 . A A . 50 VAL HG21 1 1 
        1   805 1 1 50 VAL HG22 H  -7.279   4.061   0.416 1.00 . A A . 50 VAL HG22 1 1 
        1   806 1 1 50 VAL HG23 H  -7.319   2.341   0.802 1.00 . A A . 50 VAL HG23 1 1 
        1   807 1 1 50 VAL N    N  -8.054   4.022  -2.462 1.00 . A A . 50 VAL N    1 1 
        1   808 1 1 50 VAL O    O  -6.774   2.030  -4.053 1.00 . A A . 50 VAL O    1 1 
        1   809 1 1 51 TYR C    C  -2.932   2.275  -4.907 1.00 . A A . 51 TYR C    1 1 
        1   810 1 1 51 TYR CA   C  -4.355   2.735  -5.204 1.00 . A A . 51 TYR CA   1 1 
        1   811 1 1 51 TYR CB   C  -4.354   3.709  -6.383 1.00 . A A . 51 TYR CB   1 1 
        1   812 1 1 51 TYR CD1  C  -2.176   4.985  -6.297 1.00 . A A . 51 TYR CD1  1 1 
        1   813 1 1 51 TYR CD2  C  -4.181   6.143  -5.735 1.00 . A A . 51 TYR CD2  1 1 
        1   814 1 1 51 TYR CE1  C  -1.444   6.134  -6.069 1.00 . A A . 51 TYR CE1  1 1 
        1   815 1 1 51 TYR CE2  C  -3.456   7.296  -5.507 1.00 . A A . 51 TYR CE2  1 1 
        1   816 1 1 51 TYR CG   C  -3.556   4.969  -6.132 1.00 . A A . 51 TYR CG   1 1 
        1   817 1 1 51 TYR CZ   C  -2.087   7.287  -5.676 1.00 . A A . 51 TYR CZ   1 1 
        1   818 1 1 51 TYR H    H  -4.488   4.093  -3.585 1.00 . A A . 51 TYR H    1 1 
        1   819 1 1 51 TYR HA   H  -4.951   1.871  -5.463 1.00 . A A . 51 TYR HA   1 1 
        1   820 1 1 51 TYR HB2  H  -3.932   3.217  -7.248 1.00 . A A . 51 TYR HB2  1 1 
        1   821 1 1 51 TYR HB3  H  -5.372   3.999  -6.602 1.00 . A A . 51 TYR HB3  1 1 
        1   822 1 1 51 TYR HD1  H  -1.674   4.080  -6.606 1.00 . A A . 51 TYR HD1  1 1 
        1   823 1 1 51 TYR HD2  H  -5.254   6.148  -5.602 1.00 . A A . 51 TYR HD2  1 1 
        1   824 1 1 51 TYR HE1  H  -0.372   6.126  -6.202 1.00 . A A . 51 TYR HE1  1 1 
        1   825 1 1 51 TYR HE2  H  -3.960   8.200  -5.198 1.00 . A A . 51 TYR HE2  1 1 
        1   826 1 1 51 TYR HH   H  -0.898   8.359  -4.612 1.00 . A A . 51 TYR HH   1 1 
        1   827 1 1 51 TYR N    N  -4.957   3.356  -4.030 1.00 . A A . 51 TYR N    1 1 
        1   828 1 1 51 TYR O    O  -2.123   3.030  -4.366 1.00 . A A . 51 TYR O    1 1 
        1   829 1 1 51 TYR OH   O  -1.361   8.434  -5.450 1.00 . A A . 51 TYR OH   1 1 
        1   830 1 1 52 ALA C    C  -0.324   0.908  -6.114 1.00 . A A . 52 ALA C    1 1 
        1   831 1 1 52 ALA CA   C  -1.306   0.467  -5.035 1.00 . A A . 52 ALA CA   1 1 
        1   832 1 1 52 ALA CB   C  -1.383  -1.053  -4.979 1.00 . A A . 52 ALA CB   1 1 
        1   833 1 1 52 ALA H    H  -3.319   0.476  -5.690 1.00 . A A . 52 ALA H    1 1 
        1   834 1 1 52 ALA HA   H  -0.955   0.820  -4.077 1.00 . A A . 52 ALA HA   1 1 
        1   835 1 1 52 ALA HB1  H  -0.468  -1.474  -5.369 1.00 . A A . 52 ALA HB1  1 1 
        1   836 1 1 52 ALA HB2  H  -2.218  -1.394  -5.571 1.00 . A A . 52 ALA HB2  1 1 
        1   837 1 1 52 ALA HB3  H  -1.515  -1.369  -3.955 1.00 . A A . 52 ALA HB3  1 1 
        1   838 1 1 52 ALA N    N  -2.632   1.030  -5.264 1.00 . A A . 52 ALA N    1 1 
        1   839 1 1 52 ALA O    O  -0.515   0.622  -7.296 1.00 . A A . 52 ALA O    1 1 
        1   840 1 1 53 GLU C    C   2.916   1.113  -6.705 1.00 . A A . 53 GLU C    1 1 
        1   841 1 1 53 GLU CA   C   1.743   2.086  -6.630 1.00 . A A . 53 GLU CA   1 1 
        1   842 1 1 53 GLU CB   C   2.235   3.471  -6.207 1.00 . A A . 53 GLU CB   1 1 
        1   843 1 1 53 GLU CD   C   2.092   5.970  -6.552 1.00 . A A . 53 GLU CD   1 1 
        1   844 1 1 53 GLU CG   C   1.640   4.603  -7.028 1.00 . A A . 53 GLU CG   1 1 
        1   845 1 1 53 GLU H    H   0.825   1.800  -4.744 1.00 . A A . 53 GLU H    1 1 
        1   846 1 1 53 GLU HA   H   1.288   2.157  -7.607 1.00 . A A . 53 GLU HA   1 1 
        1   847 1 1 53 GLU HB2  H   1.977   3.632  -5.172 1.00 . A A . 53 GLU HB2  1 1 
        1   848 1 1 53 GLU HB3  H   3.311   3.507  -6.312 1.00 . A A . 53 GLU HB3  1 1 
        1   849 1 1 53 GLU HG2  H   1.940   4.482  -8.058 1.00 . A A . 53 GLU HG2  1 1 
        1   850 1 1 53 GLU HG3  H   0.564   4.552  -6.959 1.00 . A A . 53 GLU HG3  1 1 
        1   851 1 1 53 GLU N    N   0.728   1.604  -5.699 1.00 . A A . 53 GLU N    1 1 
        1   852 1 1 53 GLU O    O   3.442   0.679  -5.679 1.00 . A A . 53 GLU O    1 1 
        1   853 1 1 53 GLU OE1  O   2.258   6.146  -5.326 1.00 . A A . 53 GLU OE1  1 1 
        1   854 1 1 53 GLU OE2  O   2.281   6.864  -7.404 1.00 . A A . 53 GLU OE2  1 1 
        1   855 1 1 54 GLU C    C   5.708   0.614  -8.488 1.00 . A A . 54 GLU C    1 1 
        1   856 1 1 54 GLU CA   C   4.433  -0.144  -8.133 1.00 . A A . 54 GLU CA   1 1 
        1   857 1 1 54 GLU CB   C   4.094  -1.144  -9.241 1.00 . A A . 54 GLU CB   1 1 
        1   858 1 1 54 GLU CD   C   4.075  -3.600  -9.829 1.00 . A A . 54 GLU CD   1 1 
        1   859 1 1 54 GLU CG   C   4.785  -2.487  -9.083 1.00 . A A . 54 GLU CG   1 1 
        1   860 1 1 54 GLU H    H   2.864   1.154  -8.702 1.00 . A A . 54 GLU H    1 1 
        1   861 1 1 54 GLU HA   H   4.594  -0.685  -7.212 1.00 . A A . 54 GLU HA   1 1 
        1   862 1 1 54 GLU HB2  H   3.027  -1.309  -9.246 1.00 . A A . 54 GLU HB2  1 1 
        1   863 1 1 54 GLU HB3  H   4.388  -0.722 -10.192 1.00 . A A . 54 GLU HB3  1 1 
        1   864 1 1 54 GLU HG2  H   5.793  -2.407  -9.462 1.00 . A A . 54 GLU HG2  1 1 
        1   865 1 1 54 GLU HG3  H   4.816  -2.740  -8.032 1.00 . A A . 54 GLU HG3  1 1 
        1   866 1 1 54 GLU N    N   3.322   0.775  -7.923 1.00 . A A . 54 GLU N    1 1 
        1   867 1 1 54 GLU O    O   5.675   1.587  -9.241 1.00 . A A . 54 GLU O    1 1 
        1   868 1 1 54 GLU OE1  O   2.958  -3.975  -9.413 1.00 . A A . 54 GLU OE1  1 1 
        1   869 1 1 54 GLU OE2  O   4.635  -4.096 -10.828 1.00 . A A . 54 GLU OE2  1 1 
        1   870 1 1 55 VAL C    C   8.686   0.353  -9.543 1.00 . A A . 55 VAL C    1 1 
        1   871 1 1 55 VAL CA   C   8.117   0.792  -8.199 1.00 . A A . 55 VAL CA   1 1 
        1   872 1 1 55 VAL CB   C   9.136   0.462  -7.091 1.00 . A A . 55 VAL CB   1 1 
        1   873 1 1 55 VAL CG1  C  10.398   1.294  -7.260 1.00 . A A . 55 VAL CG1  1 1 
        1   874 1 1 55 VAL CG2  C   8.522   0.684  -5.717 1.00 . A A . 55 VAL CG2  1 1 
        1   875 1 1 55 VAL H    H   6.789  -0.622  -7.351 1.00 . A A . 55 VAL H    1 1 
        1   876 1 1 55 VAL HA   H   7.966   1.862  -8.214 1.00 . A A . 55 VAL HA   1 1 
        1   877 1 1 55 VAL HB   H   9.405  -0.580  -7.178 1.00 . A A . 55 VAL HB   1 1 
        1   878 1 1 55 VAL HG11 H  10.874   1.039  -8.195 1.00 . A A . 55 VAL HG11 1 1 
        1   879 1 1 55 VAL HG12 H  11.075   1.090  -6.444 1.00 . A A . 55 VAL HG12 1 1 
        1   880 1 1 55 VAL HG13 H  10.140   2.343  -7.261 1.00 . A A . 55 VAL HG13 1 1 
        1   881 1 1 55 VAL HG21 H   9.286   0.582  -4.961 1.00 . A A . 55 VAL HG21 1 1 
        1   882 1 1 55 VAL HG22 H   7.748  -0.049  -5.546 1.00 . A A . 55 VAL HG22 1 1 
        1   883 1 1 55 VAL HG23 H   8.096   1.675  -5.669 1.00 . A A . 55 VAL HG23 1 1 
        1   884 1 1 55 VAL N    N   6.829   0.159  -7.941 1.00 . A A . 55 VAL N    1 1 
        1   885 1 1 55 VAL O    O   8.357  -0.720 -10.046 1.00 . A A . 55 VAL O    1 1 
        1   886 1 1 56 LYS C    C  11.677   0.852 -11.293 1.00 . A A . 56 LYS C    1 1 
        1   887 1 1 56 LYS CA   C  10.155   0.889 -11.410 1.00 . A A . 56 LYS CA   1 1 
        1   888 1 1 56 LYS CB   C   9.736   1.927 -12.452 1.00 . A A . 56 LYS CB   1 1 
        1   889 1 1 56 LYS CD   C   8.114   2.599 -14.250 1.00 . A A . 56 LYS CD   1 1 
        1   890 1 1 56 LYS CE   C   6.924   3.392 -13.730 1.00 . A A . 56 LYS CE   1 1 
        1   891 1 1 56 LYS CG   C   8.526   1.509 -13.273 1.00 . A A . 56 LYS CG   1 1 
        1   892 1 1 56 LYS H    H   9.763   2.034  -9.671 1.00 . A A . 56 LYS H    1 1 
        1   893 1 1 56 LYS HA   H   9.806  -0.083 -11.722 1.00 . A A . 56 LYS HA   1 1 
        1   894 1 1 56 LYS HB2  H   9.499   2.852 -11.949 1.00 . A A . 56 LYS HB2  1 1 
        1   895 1 1 56 LYS HB3  H  10.561   2.096 -13.129 1.00 . A A . 56 LYS HB3  1 1 
        1   896 1 1 56 LYS HD2  H   8.944   3.272 -14.397 1.00 . A A . 56 LYS HD2  1 1 
        1   897 1 1 56 LYS HD3  H   7.846   2.142 -15.192 1.00 . A A . 56 LYS HD3  1 1 
        1   898 1 1 56 LYS HE2  H   6.558   4.027 -14.522 1.00 . A A . 56 LYS HE2  1 1 
        1   899 1 1 56 LYS HE3  H   6.147   2.700 -13.437 1.00 . A A . 56 LYS HE3  1 1 
        1   900 1 1 56 LYS HG2  H   8.772   0.617 -13.829 1.00 . A A . 56 LYS HG2  1 1 
        1   901 1 1 56 LYS HG3  H   7.702   1.306 -12.605 1.00 . A A . 56 LYS HG3  1 1 
        1   902 1 1 56 LYS HZ1  H   6.450   4.746 -12.212 1.00 . A A . 56 LYS HZ1  1 1 
        1   903 1 1 56 LYS HZ2  H   8.012   4.932 -12.832 1.00 . A A . 56 LYS HZ2  1 1 
        1   904 1 1 56 LYS HZ3  H   7.665   3.645 -11.794 1.00 . A A . 56 LYS HZ3  1 1 
        1   905 1 1 56 LYS N    N   9.541   1.192 -10.121 1.00 . A A . 56 LYS N    1 1 
        1   906 1 1 56 LYS NZ   N   7.289   4.238 -12.560 1.00 . A A . 56 LYS NZ   1 1 
        1   907 1 1 56 LYS O    O  12.358   1.814 -11.650 1.00 . A A . 56 LYS O    1 1 
        1   908 1 1 57 PRO C    C  14.429  -0.242 -11.949 1.00 . A A . 57 PRO C    1 1 
        1   909 1 1 57 PRO CA   C  13.682  -0.423 -10.633 1.00 . A A . 57 PRO CA   1 1 
        1   910 1 1 57 PRO CB   C  13.837  -1.859 -10.124 1.00 . A A . 57 PRO CB   1 1 
        1   911 1 1 57 PRO CD   C  11.494  -1.458 -10.343 1.00 . A A . 57 PRO CD   1 1 
        1   912 1 1 57 PRO CG   C  12.514  -2.204  -9.532 1.00 . A A . 57 PRO CG   1 1 
        1   913 1 1 57 PRO HA   H  14.077   0.268  -9.901 1.00 . A A . 57 PRO HA   1 1 
        1   914 1 1 57 PRO HB2  H  14.084  -2.511 -10.950 1.00 . A A . 57 PRO HB2  1 1 
        1   915 1 1 57 PRO HB3  H  14.622  -1.899  -9.382 1.00 . A A . 57 PRO HB3  1 1 
        1   916 1 1 57 PRO HD2  H  11.171  -2.052 -11.185 1.00 . A A . 57 PRO HD2  1 1 
        1   917 1 1 57 PRO HD3  H  10.651  -1.180  -9.727 1.00 . A A . 57 PRO HD3  1 1 
        1   918 1 1 57 PRO HG2  H  12.345  -3.268  -9.605 1.00 . A A . 57 PRO HG2  1 1 
        1   919 1 1 57 PRO HG3  H  12.478  -1.887  -8.501 1.00 . A A . 57 PRO HG3  1 1 
        1   920 1 1 57 PRO N    N  12.233  -0.264 -10.792 1.00 . A A . 57 PRO N    1 1 
        1   921 1 1 57 PRO O    O  13.896   0.322 -12.905 1.00 . A A . 57 PRO O    1 1 
        1   922 1 1 58 ASP C    C  16.170  -1.754 -14.171 1.00 . A A . 58 ASP C    1 1 
        1   923 1 1 58 ASP CA   C  16.485  -0.618 -13.197 1.00 . A A . 58 ASP CA   1 1 
        1   924 1 1 58 ASP CB   C  17.971  -0.638 -12.828 1.00 . A A . 58 ASP CB   1 1 
        1   925 1 1 58 ASP CG   C  18.716   0.565 -13.373 1.00 . A A . 58 ASP CG   1 1 
        1   926 1 1 58 ASP H    H  16.037  -1.167 -11.201 1.00 . A A . 58 ASP H    1 1 
        1   927 1 1 58 ASP HA   H  16.253   0.324 -13.668 1.00 . A A . 58 ASP HA   1 1 
        1   928 1 1 58 ASP HB2  H  18.068  -0.639 -11.751 1.00 . A A . 58 ASP HB2  1 1 
        1   929 1 1 58 ASP HB3  H  18.426  -1.534 -13.231 1.00 . A A . 58 ASP HB3  1 1 
        1   930 1 1 58 ASP N    N  15.666  -0.726 -11.995 1.00 . A A . 58 ASP N    1 1 
        1   931 1 1 58 ASP O    O  16.198  -2.926 -13.796 1.00 . A A . 58 ASP O    1 1 
        1   932 1 1 58 ASP OD1  O  18.802   0.699 -14.612 1.00 . A A . 58 ASP OD1  1 1 
        1   933 1 1 58 ASP OD2  O  19.213   1.373 -12.561 1.00 . A A . 58 ASP OD2  1 1 
        1   934 1 1 59 PRO C    C  16.780  -3.232 -16.880 1.00 . A A . 59 PRO C    1 1 
        1   935 1 1 59 PRO CA   C  15.554  -2.430 -16.461 1.00 . A A . 59 PRO CA   1 1 
        1   936 1 1 59 PRO CB   C  15.032  -1.595 -17.631 1.00 . A A . 59 PRO CB   1 1 
        1   937 1 1 59 PRO CD   C  15.814  -0.052 -15.982 1.00 . A A . 59 PRO CD   1 1 
        1   938 1 1 59 PRO CG   C  15.680  -0.265 -17.466 1.00 . A A . 59 PRO CG   1 1 
        1   939 1 1 59 PRO HA   H  14.781  -3.105 -16.123 1.00 . A A . 59 PRO HA   1 1 
        1   940 1 1 59 PRO HB2  H  15.318  -2.063 -18.564 1.00 . A A . 59 PRO HB2  1 1 
        1   941 1 1 59 PRO HB3  H  13.958  -1.521 -17.575 1.00 . A A . 59 PRO HB3  1 1 
        1   942 1 1 59 PRO HD2  H  16.722   0.487 -15.759 1.00 . A A . 59 PRO HD2  1 1 
        1   943 1 1 59 PRO HD3  H  14.954   0.478 -15.599 1.00 . A A . 59 PRO HD3  1 1 
        1   944 1 1 59 PRO HG2  H  16.654  -0.270 -17.934 1.00 . A A . 59 PRO HG2  1 1 
        1   945 1 1 59 PRO HG3  H  15.058   0.503 -17.899 1.00 . A A . 59 PRO HG3  1 1 
        1   946 1 1 59 PRO N    N  15.869  -1.424 -15.441 1.00 . A A . 59 PRO N    1 1 
        1   947 1 1 59 PRO O    O  17.436  -2.911 -17.871 1.00 . A A . 59 PRO O    1 1 
        1   948 1 1 60 SER C    C  17.813  -6.356 -17.215 1.00 . A A . 60 SER C    1 1 
        1   949 1 1 60 SER CA   C  18.232  -5.128 -16.413 1.00 . A A . 60 SER CA   1 1 
        1   950 1 1 60 SER CB   C  18.916  -5.561 -15.114 1.00 . A A . 60 SER CB   1 1 
        1   951 1 1 60 SER H    H  16.523  -4.484 -15.342 1.00 . A A . 60 SER H    1 1 
        1   952 1 1 60 SER HA   H  18.930  -4.550 -16.999 1.00 . A A . 60 SER HA   1 1 
        1   953 1 1 60 SER HB2  H  19.817  -6.108 -15.348 1.00 . A A . 60 SER HB2  1 1 
        1   954 1 1 60 SER HB3  H  19.167  -4.686 -14.533 1.00 . A A . 60 SER HB3  1 1 
        1   955 1 1 60 SER HG   H  17.286  -5.898 -14.079 1.00 . A A . 60 SER HG   1 1 
        1   956 1 1 60 SER N    N  17.084  -4.279 -16.119 1.00 . A A . 60 SER N    1 1 
        1   957 1 1 60 SER O    O  18.296  -6.578 -18.325 1.00 . A A . 60 SER O    1 1 
        1   958 1 1 60 SER OG   O  18.066  -6.393 -14.343 1.00 . A A . 60 SER OG   1 1 
        1   959 1 1 61 ASN C    C  14.999  -8.165 -17.811 1.00 . A A . 61 ASN C    1 1 
        1   960 1 1 61 ASN CA   C  16.427  -8.354 -17.312 1.00 . A A . 61 ASN CA   1 1 
        1   961 1 1 61 ASN CB   C  16.492  -9.550 -16.359 1.00 . A A . 61 ASN CB   1 1 
        1   962 1 1 61 ASN CG   C  16.910 -10.827 -17.062 1.00 . A A . 61 ASN CG   1 1 
        1   963 1 1 61 ASN H    H  16.562  -6.920 -15.760 1.00 . A A . 61 ASN H    1 1 
        1   964 1 1 61 ASN HA   H  17.069  -8.546 -18.159 1.00 . A A . 61 ASN HA   1 1 
        1   965 1 1 61 ASN HB2  H  17.208  -9.341 -15.577 1.00 . A A . 61 ASN HB2  1 1 
        1   966 1 1 61 ASN HB3  H  15.518  -9.705 -15.918 1.00 . A A . 61 ASN HB3  1 1 
        1   967 1 1 61 ASN HD21 H  15.594 -11.871 -15.995 1.00 . A A . 61 ASN HD21 1 1 
        1   968 1 1 61 ASN HD22 H  16.536 -12.780 -17.135 1.00 . A A . 61 ASN HD22 1 1 
        1   969 1 1 61 ASN N    N  16.911  -7.150 -16.646 1.00 . A A . 61 ASN N    1 1 
        1   970 1 1 61 ASN ND2  N  16.284 -11.938 -16.694 1.00 . A A . 61 ASN ND2  1 1 
        1   971 1 1 61 ASN O    O  14.328  -7.197 -17.451 1.00 . A A . 61 ASN O    1 1 
        1   972 1 1 61 ASN OD1  O  17.785 -10.814 -17.928 1.00 . A A . 61 ASN OD1  1 1 
        1   973 1 1 62 LYS C    C  12.476 -10.369 -19.061 1.00 . A A . 62 LYS C    1 1 
        1   974 1 1 62 LYS CA   C  13.191  -9.027 -19.195 1.00 . A A . 62 LYS CA   1 1 
        1   975 1 1 62 LYS CB   C  13.234  -8.603 -20.666 1.00 . A A . 62 LYS CB   1 1 
        1   976 1 1 62 LYS CD   C  13.969 -10.639 -21.949 1.00 . A A . 62 LYS CD   1 1 
        1   977 1 1 62 LYS CE   C  13.708 -10.653 -23.448 1.00 . A A . 62 LYS CE   1 1 
        1   978 1 1 62 LYS CG   C  14.358  -9.252 -21.460 1.00 . A A . 62 LYS CG   1 1 
        1   979 1 1 62 LYS H    H  15.122  -9.839 -18.895 1.00 . A A . 62 LYS H    1 1 
        1   980 1 1 62 LYS HA   H  12.641  -8.285 -18.634 1.00 . A A . 62 LYS HA   1 1 
        1   981 1 1 62 LYS HB2  H  12.296  -8.865 -21.131 1.00 . A A . 62 LYS HB2  1 1 
        1   982 1 1 62 LYS HB3  H  13.361  -7.531 -20.714 1.00 . A A . 62 LYS HB3  1 1 
        1   983 1 1 62 LYS HD2  H  14.773 -11.325 -21.729 1.00 . A A . 62 LYS HD2  1 1 
        1   984 1 1 62 LYS HD3  H  13.074 -10.954 -21.434 1.00 . A A . 62 LYS HD3  1 1 
        1   985 1 1 62 LYS HE2  H  13.596  -9.635 -23.791 1.00 . A A . 62 LYS HE2  1 1 
        1   986 1 1 62 LYS HE3  H  14.555 -11.107 -23.942 1.00 . A A . 62 LYS HE3  1 1 
        1   987 1 1 62 LYS HG2  H  14.585  -8.631 -22.314 1.00 . A A . 62 LYS HG2  1 1 
        1   988 1 1 62 LYS HG3  H  15.231  -9.334 -20.830 1.00 . A A . 62 LYS HG3  1 1 
        1   989 1 1 62 LYS HZ1  H  12.614 -11.935 -24.683 1.00 . A A . 62 LYS HZ1  1 1 
        1   990 1 1 62 LYS HZ2  H  11.673 -10.768 -23.900 1.00 . A A . 62 LYS HZ2  1 1 
        1   991 1 1 62 LYS HZ3  H  12.259 -12.100 -23.037 1.00 . A A . 62 LYS HZ3  1 1 
        1   992 1 1 62 LYS N    N  14.540  -9.093 -18.644 1.00 . A A . 62 LYS N    1 1 
        1   993 1 1 62 LYS NZ   N  12.477 -11.417 -23.791 1.00 . A A . 62 LYS NZ   1 1 
        1   994 1 1 62 LYS O    O  11.569 -10.679 -19.832 1.00 . A A . 62 LYS O    1 1 
        1   995 1 1 63 LYS C    C  11.353 -12.429 -16.638 1.00 . A A . 63 LYS C    1 1 
        1   996 1 1 63 LYS CA   C  12.286 -12.469 -17.844 1.00 . A A . 63 LYS CA   1 1 
        1   997 1 1 63 LYS CB   C  13.372 -13.525 -17.631 1.00 . A A . 63 LYS CB   1 1 
        1   998 1 1 63 LYS CD   C  13.192 -14.705 -19.842 1.00 . A A . 63 LYS CD   1 1 
        1   999 1 1 63 LYS CE   C  12.888 -16.018 -20.545 1.00 . A A . 63 LYS CE   1 1 
        1  1000 1 1 63 LYS CG   C  13.084 -14.843 -18.332 1.00 . A A . 63 LYS CG   1 1 
        1  1001 1 1 63 LYS H    H  13.615 -10.859 -17.491 1.00 . A A . 63 LYS H    1 1 
        1  1002 1 1 63 LYS HA   H  11.710 -12.728 -18.719 1.00 . A A . 63 LYS HA   1 1 
        1  1003 1 1 63 LYS HB2  H  14.309 -13.141 -18.006 1.00 . A A . 63 LYS HB2  1 1 
        1  1004 1 1 63 LYS HB3  H  13.469 -13.719 -16.574 1.00 . A A . 63 LYS HB3  1 1 
        1  1005 1 1 63 LYS HD2  H  12.490 -13.957 -20.179 1.00 . A A . 63 LYS HD2  1 1 
        1  1006 1 1 63 LYS HD3  H  14.197 -14.395 -20.094 1.00 . A A . 63 LYS HD3  1 1 
        1  1007 1 1 63 LYS HE2  H  13.263 -15.966 -21.557 1.00 . A A . 63 LYS HE2  1 1 
        1  1008 1 1 63 LYS HE3  H  13.389 -16.817 -20.018 1.00 . A A . 63 LYS HE3  1 1 
        1  1009 1 1 63 LYS HG2  H  13.795 -15.581 -17.996 1.00 . A A . 63 LYS HG2  1 1 
        1  1010 1 1 63 LYS HG3  H  12.083 -15.162 -18.080 1.00 . A A . 63 LYS HG3  1 1 
        1  1011 1 1 63 LYS HZ1  H  11.026 -15.984 -21.490 1.00 . A A . 63 LYS HZ1  1 1 
        1  1012 1 1 63 LYS HZ2  H  10.945 -15.804 -19.810 1.00 . A A . 63 LYS HZ2  1 1 
        1  1013 1 1 63 LYS HZ3  H  11.259 -17.323 -20.481 1.00 . A A . 63 LYS HZ3  1 1 
        1  1014 1 1 63 LYS N    N  12.889 -11.162 -18.076 1.00 . A A . 63 LYS N    1 1 
        1  1015 1 1 63 LYS NZ   N  11.428 -16.302 -20.584 1.00 . A A . 63 LYS NZ   1 1 
        1  1016 1 1 63 LYS O    O  11.350 -11.463 -15.874 1.00 . A A . 63 LYS O    1 1 
        1  1017 1 1 64 THR C    C   9.492 -15.003 -14.861 1.00 . A A . 64 THR C    1 1 
        1  1018 1 1 64 THR CA   C   9.623 -13.567 -15.358 1.00 . A A . 64 THR CA   1 1 
        1  1019 1 1 64 THR CB   C   8.252 -13.034 -15.778 1.00 . A A . 64 THR CB   1 1 
        1  1020 1 1 64 THR CG2  C   7.471 -12.421 -14.635 1.00 . A A . 64 THR CG2  1 1 
        1  1021 1 1 64 THR H    H  10.608 -14.223 -17.113 1.00 . A A . 64 THR H    1 1 
        1  1022 1 1 64 THR HA   H  10.007 -12.955 -14.555 1.00 . A A . 64 THR HA   1 1 
        1  1023 1 1 64 THR HB   H   7.667 -13.850 -16.177 1.00 . A A . 64 THR HB   1 1 
        1  1024 1 1 64 THR HG1  H   8.757 -12.444 -17.576 1.00 . A A . 64 THR HG1  1 1 
        1  1025 1 1 64 THR HG21 H   7.295 -11.376 -14.840 1.00 . A A . 64 THR HG21 1 1 
        1  1026 1 1 64 THR HG22 H   8.038 -12.519 -13.719 1.00 . A A . 64 THR HG22 1 1 
        1  1027 1 1 64 THR HG23 H   6.526 -12.932 -14.531 1.00 . A A . 64 THR HG23 1 1 
        1  1028 1 1 64 THR N    N  10.560 -13.484 -16.472 1.00 . A A . 64 THR N    1 1 
        1  1029 1 1 64 THR O    O   9.076 -15.893 -15.605 1.00 . A A . 64 THR O    1 1 
        1  1030 1 1 64 THR OG1  O   8.386 -12.046 -16.785 1.00 . A A . 64 THR OG1  1 1 
        1  1031 1 1 65 THR C    C   8.798 -16.564 -11.827 1.00 . A A . 65 THR C    1 1 
        1  1032 1 1 65 THR CA   C   9.770 -16.552 -13.002 1.00 . A A . 65 THR CA   1 1 
        1  1033 1 1 65 THR CB   C  11.155 -17.009 -12.540 1.00 . A A . 65 THR CB   1 1 
        1  1034 1 1 65 THR CG2  C  11.843 -17.925 -13.529 1.00 . A A . 65 THR CG2  1 1 
        1  1035 1 1 65 THR H    H  10.171 -14.474 -13.057 1.00 . A A . 65 THR H    1 1 
        1  1036 1 1 65 THR HA   H   9.411 -17.234 -13.759 1.00 . A A . 65 THR HA   1 1 
        1  1037 1 1 65 THR HB   H  11.055 -17.545 -11.607 1.00 . A A . 65 THR HB   1 1 
        1  1038 1 1 65 THR HG1  H  11.715 -15.419 -11.543 1.00 . A A . 65 THR HG1  1 1 
        1  1039 1 1 65 THR HG21 H  11.317 -17.897 -14.472 1.00 . A A . 65 THR HG21 1 1 
        1  1040 1 1 65 THR HG22 H  11.842 -18.934 -13.145 1.00 . A A . 65 THR HG22 1 1 
        1  1041 1 1 65 THR HG23 H  12.862 -17.596 -13.676 1.00 . A A . 65 THR HG23 1 1 
        1  1042 1 1 65 THR N    N   9.848 -15.223 -13.599 1.00 . A A . 65 THR N    1 1 
        1  1043 1 1 65 THR O    O   7.827 -17.323 -11.819 1.00 . A A . 65 THR O    1 1 
        1  1044 1 1 65 THR OG1  O  12.004 -15.896 -12.324 1.00 . A A . 65 THR OG1  1 1 
        1  1045 1 1 66 ALA C    C   8.461 -14.340  -8.891 1.00 . A A . 66 ALA C    1 1 
        1  1046 1 1 66 ALA CA   C   8.214 -15.638  -9.653 1.00 . A A . 66 ALA CA   1 1 
        1  1047 1 1 66 ALA CB   C   8.449 -16.838  -8.748 1.00 . A A . 66 ALA CB   1 1 
        1  1048 1 1 66 ALA H    H   9.853 -15.145 -10.897 1.00 . A A . 66 ALA H    1 1 
        1  1049 1 1 66 ALA HA   H   7.186 -15.660  -9.982 1.00 . A A . 66 ALA HA   1 1 
        1  1050 1 1 66 ALA HB1  H   9.409 -17.277  -8.975 1.00 . A A . 66 ALA HB1  1 1 
        1  1051 1 1 66 ALA HB2  H   7.672 -17.570  -8.913 1.00 . A A . 66 ALA HB2  1 1 
        1  1052 1 1 66 ALA HB3  H   8.431 -16.522  -7.717 1.00 . A A . 66 ALA HB3  1 1 
        1  1053 1 1 66 ALA N    N   9.065 -15.723 -10.834 1.00 . A A . 66 ALA N    1 1 
        1  1054 1 1 66 ALA O    O   7.545 -13.894  -8.171 1.00 . A A . 66 ALA O    1 1 
        1  1055 1 1 66 ALA OXT  O   9.572 -13.782  -9.020 1.00 . A A . 66 ALA OXT  1 1 
        2  1056 1 1  1 MET C    C   2.885  13.644   1.743 1.00 . A A .  1 MET C    1 1 
        2  1057 1 1  1 MET CA   C   2.345  15.060   1.914 1.00 . A A .  1 MET CA   1 1 
        2  1058 1 1  1 MET CB   C   0.873  15.118   1.499 1.00 . A A .  1 MET CB   1 1 
        2  1059 1 1  1 MET CE   C  -2.502  15.019   1.394 1.00 . A A .  1 MET CE   1 1 
        2  1060 1 1  1 MET CG   C  -0.020  14.180   2.294 1.00 . A A .  1 MET CG   1 1 
        2  1061 1 1  1 MET H1   H   2.894  16.985   1.441 1.00 . A A .  1 MET H1   1 1 
        2  1062 1 1  1 MET H2   H   2.798  15.918   0.100 1.00 . A A .  1 MET H2   1 1 
        2  1063 1 1  1 MET H3   H   4.118  15.812   1.192 1.00 . A A .  1 MET H3   1 1 
        2  1064 1 1  1 MET HA   H   2.433  15.347   2.952 1.00 . A A .  1 MET HA   1 1 
        2  1065 1 1  1 MET HB2  H   0.512  16.126   1.637 1.00 . A A .  1 MET HB2  1 1 
        2  1066 1 1  1 MET HB3  H   0.795  14.855   0.455 1.00 . A A .  1 MET HB3  1 1 
        2  1067 1 1  1 MET HE1  H  -3.238  14.888   2.174 1.00 . A A .  1 MET HE1  1 1 
        2  1068 1 1  1 MET HE2  H  -3.002  15.132   0.443 1.00 . A A .  1 MET HE2  1 1 
        2  1069 1 1  1 MET HE3  H  -1.914  15.902   1.598 1.00 . A A .  1 MET HE3  1 1 
        2  1070 1 1  1 MET HG2  H   0.565  13.329   2.610 1.00 . A A .  1 MET HG2  1 1 
        2  1071 1 1  1 MET HG3  H  -0.388  14.704   3.164 1.00 . A A .  1 MET HG3  1 1 
        2  1072 1 1  1 MET N    N   3.108  16.032   1.088 1.00 . A A .  1 MET N    1 1 
        2  1073 1 1  1 MET O    O   3.465  13.074   2.666 1.00 . A A .  1 MET O    1 1 
        2  1074 1 1  1 MET SD   S  -1.428  13.587   1.338 1.00 . A A .  1 MET SD   1 1 
        2  1075 1 1  2 GLU C    C   2.507  10.716   1.193 1.00 . A A .  2 GLU C    1 1 
        2  1076 1 1  2 GLU CA   C   3.159  11.732   0.260 1.00 . A A .  2 GLU CA   1 1 
        2  1077 1 1  2 GLU CB   C   4.685  11.660   0.385 1.00 . A A .  2 GLU CB   1 1 
        2  1078 1 1  2 GLU CD   C   6.556  12.123  -1.250 1.00 . A A .  2 GLU CD   1 1 
        2  1079 1 1  2 GLU CG   C   5.380  11.234  -0.898 1.00 . A A .  2 GLU CG   1 1 
        2  1080 1 1  2 GLU H    H   2.222  13.588  -0.143 1.00 . A A .  2 GLU H    1 1 
        2  1081 1 1  2 GLU HA   H   2.880  11.500  -0.756 1.00 . A A .  2 GLU HA   1 1 
        2  1082 1 1  2 GLU HB2  H   5.057  12.635   0.663 1.00 . A A .  2 GLU HB2  1 1 
        2  1083 1 1  2 GLU HB3  H   4.941  10.952   1.160 1.00 . A A .  2 GLU HB3  1 1 
        2  1084 1 1  2 GLU HG2  H   5.737  10.222  -0.780 1.00 . A A .  2 GLU HG2  1 1 
        2  1085 1 1  2 GLU HG3  H   4.666  11.270  -1.709 1.00 . A A .  2 GLU HG3  1 1 
        2  1086 1 1  2 GLU N    N   2.691  13.083   0.553 1.00 . A A .  2 GLU N    1 1 
        2  1087 1 1  2 GLU O    O   3.054  10.383   2.245 1.00 . A A .  2 GLU O    1 1 
        2  1088 1 1  2 GLU OE1  O   7.301  12.515  -0.327 1.00 . A A .  2 GLU OE1  1 1 
        2  1089 1 1  2 GLU OE2  O   6.734  12.426  -2.448 1.00 . A A .  2 GLU OE2  1 1 
        2  1090 1 1  3 GLN C    C   0.860   7.832   1.088 1.00 . A A .  3 GLN C    1 1 
        2  1091 1 1  3 GLN CA   C   0.608   9.248   1.601 1.00 . A A .  3 GLN CA   1 1 
        2  1092 1 1  3 GLN CB   C  -0.891   9.556   1.579 1.00 . A A .  3 GLN CB   1 1 
        2  1093 1 1  3 GLN CD   C  -2.659  10.616   3.040 1.00 . A A .  3 GLN CD   1 1 
        2  1094 1 1  3 GLN CG   C  -1.519   9.619   2.962 1.00 . A A .  3 GLN CG   1 1 
        2  1095 1 1  3 GLN H    H   0.951  10.531  -0.048 1.00 . A A .  3 GLN H    1 1 
        2  1096 1 1  3 GLN HA   H   0.968   9.317   2.616 1.00 . A A .  3 GLN HA   1 1 
        2  1097 1 1  3 GLN HB2  H  -1.044  10.509   1.096 1.00 . A A .  3 GLN HB2  1 1 
        2  1098 1 1  3 GLN HB3  H  -1.399   8.790   1.011 1.00 . A A .  3 GLN HB3  1 1 
        2  1099 1 1  3 GLN HE21 H  -2.690  10.459   5.024 1.00 . A A .  3 GLN HE21 1 1 
        2  1100 1 1  3 GLN HE22 H  -3.852  11.548   4.333 1.00 . A A .  3 GLN HE22 1 1 
        2  1101 1 1  3 GLN HG2  H  -1.900   8.641   3.215 1.00 . A A .  3 GLN HG2  1 1 
        2  1102 1 1  3 GLN HG3  H  -0.761   9.903   3.676 1.00 . A A .  3 GLN HG3  1 1 
        2  1103 1 1  3 GLN N    N   1.336  10.227   0.801 1.00 . A A .  3 GLN N    1 1 
        2  1104 1 1  3 GLN NE2  N  -3.113  10.903   4.255 1.00 . A A .  3 GLN NE2  1 1 
        2  1105 1 1  3 GLN O    O  -0.048   7.002   1.053 1.00 . A A .  3 GLN O    1 1 
        2  1106 1 1  3 GLN OE1  O  -3.127  11.122   2.021 1.00 . A A .  3 GLN OE1  1 1 
        2  1107 1 1  4 ARG C    C   2.970   5.352   1.299 1.00 . A A .  4 ARG C    1 1 
        2  1108 1 1  4 ARG CA   C   2.479   6.255   0.178 1.00 . A A .  4 ARG CA   1 1 
        2  1109 1 1  4 ARG CB   C   3.560   6.396  -0.894 1.00 . A A .  4 ARG CB   1 1 
        2  1110 1 1  4 ARG CD   C   4.423   8.187  -2.430 1.00 . A A .  4 ARG CD   1 1 
        2  1111 1 1  4 ARG CG   C   3.205   7.394  -1.985 1.00 . A A .  4 ARG CG   1 1 
        2  1112 1 1  4 ARG CZ   C   3.601   9.560  -4.303 1.00 . A A .  4 ARG CZ   1 1 
        2  1113 1 1  4 ARG H    H   2.777   8.272   0.743 1.00 . A A .  4 ARG H    1 1 
        2  1114 1 1  4 ARG HA   H   1.603   5.802  -0.262 1.00 . A A .  4 ARG HA   1 1 
        2  1115 1 1  4 ARG HB2  H   4.477   6.717  -0.424 1.00 . A A .  4 ARG HB2  1 1 
        2  1116 1 1  4 ARG HB3  H   3.720   5.432  -1.356 1.00 . A A .  4 ARG HB3  1 1 
        2  1117 1 1  4 ARG HD2  H   4.490   9.086  -1.834 1.00 . A A .  4 ARG HD2  1 1 
        2  1118 1 1  4 ARG HD3  H   5.307   7.585  -2.274 1.00 . A A .  4 ARG HD3  1 1 
        2  1119 1 1  4 ARG HE   H   4.879   8.037  -4.476 1.00 . A A .  4 ARG HE   1 1 
        2  1120 1 1  4 ARG HG2  H   2.807   6.859  -2.833 1.00 . A A .  4 ARG HG2  1 1 
        2  1121 1 1  4 ARG HG3  H   2.461   8.077  -1.604 1.00 . A A .  4 ARG HG3  1 1 
        2  1122 1 1  4 ARG HH11 H   2.872  10.091  -2.493 1.00 . A A .  4 ARG HH11 1 1 
        2  1123 1 1  4 ARG HH12 H   2.310  11.041  -3.827 1.00 . A A .  4 ARG HH12 1 1 
        2  1124 1 1  4 ARG HH21 H   4.139   9.285  -6.231 1.00 . A A .  4 ARG HH21 1 1 
        2  1125 1 1  4 ARG HH22 H   3.028  10.584  -5.951 1.00 . A A .  4 ARG HH22 1 1 
        2  1126 1 1  4 ARG N    N   2.100   7.567   0.690 1.00 . A A .  4 ARG N    1 1 
        2  1127 1 1  4 ARG NE   N   4.346   8.560  -3.841 1.00 . A A .  4 ARG NE   1 1 
        2  1128 1 1  4 ARG NH1  N   2.868  10.290  -3.473 1.00 . A A .  4 ARG NH1  1 1 
        2  1129 1 1  4 ARG NH2  N   3.589   9.832  -5.601 1.00 . A A .  4 ARG NH2  1 1 
        2  1130 1 1  4 ARG O    O   4.090   5.500   1.788 1.00 . A A .  4 ARG O    1 1 
        2  1131 1 1  5 ILE C    C   2.862   2.133   2.153 1.00 . A A .  5 ILE C    1 1 
        2  1132 1 1  5 ILE CA   C   2.456   3.472   2.748 1.00 . A A .  5 ILE CA   1 1 
        2  1133 1 1  5 ILE CB   C   1.273   3.248   3.715 1.00 . A A .  5 ILE CB   1 1 
        2  1134 1 1  5 ILE CD1  C  -0.846   4.312   4.637 1.00 . A A .  5 ILE CD1  1 1 
        2  1135 1 1  5 ILE CG1  C   0.346   4.460   3.716 1.00 . A A .  5 ILE CG1  1 1 
        2  1136 1 1  5 ILE CG2  C   1.775   2.963   5.125 1.00 . A A .  5 ILE CG2  1 1 
        2  1137 1 1  5 ILE H    H   1.247   4.349   1.255 1.00 . A A .  5 ILE H    1 1 
        2  1138 1 1  5 ILE HA   H   3.287   3.876   3.309 1.00 . A A .  5 ILE HA   1 1 
        2  1139 1 1  5 ILE HB   H   0.722   2.388   3.371 1.00 . A A .  5 ILE HB   1 1 
        2  1140 1 1  5 ILE HD11 H  -0.569   3.712   5.491 1.00 . A A .  5 ILE HD11 1 1 
        2  1141 1 1  5 ILE HD12 H  -1.654   3.830   4.106 1.00 . A A .  5 ILE HD12 1 1 
        2  1142 1 1  5 ILE HD13 H  -1.166   5.288   4.971 1.00 . A A .  5 ILE HD13 1 1 
        2  1143 1 1  5 ILE HG12 H   0.902   5.332   4.027 1.00 . A A .  5 ILE HG12 1 1 
        2  1144 1 1  5 ILE HG13 H  -0.021   4.606   2.716 1.00 . A A .  5 ILE HG13 1 1 
        2  1145 1 1  5 ILE HG21 H   2.819   3.230   5.196 1.00 . A A .  5 ILE HG21 1 1 
        2  1146 1 1  5 ILE HG22 H   1.658   1.912   5.343 1.00 . A A .  5 ILE HG22 1 1 
        2  1147 1 1  5 ILE HG23 H   1.207   3.543   5.836 1.00 . A A .  5 ILE HG23 1 1 
        2  1148 1 1  5 ILE N    N   2.121   4.415   1.692 1.00 . A A .  5 ILE N    1 1 
        2  1149 1 1  5 ILE O    O   2.963   1.992   0.936 1.00 . A A .  5 ILE O    1 1 
        2  1150 1 1  6 THR C    C   2.256  -1.060   2.361 1.00 . A A .  6 THR C    1 1 
        2  1151 1 1  6 THR CA   C   3.479  -0.177   2.575 1.00 . A A .  6 THR CA   1 1 
        2  1152 1 1  6 THR CB   C   4.420  -0.822   3.595 1.00 . A A .  6 THR CB   1 1 
        2  1153 1 1  6 THR CG2  C   5.734  -0.086   3.745 1.00 . A A .  6 THR CG2  1 1 
        2  1154 1 1  6 THR H    H   2.983   1.336   3.970 1.00 . A A .  6 THR H    1 1 
        2  1155 1 1  6 THR HA   H   4.001  -0.075   1.634 1.00 . A A .  6 THR HA   1 1 
        2  1156 1 1  6 THR HB   H   4.641  -1.831   3.278 1.00 . A A .  6 THR HB   1 1 
        2  1157 1 1  6 THR HG1  H   3.897  -1.768   5.226 1.00 . A A .  6 THR HG1  1 1 
        2  1158 1 1  6 THR HG21 H   5.543   0.973   3.847 1.00 . A A .  6 THR HG21 1 1 
        2  1159 1 1  6 THR HG22 H   6.346  -0.260   2.874 1.00 . A A .  6 THR HG22 1 1 
        2  1160 1 1  6 THR HG23 H   6.249  -0.444   4.625 1.00 . A A .  6 THR HG23 1 1 
        2  1161 1 1  6 THR N    N   3.089   1.157   3.015 1.00 . A A .  6 THR N    1 1 
        2  1162 1 1  6 THR O    O   1.200  -0.830   2.951 1.00 . A A .  6 THR O    1 1 
        2  1163 1 1  6 THR OG1  O   3.810  -0.879   4.873 1.00 . A A .  6 THR OG1  1 1 
        2  1164 1 1  7 LEU C    C   1.114  -3.981   2.373 1.00 . A A .  7 LEU C    1 1 
        2  1165 1 1  7 LEU CA   C   1.306  -2.993   1.228 1.00 . A A .  7 LEU CA   1 1 
        2  1166 1 1  7 LEU CB   C   1.570  -3.749  -0.075 1.00 . A A .  7 LEU CB   1 1 
        2  1167 1 1  7 LEU CD1  C  -0.775  -4.084  -0.898 1.00 . A A .  7 LEU CD1  1 1 
        2  1168 1 1  7 LEU CD2  C   1.019  -5.702  -1.546 1.00 . A A .  7 LEU CD2  1 1 
        2  1169 1 1  7 LEU CG   C   0.503  -4.778  -0.452 1.00 . A A .  7 LEU CG   1 1 
        2  1170 1 1  7 LEU H    H   3.267  -2.210   1.075 1.00 . A A .  7 LEU H    1 1 
        2  1171 1 1  7 LEU HA   H   0.405  -2.409   1.119 1.00 . A A .  7 LEU HA   1 1 
        2  1172 1 1  7 LEU HB2  H   1.645  -3.027  -0.876 1.00 . A A .  7 LEU HB2  1 1 
        2  1173 1 1  7 LEU HB3  H   2.515  -4.261   0.015 1.00 . A A .  7 LEU HB3  1 1 
        2  1174 1 1  7 LEU HD11 H  -0.560  -3.440  -1.738 1.00 . A A .  7 LEU HD11 1 1 
        2  1175 1 1  7 LEU HD12 H  -1.167  -3.496  -0.082 1.00 . A A .  7 LEU HD12 1 1 
        2  1176 1 1  7 LEU HD13 H  -1.504  -4.825  -1.190 1.00 . A A .  7 LEU HD13 1 1 
        2  1177 1 1  7 LEU HD21 H   0.681  -5.345  -2.507 1.00 . A A .  7 LEU HD21 1 1 
        2  1178 1 1  7 LEU HD22 H   0.643  -6.700  -1.381 1.00 . A A .  7 LEU HD22 1 1 
        2  1179 1 1  7 LEU HD23 H   2.098  -5.716  -1.526 1.00 . A A .  7 LEU HD23 1 1 
        2  1180 1 1  7 LEU HG   H   0.271  -5.380   0.414 1.00 . A A .  7 LEU HG   1 1 
        2  1181 1 1  7 LEU N    N   2.402  -2.074   1.514 1.00 . A A .  7 LEU N    1 1 
        2  1182 1 1  7 LEU O    O  -0.005  -4.409   2.657 1.00 . A A .  7 LEU O    1 1 
        2  1183 1 1  8 LYS C    C   1.456  -4.665   5.345 1.00 . A A .  8 LYS C    1 1 
        2  1184 1 1  8 LYS CA   C   2.169  -5.278   4.143 1.00 . A A .  8 LYS CA   1 1 
        2  1185 1 1  8 LYS CB   C   3.585  -5.702   4.538 1.00 . A A .  8 LYS CB   1 1 
        2  1186 1 1  8 LYS CD   C   5.039  -7.216   5.920 1.00 . A A .  8 LYS CD   1 1 
        2  1187 1 1  8 LYS CE   C   5.290  -7.396   7.409 1.00 . A A .  8 LYS CE   1 1 
        2  1188 1 1  8 LYS CG   C   3.622  -6.740   5.647 1.00 . A A .  8 LYS CG   1 1 
        2  1189 1 1  8 LYS H    H   3.075  -3.967   2.757 1.00 . A A .  8 LYS H    1 1 
        2  1190 1 1  8 LYS HA   H   1.619  -6.147   3.819 1.00 . A A .  8 LYS HA   1 1 
        2  1191 1 1  8 LYS HB2  H   4.078  -6.117   3.670 1.00 . A A .  8 LYS HB2  1 1 
        2  1192 1 1  8 LYS HB3  H   4.130  -4.831   4.869 1.00 . A A .  8 LYS HB3  1 1 
        2  1193 1 1  8 LYS HD2  H   5.193  -8.162   5.424 1.00 . A A .  8 LYS HD2  1 1 
        2  1194 1 1  8 LYS HD3  H   5.735  -6.486   5.532 1.00 . A A .  8 LYS HD3  1 1 
        2  1195 1 1  8 LYS HE2  H   4.377  -7.727   7.878 1.00 . A A .  8 LYS HE2  1 1 
        2  1196 1 1  8 LYS HE3  H   6.056  -8.146   7.544 1.00 . A A .  8 LYS HE3  1 1 
        2  1197 1 1  8 LYS HG2  H   3.220  -6.302   6.549 1.00 . A A .  8 LYS HG2  1 1 
        2  1198 1 1  8 LYS HG3  H   3.017  -7.586   5.357 1.00 . A A .  8 LYS HG3  1 1 
        2  1199 1 1  8 LYS HZ1  H   6.773  -6.103   8.115 1.00 . A A .  8 LYS HZ1  1 1 
        2  1200 1 1  8 LYS HZ2  H   5.342  -6.060   9.014 1.00 . A A .  8 LYS HZ2  1 1 
        2  1201 1 1  8 LYS HZ3  H   5.410  -5.312   7.498 1.00 . A A .  8 LYS HZ3  1 1 
        2  1202 1 1  8 LYS N    N   2.213  -4.341   3.030 1.00 . A A .  8 LYS N    1 1 
        2  1203 1 1  8 LYS NZ   N   5.736  -6.129   8.054 1.00 . A A .  8 LYS NZ   1 1 
        2  1204 1 1  8 LYS O    O   0.733  -5.352   6.067 1.00 . A A .  8 LYS O    1 1 
        2  1205 1 1  9 ASP C    C  -0.440  -2.451   6.428 1.00 . A A .  9 ASP C    1 1 
        2  1206 1 1  9 ASP CA   C   1.050  -2.666   6.674 1.00 . A A .  9 ASP CA   1 1 
        2  1207 1 1  9 ASP CB   C   1.735  -1.317   6.899 1.00 . A A .  9 ASP CB   1 1 
        2  1208 1 1  9 ASP CG   C   3.092  -1.461   7.560 1.00 . A A .  9 ASP CG   1 1 
        2  1209 1 1  9 ASP H    H   2.258  -2.876   4.948 1.00 . A A .  9 ASP H    1 1 
        2  1210 1 1  9 ASP HA   H   1.171  -3.273   7.558 1.00 . A A .  9 ASP HA   1 1 
        2  1211 1 1  9 ASP HB2  H   1.868  -0.826   5.947 1.00 . A A .  9 ASP HB2  1 1 
        2  1212 1 1  9 ASP HB3  H   1.110  -0.703   7.531 1.00 . A A .  9 ASP HB3  1 1 
        2  1213 1 1  9 ASP N    N   1.669  -3.370   5.557 1.00 . A A .  9 ASP N    1 1 
        2  1214 1 1  9 ASP O    O  -1.262  -2.661   7.318 1.00 . A A .  9 ASP O    1 1 
        2  1215 1 1  9 ASP OD1  O   3.954  -2.168   6.999 1.00 . A A .  9 ASP OD1  1 1 
        2  1216 1 1  9 ASP OD2  O   3.292  -0.864   8.639 1.00 . A A .  9 ASP OD2  1 1 
        2  1217 1 1 10 TYR C    C  -3.025  -3.024   5.059 1.00 . A A . 10 TYR C    1 1 
        2  1218 1 1 10 TYR CA   C  -2.170  -1.777   4.854 1.00 . A A . 10 TYR CA   1 1 
        2  1219 1 1 10 TYR CB   C  -2.268  -1.311   3.401 1.00 . A A . 10 TYR CB   1 1 
        2  1220 1 1 10 TYR CD1  C  -4.757  -1.379   2.983 1.00 . A A . 10 TYR CD1  1 1 
        2  1221 1 1 10 TYR CD2  C  -3.650   0.727   2.841 1.00 . A A . 10 TYR CD2  1 1 
        2  1222 1 1 10 TYR CE1  C  -5.960  -0.771   2.680 1.00 . A A . 10 TYR CE1  1 1 
        2  1223 1 1 10 TYR CE2  C  -4.851   1.343   2.538 1.00 . A A . 10 TYR CE2  1 1 
        2  1224 1 1 10 TYR CG   C  -3.583  -0.642   3.069 1.00 . A A . 10 TYR CG   1 1 
        2  1225 1 1 10 TYR CZ   C  -6.002   0.588   2.458 1.00 . A A . 10 TYR CZ   1 1 
        2  1226 1 1 10 TYR H    H  -0.078  -1.874   4.549 1.00 . A A . 10 TYR H    1 1 
        2  1227 1 1 10 TYR HA   H  -2.540  -0.993   5.497 1.00 . A A . 10 TYR HA   1 1 
        2  1228 1 1 10 TYR HB2  H  -1.477  -0.604   3.202 1.00 . A A . 10 TYR HB2  1 1 
        2  1229 1 1 10 TYR HB3  H  -2.155  -2.163   2.748 1.00 . A A . 10 TYR HB3  1 1 
        2  1230 1 1 10 TYR HD1  H  -4.721  -2.444   3.157 1.00 . A A . 10 TYR HD1  1 1 
        2  1231 1 1 10 TYR HD2  H  -2.746   1.315   2.904 1.00 . A A . 10 TYR HD2  1 1 
        2  1232 1 1 10 TYR HE1  H  -6.863  -1.363   2.617 1.00 . A A . 10 TYR HE1  1 1 
        2  1233 1 1 10 TYR HE2  H  -4.882   2.407   2.365 1.00 . A A . 10 TYR HE2  1 1 
        2  1234 1 1 10 TYR HH   H  -7.669   0.673   1.501 1.00 . A A . 10 TYR HH   1 1 
        2  1235 1 1 10 TYR N    N  -0.779  -2.026   5.215 1.00 . A A . 10 TYR N    1 1 
        2  1236 1 1 10 TYR O    O  -4.230  -2.928   5.296 1.00 . A A . 10 TYR O    1 1 
        2  1237 1 1 10 TYR OH   O  -7.199   1.196   2.156 1.00 . A A . 10 TYR OH   1 1 
        2  1238 1 1 11 ALA C    C  -3.161  -5.856   6.609 1.00 . A A . 11 ALA C    1 1 
        2  1239 1 1 11 ALA CA   C  -3.107  -5.454   5.139 1.00 . A A . 11 ALA CA   1 1 
        2  1240 1 1 11 ALA CB   C  -2.447  -6.546   4.315 1.00 . A A . 11 ALA CB   1 1 
        2  1241 1 1 11 ALA H    H  -1.437  -4.205   4.774 1.00 . A A . 11 ALA H    1 1 
        2  1242 1 1 11 ALA HA   H  -4.116  -5.320   4.776 1.00 . A A . 11 ALA HA   1 1 
        2  1243 1 1 11 ALA HB1  H  -3.207  -7.184   3.889 1.00 . A A . 11 ALA HB1  1 1 
        2  1244 1 1 11 ALA HB2  H  -1.798  -7.135   4.947 1.00 . A A . 11 ALA HB2  1 1 
        2  1245 1 1 11 ALA HB3  H  -1.866  -6.099   3.521 1.00 . A A . 11 ALA HB3  1 1 
        2  1246 1 1 11 ALA N    N  -2.398  -4.192   4.965 1.00 . A A . 11 ALA N    1 1 
        2  1247 1 1 11 ALA O    O  -4.229  -6.150   7.144 1.00 . A A . 11 ALA O    1 1 
        2  1248 1 1 12 MET C    C  -2.576  -5.191   9.556 1.00 . A A . 12 MET C    1 1 
        2  1249 1 1 12 MET CA   C  -1.919  -6.242   8.665 1.00 . A A . 12 MET CA   1 1 
        2  1250 1 1 12 MET CB   C  -0.457  -6.435   9.074 1.00 . A A . 12 MET CB   1 1 
        2  1251 1 1 12 MET CE   C   2.234  -6.888  10.531 1.00 . A A . 12 MET CE   1 1 
        2  1252 1 1 12 MET CG   C  -0.108  -7.873   9.424 1.00 . A A . 12 MET CG   1 1 
        2  1253 1 1 12 MET H    H  -1.182  -5.630   6.779 1.00 . A A . 12 MET H    1 1 
        2  1254 1 1 12 MET HA   H  -2.442  -7.174   8.787 1.00 . A A . 12 MET HA   1 1 
        2  1255 1 1 12 MET HB2  H   0.176  -6.121   8.259 1.00 . A A . 12 MET HB2  1 1 
        2  1256 1 1 12 MET HB3  H  -0.251  -5.817   9.937 1.00 . A A . 12 MET HB3  1 1 
        2  1257 1 1 12 MET HE1  H   2.684  -6.533  11.445 1.00 . A A . 12 MET HE1  1 1 
        2  1258 1 1 12 MET HE2  H   1.853  -6.048   9.966 1.00 . A A . 12 MET HE2  1 1 
        2  1259 1 1 12 MET HE3  H   2.976  -7.408   9.942 1.00 . A A . 12 MET HE3  1 1 
        2  1260 1 1 12 MET HG2  H  -1.025  -8.425   9.571 1.00 . A A . 12 MET HG2  1 1 
        2  1261 1 1 12 MET HG3  H   0.441  -8.306   8.602 1.00 . A A . 12 MET HG3  1 1 
        2  1262 1 1 12 MET N    N  -2.002  -5.871   7.258 1.00 . A A . 12 MET N    1 1 
        2  1263 1 1 12 MET O    O  -2.982  -5.484  10.681 1.00 . A A . 12 MET O    1 1 
        2  1264 1 1 12 MET SD   S   0.890  -8.004  10.920 1.00 . A A . 12 MET SD   1 1 
        2  1265 1 1 13 ARG C    C  -4.772  -2.793   9.571 1.00 . A A . 13 ARG C    1 1 
        2  1266 1 1 13 ARG CA   C  -3.267  -2.872   9.803 1.00 . A A . 13 ARG CA   1 1 
        2  1267 1 1 13 ARG CB   C  -2.611  -1.545   9.416 1.00 . A A . 13 ARG CB   1 1 
        2  1268 1 1 13 ARG CD   C  -1.736   0.584  10.422 1.00 . A A . 13 ARG CD   1 1 
        2  1269 1 1 13 ARG CG   C  -2.874  -0.425  10.409 1.00 . A A . 13 ARG CG   1 1 
        2  1270 1 1 13 ARG CZ   C  -0.772   2.305   8.946 1.00 . A A . 13 ARG CZ   1 1 
        2  1271 1 1 13 ARG H    H  -2.320  -3.798   8.152 1.00 . A A . 13 ARG H    1 1 
        2  1272 1 1 13 ARG HA   H  -3.088  -3.053  10.850 1.00 . A A . 13 ARG HA   1 1 
        2  1273 1 1 13 ARG HB2  H  -1.542  -1.692   9.346 1.00 . A A . 13 ARG HB2  1 1 
        2  1274 1 1 13 ARG HB3  H  -2.991  -1.237   8.450 1.00 . A A . 13 ARG HB3  1 1 
        2  1275 1 1 13 ARG HD2  H  -1.887   1.264  11.246 1.00 . A A . 13 ARG HD2  1 1 
        2  1276 1 1 13 ARG HD3  H  -0.805   0.054  10.558 1.00 . A A . 13 ARG HD3  1 1 
        2  1277 1 1 13 ARG HE   H  -2.330   1.147   8.485 1.00 . A A . 13 ARG HE   1 1 
        2  1278 1 1 13 ARG HG2  H  -3.788   0.082  10.131 1.00 . A A . 13 ARG HG2  1 1 
        2  1279 1 1 13 ARG HG3  H  -2.979  -0.851  11.398 1.00 . A A . 13 ARG HG3  1 1 
        2  1280 1 1 13 ARG HH11 H   0.149   2.123  10.737 1.00 . A A . 13 ARG HH11 1 1 
        2  1281 1 1 13 ARG HH12 H   0.811   3.326   9.681 1.00 . A A . 13 ARG HH12 1 1 
        2  1282 1 1 13 ARG HH21 H  -1.462   2.729   7.095 1.00 . A A . 13 ARG HH21 1 1 
        2  1283 1 1 13 ARG HH22 H  -0.105   3.671   7.613 1.00 . A A . 13 ARG HH22 1 1 
        2  1284 1 1 13 ARG N    N  -2.668  -3.969   9.050 1.00 . A A . 13 ARG N    1 1 
        2  1285 1 1 13 ARG NE   N  -1.670   1.353   9.180 1.00 . A A . 13 ARG NE   1 1 
        2  1286 1 1 13 ARG NH1  N   0.138   2.610   9.863 1.00 . A A . 13 ARG NH1  1 1 
        2  1287 1 1 13 ARG NH2  N  -0.780   2.954   7.789 1.00 . A A . 13 ARG NH2  1 1 
        2  1288 1 1 13 ARG O    O  -5.566  -3.026  10.482 1.00 . A A . 13 ARG O    1 1 
        2  1289 1 1 14 PHE C    C  -7.195  -3.666   7.695 1.00 . A A . 14 PHE C    1 1 
        2  1290 1 1 14 PHE CA   C  -6.553  -2.312   7.988 1.00 . A A . 14 PHE CA   1 1 
        2  1291 1 1 14 PHE CB   C  -6.651  -1.401   6.776 1.00 . A A . 14 PHE CB   1 1 
        2  1292 1 1 14 PHE CD1  C  -6.971   0.946   7.583 1.00 . A A . 14 PHE CD1  1 1 
        2  1293 1 1 14 PHE CD2  C  -4.821   0.311   6.796 1.00 . A A . 14 PHE CD2  1 1 
        2  1294 1 1 14 PHE CE1  C  -6.502   2.208   7.849 1.00 . A A . 14 PHE CE1  1 1 
        2  1295 1 1 14 PHE CE2  C  -4.348   1.570   7.058 1.00 . A A . 14 PHE CE2  1 1 
        2  1296 1 1 14 PHE CG   C  -6.139  -0.020   7.053 1.00 . A A . 14 PHE CG   1 1 
        2  1297 1 1 14 PHE CZ   C  -5.191   2.516   7.585 1.00 . A A . 14 PHE CZ   1 1 
        2  1298 1 1 14 PHE H    H  -4.482  -2.260   7.668 1.00 . A A . 14 PHE H    1 1 
        2  1299 1 1 14 PHE HA   H  -7.070  -1.848   8.814 1.00 . A A . 14 PHE HA   1 1 
        2  1300 1 1 14 PHE HB2  H  -6.070  -1.819   5.966 1.00 . A A . 14 PHE HB2  1 1 
        2  1301 1 1 14 PHE HB3  H  -7.676  -1.326   6.475 1.00 . A A . 14 PHE HB3  1 1 
        2  1302 1 1 14 PHE HD1  H  -7.993   0.708   7.794 1.00 . A A . 14 PHE HD1  1 1 
        2  1303 1 1 14 PHE HD2  H  -4.160  -0.424   6.385 1.00 . A A . 14 PHE HD2  1 1 
        2  1304 1 1 14 PHE HE1  H  -7.161   2.956   8.264 1.00 . A A . 14 PHE HE1  1 1 
        2  1305 1 1 14 PHE HE2  H  -3.317   1.814   6.854 1.00 . A A . 14 PHE HE2  1 1 
        2  1306 1 1 14 PHE HZ   H  -4.827   3.491   7.790 1.00 . A A . 14 PHE HZ   1 1 
        2  1307 1 1 14 PHE N    N  -5.156  -2.446   8.348 1.00 . A A . 14 PHE N    1 1 
        2  1308 1 1 14 PHE O    O  -8.325  -3.927   8.108 1.00 . A A . 14 PHE O    1 1 
        2  1309 1 1 15 GLY C    C  -7.040  -6.081   5.154 1.00 . A A . 15 GLY C    1 1 
        2  1310 1 1 15 GLY CA   C  -6.997  -5.834   6.649 1.00 . A A . 15 GLY CA   1 1 
        2  1311 1 1 15 GLY H    H  -5.577  -4.262   6.678 1.00 . A A . 15 GLY H    1 1 
        2  1312 1 1 15 GLY HA2  H  -6.375  -6.588   7.110 1.00 . A A . 15 GLY HA2  1 1 
        2  1313 1 1 15 GLY HA3  H  -7.999  -5.921   7.045 1.00 . A A . 15 GLY HA3  1 1 
        2  1314 1 1 15 GLY N    N  -6.472  -4.522   6.982 1.00 . A A . 15 GLY N    1 1 
        2  1315 1 1 15 GLY O    O  -7.253  -5.154   4.373 1.00 . A A . 15 GLY O    1 1 
        2  1316 1 1 16 GLN C    C  -8.177  -7.313   2.691 1.00 . A A . 16 GLN C    1 1 
        2  1317 1 1 16 GLN CA   C  -6.855  -7.702   3.345 1.00 . A A . 16 GLN CA   1 1 
        2  1318 1 1 16 GLN CB   C  -6.620  -9.205   3.188 1.00 . A A . 16 GLN CB   1 1 
        2  1319 1 1 16 GLN CD   C  -5.337 -10.677   4.793 1.00 . A A . 16 GLN CD   1 1 
        2  1320 1 1 16 GLN CG   C  -5.253  -9.663   3.670 1.00 . A A . 16 GLN CG   1 1 
        2  1321 1 1 16 GLN H    H  -6.674  -8.026   5.430 1.00 . A A . 16 GLN H    1 1 
        2  1322 1 1 16 GLN HA   H  -6.055  -7.170   2.854 1.00 . A A . 16 GLN HA   1 1 
        2  1323 1 1 16 GLN HB2  H  -7.373  -9.736   3.751 1.00 . A A . 16 GLN HB2  1 1 
        2  1324 1 1 16 GLN HB3  H  -6.716  -9.466   2.144 1.00 . A A . 16 GLN HB3  1 1 
        2  1325 1 1 16 GLN HE21 H  -5.123  -9.230   6.144 1.00 . A A . 16 GLN HE21 1 1 
        2  1326 1 1 16 GLN HE22 H  -5.293 -10.837   6.777 1.00 . A A . 16 GLN HE22 1 1 
        2  1327 1 1 16 GLN HG2  H  -4.724 -10.110   2.841 1.00 . A A . 16 GLN HG2  1 1 
        2  1328 1 1 16 GLN HG3  H  -4.703  -8.801   4.022 1.00 . A A . 16 GLN HG3  1 1 
        2  1329 1 1 16 GLN N    N  -6.838  -7.334   4.757 1.00 . A A . 16 GLN N    1 1 
        2  1330 1 1 16 GLN NE2  N  -5.242 -10.200   6.030 1.00 . A A . 16 GLN NE2  1 1 
        2  1331 1 1 16 GLN O    O  -8.234  -7.048   1.491 1.00 . A A . 16 GLN O    1 1 
        2  1332 1 1 16 GLN OE1  O  -5.488 -11.874   4.553 1.00 . A A . 16 GLN OE1  1 1 
        2  1333 1 1 17 THR C    C -10.560  -5.538   2.364 1.00 . A A . 17 THR C    1 1 
        2  1334 1 1 17 THR CA   C -10.560  -6.931   2.986 1.00 . A A . 17 THR CA   1 1 
        2  1335 1 1 17 THR CB   C -11.590  -6.992   4.115 1.00 . A A . 17 THR CB   1 1 
        2  1336 1 1 17 THR CG2  C -13.000  -6.693   3.656 1.00 . A A . 17 THR CG2  1 1 
        2  1337 1 1 17 THR H    H  -9.135  -7.507   4.437 1.00 . A A . 17 THR H    1 1 
        2  1338 1 1 17 THR HA   H -10.830  -7.650   2.227 1.00 . A A . 17 THR HA   1 1 
        2  1339 1 1 17 THR HB   H -11.330  -6.265   4.870 1.00 . A A . 17 THR HB   1 1 
        2  1340 1 1 17 THR HG1  H -10.760  -8.422   5.169 1.00 . A A . 17 THR HG1  1 1 
        2  1341 1 1 17 THR HG21 H -13.060  -6.803   2.584 1.00 . A A . 17 THR HG21 1 1 
        2  1342 1 1 17 THR HG22 H -13.260  -5.683   3.931 1.00 . A A . 17 THR HG22 1 1 
        2  1343 1 1 17 THR HG23 H -13.690  -7.383   4.127 1.00 . A A . 17 THR HG23 1 1 
        2  1344 1 1 17 THR N    N  -9.241  -7.284   3.488 1.00 . A A . 17 THR N    1 1 
        2  1345 1 1 17 THR O    O -10.820  -5.379   1.172 1.00 . A A . 17 THR O    1 1 
        2  1346 1 1 17 THR OG1  O -11.600  -8.276   4.718 1.00 . A A . 17 THR OG1  1 1 
        2  1347 1 1 18 LYS C    C  -9.157  -2.972   1.623 1.00 . A A . 18 LYS C    1 1 
        2  1348 1 1 18 LYS CA   C -10.210  -3.153   2.704 1.00 . A A . 18 LYS CA   1 1 
        2  1349 1 1 18 LYS CB   C  -9.945  -2.199   3.869 1.00 . A A . 18 LYS CB   1 1 
        2  1350 1 1 18 LYS CD   C -10.300   0.076   4.875 1.00 . A A . 18 LYS CD   1 1 
        2  1351 1 1 18 LYS CE   C  -9.498   1.221   4.292 1.00 . A A . 18 LYS CE   1 1 
        2  1352 1 1 18 LYS CG   C -10.740  -0.907   3.799 1.00 . A A . 18 LYS CG   1 1 
        2  1353 1 1 18 LYS H    H -10.050  -4.720   4.116 1.00 . A A . 18 LYS H    1 1 
        2  1354 1 1 18 LYS HA   H -11.180  -2.921   2.282 1.00 . A A . 18 LYS HA   1 1 
        2  1355 1 1 18 LYS HB2  H -10.190  -2.700   4.794 1.00 . A A . 18 LYS HB2  1 1 
        2  1356 1 1 18 LYS HB3  H  -8.895  -1.948   3.876 1.00 . A A . 18 LYS HB3  1 1 
        2  1357 1 1 18 LYS HD2  H -11.180   0.480   5.355 1.00 . A A . 18 LYS HD2  1 1 
        2  1358 1 1 18 LYS HD3  H  -9.707  -0.445   5.604 1.00 . A A . 18 LYS HD3  1 1 
        2  1359 1 1 18 LYS HE2  H  -8.668   1.431   4.951 1.00 . A A . 18 LYS HE2  1 1 
        2  1360 1 1 18 LYS HE3  H  -9.121   0.924   3.325 1.00 . A A . 18 LYS HE3  1 1 
        2  1361 1 1 18 LYS HG2  H -10.590  -0.454   2.829 1.00 . A A . 18 LYS HG2  1 1 
        2  1362 1 1 18 LYS HG3  H -11.790  -1.135   3.932 1.00 . A A . 18 LYS HG3  1 1 
        2  1363 1 1 18 LYS HZ1  H  -9.740   3.214   3.711 1.00 . A A . 18 LYS HZ1  1 1 
        2  1364 1 1 18 LYS HZ2  H -10.650   2.778   5.062 1.00 . A A . 18 LYS HZ2  1 1 
        2  1365 1 1 18 LYS HZ3  H -11.130   2.271   3.520 1.00 . A A . 18 LYS HZ3  1 1 
        2  1366 1 1 18 LYS N    N -10.250  -4.531   3.175 1.00 . A A . 18 LYS N    1 1 
        2  1367 1 1 18 LYS NZ   N -10.310   2.457   4.136 1.00 . A A . 18 LYS NZ   1 1 
        2  1368 1 1 18 LYS O    O  -9.318  -2.163   0.710 1.00 . A A . 18 LYS O    1 1 
        2  1369 1 1 19 THR C    C  -7.441  -4.137  -0.608 1.00 . A A . 19 THR C    1 1 
        2  1370 1 1 19 THR CA   C  -6.985  -3.655   0.764 1.00 . A A . 19 THR CA   1 1 
        2  1371 1 1 19 THR CB   C  -5.792  -4.487   1.236 1.00 . A A . 19 THR CB   1 1 
        2  1372 1 1 19 THR CG2  C  -4.481  -4.061   0.612 1.00 . A A . 19 THR CG2  1 1 
        2  1373 1 1 19 THR H    H  -8.001  -4.359   2.482 1.00 . A A . 19 THR H    1 1 
        2  1374 1 1 19 THR HA   H  -6.682  -2.621   0.687 1.00 . A A . 19 THR HA   1 1 
        2  1375 1 1 19 THR HB   H  -5.963  -5.522   0.974 1.00 . A A . 19 THR HB   1 1 
        2  1376 1 1 19 THR HG1  H  -6.039  -5.177   3.052 1.00 . A A . 19 THR HG1  1 1 
        2  1377 1 1 19 THR HG21 H  -3.781  -4.884   0.646 1.00 . A A . 19 THR HG21 1 1 
        2  1378 1 1 19 THR HG22 H  -4.076  -3.223   1.161 1.00 . A A . 19 THR HG22 1 1 
        2  1379 1 1 19 THR HG23 H  -4.648  -3.771  -0.415 1.00 . A A . 19 THR HG23 1 1 
        2  1380 1 1 19 THR N    N  -8.072  -3.731   1.733 1.00 . A A . 19 THR N    1 1 
        2  1381 1 1 19 THR O    O  -6.984  -3.639  -1.637 1.00 . A A . 19 THR O    1 1 
        2  1382 1 1 19 THR OG1  O  -5.646  -4.403   2.642 1.00 . A A . 19 THR OG1  1 1 
        2  1383 1 1 20 ALA C    C -10.100  -4.910  -2.338 1.00 . A A . 20 ALA C    1 1 
        2  1384 1 1 20 ALA CA   C  -8.860  -5.663  -1.865 1.00 . A A . 20 ALA CA   1 1 
        2  1385 1 1 20 ALA CB   C  -9.171  -7.142  -1.694 1.00 . A A . 20 ALA CB   1 1 
        2  1386 1 1 20 ALA H    H  -8.669  -5.469   0.234 1.00 . A A . 20 ALA H    1 1 
        2  1387 1 1 20 ALA HA   H  -8.089  -5.566  -2.614 1.00 . A A . 20 ALA HA   1 1 
        2  1388 1 1 20 ALA HB1  H -10.240  -7.285  -1.650 1.00 . A A . 20 ALA HB1  1 1 
        2  1389 1 1 20 ALA HB2  H  -8.724  -7.500  -0.778 1.00 . A A . 20 ALA HB2  1 1 
        2  1390 1 1 20 ALA HB3  H  -8.768  -7.693  -2.531 1.00 . A A . 20 ALA HB3  1 1 
        2  1391 1 1 20 ALA N    N  -8.343  -5.111  -0.617 1.00 . A A . 20 ALA N    1 1 
        2  1392 1 1 20 ALA O    O -10.490  -5.017  -3.499 1.00 . A A . 20 ALA O    1 1 
        2  1393 1 1 21 LYS C    C -11.570  -1.996  -2.265 1.00 . A A . 21 LYS C    1 1 
        2  1394 1 1 21 LYS CA   C -11.920  -3.396  -1.765 1.00 . A A . 21 LYS CA   1 1 
        2  1395 1 1 21 LYS CB   C -12.840  -3.304  -0.545 1.00 . A A . 21 LYS CB   1 1 
        2  1396 1 1 21 LYS CD   C -14.840  -4.543   0.327 1.00 . A A . 21 LYS CD   1 1 
        2  1397 1 1 21 LYS CE   C -14.750  -6.040   0.068 1.00 . A A . 21 LYS CE   1 1 
        2  1398 1 1 21 LYS CG   C -14.270  -3.738  -0.827 1.00 . A A . 21 LYS CG   1 1 
        2  1399 1 1 21 LYS H    H -10.360  -4.113  -0.520 1.00 . A A . 21 LYS H    1 1 
        2  1400 1 1 21 LYS HA   H -12.440  -3.926  -2.550 1.00 . A A . 21 LYS HA   1 1 
        2  1401 1 1 21 LYS HB2  H -12.440  -3.933   0.238 1.00 . A A . 21 LYS HB2  1 1 
        2  1402 1 1 21 LYS HB3  H -12.860  -2.280  -0.197 1.00 . A A . 21 LYS HB3  1 1 
        2  1403 1 1 21 LYS HD2  H -14.290  -4.309   1.226 1.00 . A A . 21 LYS HD2  1 1 
        2  1404 1 1 21 LYS HD3  H -15.880  -4.275   0.458 1.00 . A A . 21 LYS HD3  1 1 
        2  1405 1 1 21 LYS HE2  H -14.250  -6.200  -0.875 1.00 . A A . 21 LYS HE2  1 1 
        2  1406 1 1 21 LYS HE3  H -14.170  -6.493   0.861 1.00 . A A . 21 LYS HE3  1 1 
        2  1407 1 1 21 LYS HG2  H -14.880  -2.861  -0.980 1.00 . A A . 21 LYS HG2  1 1 
        2  1408 1 1 21 LYS HG3  H -14.280  -4.346  -1.720 1.00 . A A . 21 LYS HG3  1 1 
        2  1409 1 1 21 LYS HZ1  H -16.030  -7.604  -0.454 1.00 . A A . 21 LYS HZ1  1 1 
        2  1410 1 1 21 LYS HZ2  H -16.760  -6.078  -0.506 1.00 . A A . 21 LYS HZ2  1 1 
        2  1411 1 1 21 LYS HZ3  H -16.460  -6.821   0.984 1.00 . A A . 21 LYS HZ3  1 1 
        2  1412 1 1 21 LYS N    N -10.720  -4.155  -1.432 1.00 . A A . 21 LYS N    1 1 
        2  1413 1 1 21 LYS NZ   N -16.090  -6.680   0.019 1.00 . A A . 21 LYS NZ   1 1 
        2  1414 1 1 21 LYS O    O -11.970  -1.605  -3.364 1.00 . A A . 21 LYS O    1 1 
        2  1415 1 1 22 ASP C    C  -9.653   0.133  -3.109 1.00 . A A . 22 ASP C    1 1 
        2  1416 1 1 22 ASP CA   C -10.450   0.114  -1.808 1.00 . A A . 22 ASP CA   1 1 
        2  1417 1 1 22 ASP CB   C  -9.628   0.734  -0.677 1.00 . A A . 22 ASP CB   1 1 
        2  1418 1 1 22 ASP CG   C -10.450   1.662   0.193 1.00 . A A . 22 ASP CG   1 1 
        2  1419 1 1 22 ASP H    H -10.560  -1.607  -0.586 1.00 . A A . 22 ASP H    1 1 
        2  1420 1 1 22 ASP HA   H -11.350   0.692  -1.944 1.00 . A A . 22 ASP HA   1 1 
        2  1421 1 1 22 ASP HB2  H  -9.232  -0.055  -0.053 1.00 . A A . 22 ASP HB2  1 1 
        2  1422 1 1 22 ASP HB3  H  -8.812   1.300  -1.104 1.00 . A A . 22 ASP HB3  1 1 
        2  1423 1 1 22 ASP N    N -10.840  -1.243  -1.450 1.00 . A A . 22 ASP N    1 1 
        2  1424 1 1 22 ASP O    O  -9.821   1.027  -3.937 1.00 . A A . 22 ASP O    1 1 
        2  1425 1 1 22 ASP OD1  O -11.240   2.454  -0.364 1.00 . A A . 22 ASP OD1  1 1 
        2  1426 1 1 22 ASP OD2  O -10.310   1.597   1.432 1.00 . A A . 22 ASP OD2  1 1 
        2  1427 1 1 23 LEU C    C  -8.754  -1.546  -5.645 1.00 . A A . 23 LEU C    1 1 
        2  1428 1 1 23 LEU CA   C  -7.962  -0.951  -4.484 1.00 . A A . 23 LEU CA   1 1 
        2  1429 1 1 23 LEU CB   C  -6.719  -1.799  -4.211 1.00 . A A . 23 LEU CB   1 1 
        2  1430 1 1 23 LEU CD1  C  -5.637  -1.301  -2.004 1.00 . A A . 23 LEU CD1  1 1 
        2  1431 1 1 23 LEU CD2  C  -4.237  -1.500  -4.065 1.00 . A A . 23 LEU CD2  1 1 
        2  1432 1 1 23 LEU CG   C  -5.580  -1.063  -3.504 1.00 . A A . 23 LEU CG   1 1 
        2  1433 1 1 23 LEU H    H  -8.694  -1.544  -2.587 1.00 . A A . 23 LEU H    1 1 
        2  1434 1 1 23 LEU HA   H  -7.651   0.048  -4.751 1.00 . A A . 23 LEU HA   1 1 
        2  1435 1 1 23 LEU HB2  H  -7.011  -2.641  -3.602 1.00 . A A . 23 LEU HB2  1 1 
        2  1436 1 1 23 LEU HB3  H  -6.348  -2.169  -5.155 1.00 . A A . 23 LEU HB3  1 1 
        2  1437 1 1 23 LEU HD11 H  -6.666  -1.402  -1.694 1.00 . A A . 23 LEU HD11 1 1 
        2  1438 1 1 23 LEU HD12 H  -5.186  -0.466  -1.489 1.00 . A A . 23 LEU HD12 1 1 
        2  1439 1 1 23 LEU HD13 H  -5.098  -2.206  -1.764 1.00 . A A . 23 LEU HD13 1 1 
        2  1440 1 1 23 LEU HD21 H  -4.191  -1.259  -5.116 1.00 . A A . 23 LEU HD21 1 1 
        2  1441 1 1 23 LEU HD22 H  -4.121  -2.564  -3.934 1.00 . A A . 23 LEU HD22 1 1 
        2  1442 1 1 23 LEU HD23 H  -3.445  -0.983  -3.543 1.00 . A A . 23 LEU HD23 1 1 
        2  1443 1 1 23 LEU HG   H  -5.685  -0.001  -3.677 1.00 . A A . 23 LEU HG   1 1 
        2  1444 1 1 23 LEU N    N  -8.785  -0.858  -3.283 1.00 . A A . 23 LEU N    1 1 
        2  1445 1 1 23 LEU O    O  -8.618  -1.111  -6.789 1.00 . A A . 23 LEU O    1 1 
        2  1446 1 1 24 GLY C    C  -9.785  -4.496  -6.836 1.00 . A A . 24 GLY C    1 1 
        2  1447 1 1 24 GLY CA   C -10.380  -3.179  -6.372 1.00 . A A . 24 GLY CA   1 1 
        2  1448 1 1 24 GLY H    H  -9.646  -2.848  -4.413 1.00 . A A . 24 GLY H    1 1 
        2  1449 1 1 24 GLY HA2  H -11.370  -3.362  -5.981 1.00 . A A . 24 GLY HA2  1 1 
        2  1450 1 1 24 GLY HA3  H -10.450  -2.513  -7.218 1.00 . A A . 24 GLY HA3  1 1 
        2  1451 1 1 24 GLY N    N  -9.580  -2.542  -5.342 1.00 . A A . 24 GLY N    1 1 
        2  1452 1 1 24 GLY O    O  -9.730  -4.770  -8.035 1.00 . A A . 24 GLY O    1 1 
        2  1453 1 1 25 VAL C    C  -9.234  -7.679  -5.238 1.00 . A A . 25 VAL C    1 1 
        2  1454 1 1 25 VAL CA   C  -8.747  -6.603  -6.201 1.00 . A A . 25 VAL CA   1 1 
        2  1455 1 1 25 VAL CB   C  -7.209  -6.543  -6.151 1.00 . A A . 25 VAL CB   1 1 
        2  1456 1 1 25 VAL CG1  C  -6.665  -5.758  -7.334 1.00 . A A . 25 VAL CG1  1 1 
        2  1457 1 1 25 VAL CG2  C  -6.741  -5.934  -4.837 1.00 . A A . 25 VAL CG2  1 1 
        2  1458 1 1 25 VAL H    H  -9.413  -5.033  -4.947 1.00 . A A . 25 VAL H    1 1 
        2  1459 1 1 25 VAL HA   H  -9.044  -6.869  -7.206 1.00 . A A . 25 VAL HA   1 1 
        2  1460 1 1 25 VAL HB   H  -6.826  -7.550  -6.213 1.00 . A A . 25 VAL HB   1 1 
        2  1461 1 1 25 VAL HG11 H  -5.586  -5.786  -7.320 1.00 . A A . 25 VAL HG11 1 1 
        2  1462 1 1 25 VAL HG12 H  -6.999  -4.731  -7.269 1.00 . A A . 25 VAL HG12 1 1 
        2  1463 1 1 25 VAL HG13 H  -7.026  -6.195  -8.253 1.00 . A A . 25 VAL HG13 1 1 
        2  1464 1 1 25 VAL HG21 H  -7.248  -4.995  -4.675 1.00 . A A . 25 VAL HG21 1 1 
        2  1465 1 1 25 VAL HG22 H  -5.675  -5.767  -4.878 1.00 . A A . 25 VAL HG22 1 1 
        2  1466 1 1 25 VAL HG23 H  -6.968  -6.610  -4.026 1.00 . A A . 25 VAL HG23 1 1 
        2  1467 1 1 25 VAL N    N  -9.340  -5.309  -5.884 1.00 . A A . 25 VAL N    1 1 
        2  1468 1 1 25 VAL O    O -10.040  -7.410  -4.348 1.00 . A A . 25 VAL O    1 1 
        2  1469 1 1 26 GLN C    C  -8.042 -10.299  -3.532 1.00 . A A . 26 GLN C    1 1 
        2  1470 1 1 26 GLN CA   C  -9.122 -10.015  -4.565 1.00 . A A . 26 GLN CA   1 1 
        2  1471 1 1 26 GLN CB   C  -9.376 -11.266  -5.407 1.00 . A A . 26 GLN CB   1 1 
        2  1472 1 1 26 GLN CD   C -11.440 -12.346  -6.366 1.00 . A A . 26 GLN CD   1 1 
        2  1473 1 1 26 GLN CG   C -10.540 -11.129  -6.366 1.00 . A A . 26 GLN CG   1 1 
        2  1474 1 1 26 GLN H    H  -8.099  -9.053  -6.143 1.00 . A A . 26 GLN H    1 1 
        2  1475 1 1 26 GLN HA   H -10.030  -9.744  -4.054 1.00 . A A . 26 GLN HA   1 1 
        2  1476 1 1 26 GLN HB2  H  -8.489 -11.485  -5.985 1.00 . A A . 26 GLN HB2  1 1 
        2  1477 1 1 26 GLN HB3  H  -9.576 -12.095  -4.745 1.00 . A A . 26 GLN HB3  1 1 
        2  1478 1 1 26 GLN HE21 H -12.100 -11.891  -4.546 1.00 . A A . 26 GLN HE21 1 1 
        2  1479 1 1 26 GLN HE22 H -12.770 -13.319  -5.250 1.00 . A A . 26 GLN HE22 1 1 
        2  1480 1 1 26 GLN HG2  H -11.120 -10.268  -6.080 1.00 . A A . 26 GLN HG2  1 1 
        2  1481 1 1 26 GLN HG3  H -10.150 -10.986  -7.364 1.00 . A A . 26 GLN HG3  1 1 
        2  1482 1 1 26 GLN N    N  -8.739  -8.899  -5.419 1.00 . A A . 26 GLN N    1 1 
        2  1483 1 1 26 GLN NE2  N -12.180 -12.538  -5.276 1.00 . A A . 26 GLN NE2  1 1 
        2  1484 1 1 26 GLN O    O  -6.865 -10.009  -3.751 1.00 . A A . 26 GLN O    1 1 
        2  1485 1 1 26 GLN OE1  O -11.480 -13.109  -7.333 1.00 . A A . 26 GLN OE1  1 1 
        2  1486 1 1 27 GLN C    C  -6.469 -12.202  -1.810 1.00 . A A . 27 GLN C    1 1 
        2  1487 1 1 27 GLN CA   C  -7.517 -11.198  -1.336 1.00 . A A . 27 GLN CA   1 1 
        2  1488 1 1 27 GLN CB   C  -8.271 -11.763  -0.130 1.00 . A A . 27 GLN CB   1 1 
        2  1489 1 1 27 GLN CD   C -10.490 -11.299   0.969 1.00 . A A . 27 GLN CD   1 1 
        2  1490 1 1 27 GLN CG   C  -9.146 -10.738   0.573 1.00 . A A . 27 GLN CG   1 1 
        2  1491 1 1 27 GLN H    H  -9.399 -11.077  -2.296 1.00 . A A . 27 GLN H    1 1 
        2  1492 1 1 27 GLN HA   H  -7.018 -10.289  -1.043 1.00 . A A . 27 GLN HA   1 1 
        2  1493 1 1 27 GLN HB2  H  -8.901 -12.575  -0.462 1.00 . A A . 27 GLN HB2  1 1 
        2  1494 1 1 27 GLN HB3  H  -7.555 -12.143   0.582 1.00 . A A . 27 GLN HB3  1 1 
        2  1495 1 1 27 GLN HE21 H  -9.648 -12.420   2.375 1.00 . A A . 27 GLN HE21 1 1 
        2  1496 1 1 27 GLN HE22 H -11.360 -12.562   2.238 1.00 . A A . 27 GLN HE22 1 1 
        2  1497 1 1 27 GLN HG2  H  -8.639 -10.402   1.464 1.00 . A A . 27 GLN HG2  1 1 
        2  1498 1 1 27 GLN HG3  H  -9.300  -9.900  -0.092 1.00 . A A . 27 GLN HG3  1 1 
        2  1499 1 1 27 GLN N    N  -8.449 -10.869  -2.407 1.00 . A A . 27 GLN N    1 1 
        2  1500 1 1 27 GLN NE2  N -10.500 -12.182   1.959 1.00 . A A . 27 GLN NE2  1 1 
        2  1501 1 1 27 GLN O    O  -5.411 -12.345  -1.197 1.00 . A A . 27 GLN O    1 1 
        2  1502 1 1 27 GLN OE1  O -11.520 -10.942   0.392 1.00 . A A . 27 GLN OE1  1 1 
        2  1503 1 1 28 SER C    C  -4.564 -13.224  -3.939 1.00 . A A . 28 SER C    1 1 
        2  1504 1 1 28 SER CA   C  -5.852 -13.884  -3.459 1.00 . A A . 28 SER CA   1 1 
        2  1505 1 1 28 SER CB   C  -6.517 -14.634  -4.614 1.00 . A A . 28 SER CB   1 1 
        2  1506 1 1 28 SER H    H  -7.626 -12.739  -3.351 1.00 . A A . 28 SER H    1 1 
        2  1507 1 1 28 SER HA   H  -5.614 -14.587  -2.677 1.00 . A A . 28 SER HA   1 1 
        2  1508 1 1 28 SER HB2  H  -5.876 -15.441  -4.934 1.00 . A A . 28 SER HB2  1 1 
        2  1509 1 1 28 SER HB3  H  -7.463 -15.036  -4.283 1.00 . A A . 28 SER HB3  1 1 
        2  1510 1 1 28 SER HG   H  -5.912 -13.568  -6.143 1.00 . A A . 28 SER HG   1 1 
        2  1511 1 1 28 SER N    N  -6.769 -12.895  -2.905 1.00 . A A . 28 SER N    1 1 
        2  1512 1 1 28 SER O    O  -3.468 -13.737  -3.709 1.00 . A A . 28 SER O    1 1 
        2  1513 1 1 28 SER OG   O  -6.746 -13.772  -5.716 1.00 . A A . 28 SER OG   1 1 
        2  1514 1 1 29 ALA C    C  -2.800 -10.646  -3.998 1.00 . A A . 29 ALA C    1 1 
        2  1515 1 1 29 ALA CA   C  -3.548 -11.354  -5.121 1.00 . A A . 29 ALA CA   1 1 
        2  1516 1 1 29 ALA CB   C  -3.987 -10.352  -6.179 1.00 . A A . 29 ALA CB   1 1 
        2  1517 1 1 29 ALA H    H  -5.600 -11.723  -4.760 1.00 . A A . 29 ALA H    1 1 
        2  1518 1 1 29 ALA HA   H  -2.884 -12.068  -5.589 1.00 . A A . 29 ALA HA   1 1 
        2  1519 1 1 29 ALA HB1  H  -3.116  -9.909  -6.638 1.00 . A A . 29 ALA HB1  1 1 
        2  1520 1 1 29 ALA HB2  H  -4.585  -9.580  -5.719 1.00 . A A . 29 ALA HB2  1 1 
        2  1521 1 1 29 ALA HB3  H  -4.571 -10.859  -6.934 1.00 . A A . 29 ALA HB3  1 1 
        2  1522 1 1 29 ALA N    N  -4.701 -12.083  -4.608 1.00 . A A . 29 ALA N    1 1 
        2  1523 1 1 29 ALA O    O  -1.572 -10.557  -4.017 1.00 . A A . 29 ALA O    1 1 
        2  1524 1 1 30 ILE C    C  -1.995 -10.361  -1.126 1.00 . A A . 30 ILE C    1 1 
        2  1525 1 1 30 ILE CA   C  -2.946  -9.446  -1.887 1.00 . A A . 30 ILE CA   1 1 
        2  1526 1 1 30 ILE CB   C  -4.021  -8.915  -0.917 1.00 . A A . 30 ILE CB   1 1 
        2  1527 1 1 30 ILE CD1  C  -4.529  -6.984  -2.498 1.00 . A A . 30 ILE CD1  1 1 
        2  1528 1 1 30 ILE CG1  C  -5.088  -8.125  -1.676 1.00 . A A . 30 ILE CG1  1 1 
        2  1529 1 1 30 ILE CG2  C  -3.382  -8.050   0.160 1.00 . A A . 30 ILE CG2  1 1 
        2  1530 1 1 30 ILE H    H  -4.519 -10.247  -3.058 1.00 . A A . 30 ILE H    1 1 
        2  1531 1 1 30 ILE HA   H  -2.389  -8.604  -2.273 1.00 . A A . 30 ILE HA   1 1 
        2  1532 1 1 30 ILE HB   H  -4.486  -9.761  -0.433 1.00 . A A . 30 ILE HB   1 1 
        2  1533 1 1 30 ILE HD11 H  -5.318  -6.280  -2.720 1.00 . A A . 30 ILE HD11 1 1 
        2  1534 1 1 30 ILE HD12 H  -4.121  -7.371  -3.420 1.00 . A A . 30 ILE HD12 1 1 
        2  1535 1 1 30 ILE HD13 H  -3.750  -6.486  -1.940 1.00 . A A . 30 ILE HD13 1 1 
        2  1536 1 1 30 ILE HG12 H  -5.611  -8.790  -2.346 1.00 . A A . 30 ILE HG12 1 1 
        2  1537 1 1 30 ILE HG13 H  -5.792  -7.711  -0.969 1.00 . A A . 30 ILE HG13 1 1 
        2  1538 1 1 30 ILE HG21 H  -2.638  -8.626   0.690 1.00 . A A . 30 ILE HG21 1 1 
        2  1539 1 1 30 ILE HG22 H  -4.142  -7.719   0.853 1.00 . A A . 30 ILE HG22 1 1 
        2  1540 1 1 30 ILE HG23 H  -2.914  -7.191  -0.299 1.00 . A A . 30 ILE HG23 1 1 
        2  1541 1 1 30 ILE N    N  -3.545 -10.145  -3.019 1.00 . A A . 30 ILE N    1 1 
        2  1542 1 1 30 ILE O    O  -0.849 -10.000  -0.862 1.00 . A A . 30 ILE O    1 1 
        2  1543 1 1 31 ASN C    C  -0.445 -12.920  -0.857 1.00 . A A . 31 ASN C    1 1 
        2  1544 1 1 31 ASN CA   C  -1.670 -12.516  -0.045 1.00 . A A . 31 ASN CA   1 1 
        2  1545 1 1 31 ASN CB   C  -2.503 -13.754   0.294 1.00 . A A . 31 ASN CB   1 1 
        2  1546 1 1 31 ASN CG   C  -3.185 -13.641   1.644 1.00 . A A . 31 ASN CG   1 1 
        2  1547 1 1 31 ASN H    H  -3.401 -11.777  -1.015 1.00 . A A . 31 ASN H    1 1 
        2  1548 1 1 31 ASN HA   H  -1.344 -12.051   0.872 1.00 . A A . 31 ASN HA   1 1 
        2  1549 1 1 31 ASN HB2  H  -3.264 -13.888  -0.462 1.00 . A A . 31 ASN HB2  1 1 
        2  1550 1 1 31 ASN HB3  H  -1.859 -14.621   0.308 1.00 . A A . 31 ASN HB3  1 1 
        2  1551 1 1 31 ASN HD21 H  -3.329 -15.624   1.761 1.00 . A A . 31 ASN HD21 1 1 
        2  1552 1 1 31 ASN HD22 H  -3.975 -14.736   3.107 1.00 . A A . 31 ASN HD22 1 1 
        2  1553 1 1 31 ASN N    N  -2.479 -11.547  -0.775 1.00 . A A . 31 ASN N    1 1 
        2  1554 1 1 31 ASN ND2  N  -3.531 -14.781   2.229 1.00 . A A . 31 ASN ND2  1 1 
        2  1555 1 1 31 ASN O    O   0.614 -13.205  -0.298 1.00 . A A . 31 ASN O    1 1 
        2  1556 1 1 31 ASN OD1  O  -3.396 -12.541   2.155 1.00 . A A . 31 ASN OD1  1 1 
        2  1557 1 1 32 LYS C    C   1.544 -12.211  -3.137 1.00 . A A . 32 LYS C    1 1 
        2  1558 1 1 32 LYS CA   C   0.497 -13.313  -3.066 1.00 . A A . 32 LYS CA   1 1 
        2  1559 1 1 32 LYS CB   C  -0.034 -13.613  -4.468 1.00 . A A . 32 LYS CB   1 1 
        2  1560 1 1 32 LYS CD   C   0.206 -16.111  -4.600 1.00 . A A . 32 LYS CD   1 1 
        2  1561 1 1 32 LYS CE   C  -0.526 -17.442  -4.655 1.00 . A A . 32 LYS CE   1 1 
        2  1562 1 1 32 LYS CG   C  -0.765 -14.941  -4.572 1.00 . A A . 32 LYS CG   1 1 
        2  1563 1 1 32 LYS H    H  -1.463 -12.709  -2.563 1.00 . A A . 32 LYS H    1 1 
        2  1564 1 1 32 LYS HA   H   0.954 -14.198  -2.666 1.00 . A A . 32 LYS HA   1 1 
        2  1565 1 1 32 LYS HB2  H  -0.715 -12.827  -4.758 1.00 . A A . 32 LYS HB2  1 1 
        2  1566 1 1 32 LYS HB3  H   0.797 -13.630  -5.159 1.00 . A A . 32 LYS HB3  1 1 
        2  1567 1 1 32 LYS HD2  H   0.836 -16.022  -5.472 1.00 . A A . 32 LYS HD2  1 1 
        2  1568 1 1 32 LYS HD3  H   0.815 -16.081  -3.708 1.00 . A A . 32 LYS HD3  1 1 
        2  1569 1 1 32 LYS HE2  H  -1.041 -17.594  -3.719 1.00 . A A . 32 LYS HE2  1 1 
        2  1570 1 1 32 LYS HE3  H  -1.245 -17.410  -5.460 1.00 . A A . 32 LYS HE3  1 1 
        2  1571 1 1 32 LYS HG2  H  -1.419 -15.049  -3.719 1.00 . A A . 32 LYS HG2  1 1 
        2  1572 1 1 32 LYS HG3  H  -1.351 -14.948  -5.480 1.00 . A A . 32 LYS HG3  1 1 
        2  1573 1 1 32 LYS HZ1  H   1.202 -18.275  -5.482 1.00 . A A . 32 LYS HZ1  1 1 
        2  1574 1 1 32 LYS HZ2  H  -0.091 -19.359  -5.359 1.00 . A A . 32 LYS HZ2  1 1 
        2  1575 1 1 32 LYS HZ3  H   0.780 -18.923  -3.976 1.00 . A A . 32 LYS HZ3  1 1 
        2  1576 1 1 32 LYS N    N  -0.596 -12.943  -2.177 1.00 . A A . 32 LYS N    1 1 
        2  1577 1 1 32 LYS NZ   N   0.406 -18.579  -4.883 1.00 . A A . 32 LYS NZ   1 1 
        2  1578 1 1 32 LYS O    O   2.726 -12.474  -3.356 1.00 . A A . 32 LYS O    1 1 
        2  1579 1 1 33 TRP C    C   2.938  -9.819  -1.817 1.00 . A A . 33 TRP C    1 1 
        2  1580 1 1 33 TRP CA   C   1.979  -9.829  -3.004 1.00 . A A . 33 TRP CA   1 1 
        2  1581 1 1 33 TRP CB   C   1.124  -8.573  -3.011 1.00 . A A . 33 TRP CB   1 1 
        2  1582 1 1 33 TRP CD1  C   0.628  -9.031  -5.447 1.00 . A A . 33 TRP CD1  1 1 
        2  1583 1 1 33 TRP CD2  C  -0.672  -7.469  -4.544 1.00 . A A . 33 TRP CD2  1 1 
        2  1584 1 1 33 TRP CE2  C  -1.038  -7.622  -5.893 1.00 . A A . 33 TRP CE2  1 1 
        2  1585 1 1 33 TRP CE3  C  -1.353  -6.543  -3.761 1.00 . A A . 33 TRP CE3  1 1 
        2  1586 1 1 33 TRP CG   C   0.402  -8.370  -4.293 1.00 . A A . 33 TRP CG   1 1 
        2  1587 1 1 33 TRP CH2  C  -2.715  -5.976  -5.683 1.00 . A A . 33 TRP CH2  1 1 
        2  1588 1 1 33 TRP CZ2  C  -2.059  -6.880  -6.476 1.00 . A A . 33 TRP CZ2  1 1 
        2  1589 1 1 33 TRP CZ3  C  -2.371  -5.804  -4.335 1.00 . A A . 33 TRP CZ3  1 1 
        2  1590 1 1 33 TRP H    H   0.147 -10.828  -2.790 1.00 . A A . 33 TRP H    1 1 
        2  1591 1 1 33 TRP HA   H   2.546  -9.876  -3.921 1.00 . A A . 33 TRP HA   1 1 
        2  1592 1 1 33 TRP HB2  H   0.386  -8.662  -2.244 1.00 . A A . 33 TRP HB2  1 1 
        2  1593 1 1 33 TRP HB3  H   1.743  -7.714  -2.827 1.00 . A A . 33 TRP HB3  1 1 
        2  1594 1 1 33 TRP HD1  H   1.380  -9.788  -5.554 1.00 . A A . 33 TRP HD1  1 1 
        2  1595 1 1 33 TRP HE1  H  -0.249  -8.906  -7.352 1.00 . A A . 33 TRP HE1  1 1 
        2  1596 1 1 33 TRP HE3  H  -1.099  -6.407  -2.720 1.00 . A A . 33 TRP HE3  1 1 
        2  1597 1 1 33 TRP HH2  H  -3.517  -5.378  -6.092 1.00 . A A . 33 TRP HH2  1 1 
        2  1598 1 1 33 TRP HZ2  H  -2.334  -7.004  -7.513 1.00 . A A . 33 TRP HZ2  1 1 
        2  1599 1 1 33 TRP HZ3  H  -2.910  -5.080  -3.743 1.00 . A A . 33 TRP HZ3  1 1 
        2  1600 1 1 33 TRP N    N   1.099 -10.978  -2.956 1.00 . A A . 33 TRP N    1 1 
        2  1601 1 1 33 TRP NE1  N  -0.225  -8.586  -6.427 1.00 . A A . 33 TRP NE1  1 1 
        2  1602 1 1 33 TRP O    O   4.147  -9.658  -1.983 1.00 . A A . 33 TRP O    1 1 
        2  1603 1 1 34 ILE C    C   3.909 -11.350   0.761 1.00 . A A . 34 ILE C    1 1 
        2  1604 1 1 34 ILE CA   C   3.194 -10.012   0.595 1.00 . A A . 34 ILE CA   1 1 
        2  1605 1 1 34 ILE CB   C   2.332  -9.745   1.844 1.00 . A A . 34 ILE CB   1 1 
        2  1606 1 1 34 ILE CD1  C   0.019  -8.707   2.078 1.00 . A A . 34 ILE CD1  1 1 
        2  1607 1 1 34 ILE CG1  C   1.452  -8.509   1.633 1.00 . A A . 34 ILE CG1  1 1 
        2  1608 1 1 34 ILE CG2  C   3.215  -9.569   3.073 1.00 . A A . 34 ILE CG2  1 1 
        2  1609 1 1 34 ILE H    H   1.420 -10.122  -0.554 1.00 . A A . 34 ILE H    1 1 
        2  1610 1 1 34 ILE HA   H   3.932  -9.228   0.517 1.00 . A A . 34 ILE HA   1 1 
        2  1611 1 1 34 ILE HB   H   1.701 -10.604   2.008 1.00 . A A . 34 ILE HB   1 1 
        2  1612 1 1 34 ILE HD11 H   0.005  -9.143   3.067 1.00 . A A . 34 ILE HD11 1 1 
        2  1613 1 1 34 ILE HD12 H  -0.487  -9.365   1.388 1.00 . A A . 34 ILE HD12 1 1 
        2  1614 1 1 34 ILE HD13 H  -0.486  -7.752   2.100 1.00 . A A . 34 ILE HD13 1 1 
        2  1615 1 1 34 ILE HG12 H   1.861  -7.682   2.193 1.00 . A A . 34 ILE HG12 1 1 
        2  1616 1 1 34 ILE HG13 H   1.440  -8.257   0.583 1.00 . A A . 34 ILE HG13 1 1 
        2  1617 1 1 34 ILE HG21 H   4.214  -9.911   2.851 1.00 . A A . 34 ILE HG21 1 1 
        2  1618 1 1 34 ILE HG22 H   2.811 -10.145   3.892 1.00 . A A . 34 ILE HG22 1 1 
        2  1619 1 1 34 ILE HG23 H   3.246  -8.525   3.348 1.00 . A A . 34 ILE HG23 1 1 
        2  1620 1 1 34 ILE N    N   2.390  -9.997  -0.620 1.00 . A A . 34 ILE N    1 1 
        2  1621 1 1 34 ILE O    O   4.953 -11.432   1.408 1.00 . A A . 34 ILE O    1 1 
        2  1622 1 1 35 HIS C    C   5.324 -13.753  -0.340 1.00 . A A . 35 HIS C    1 1 
        2  1623 1 1 35 HIS CA   C   3.923 -13.732   0.253 1.00 . A A . 35 HIS CA   1 1 
        2  1624 1 1 35 HIS CB   C   3.031 -14.737  -0.476 1.00 . A A . 35 HIS CB   1 1 
        2  1625 1 1 35 HIS CD2  C   1.411 -16.644   0.203 1.00 . A A . 35 HIS CD2  1 1 
        2  1626 1 1 35 HIS CE1  C   1.109 -16.079   2.300 1.00 . A A . 35 HIS CE1  1 1 
        2  1627 1 1 35 HIS CG   C   2.144 -15.530   0.434 1.00 . A A . 35 HIS CG   1 1 
        2  1628 1 1 35 HIS H    H   2.509 -12.274  -0.330 1.00 . A A . 35 HIS H    1 1 
        2  1629 1 1 35 HIS HA   H   3.983 -14.004   1.292 1.00 . A A . 35 HIS HA   1 1 
        2  1630 1 1 35 HIS HB2  H   2.399 -14.207  -1.173 1.00 . A A . 35 HIS HB2  1 1 
        2  1631 1 1 35 HIS HB3  H   3.654 -15.429  -1.020 1.00 . A A . 35 HIS HB3  1 1 
        2  1632 1 1 35 HIS HD1  H   2.325 -14.437   2.228 1.00 . A A . 35 HIS HD1  1 1 
        2  1633 1 1 35 HIS HD2  H   1.338 -17.180  -0.733 1.00 . A A . 35 HIS HD2  1 1 
        2  1634 1 1 35 HIS HE1  H   0.762 -16.074   3.324 1.00 . A A . 35 HIS HE1  1 1 
        2  1635 1 1 35 HIS HE2  H   0.106 -17.672   1.488 1.00 . A A . 35 HIS HE2  1 1 
        2  1636 1 1 35 HIS N    N   3.341 -12.399   0.172 1.00 . A A . 35 HIS N    1 1 
        2  1637 1 1 35 HIS ND1  N   1.932 -15.202   1.757 1.00 . A A . 35 HIS ND1  1 1 
        2  1638 1 1 35 HIS NE2  N   0.778 -16.965   1.378 1.00 . A A . 35 HIS NE2  1 1 
        2  1639 1 1 35 HIS O    O   6.176 -14.542   0.071 1.00 . A A . 35 HIS O    1 1 
        2  1640 1 1 36 ALA C    C   7.564 -11.484  -1.634 1.00 . A A . 36 ALA C    1 1 
        2  1641 1 1 36 ALA CA   C   6.850 -12.791  -1.972 1.00 . A A . 36 ALA CA   1 1 
        2  1642 1 1 36 ALA CB   C   6.677 -12.925  -3.476 1.00 . A A . 36 ALA CB   1 1 
        2  1643 1 1 36 ALA H    H   4.831 -12.284  -1.589 1.00 . A A . 36 ALA H    1 1 
        2  1644 1 1 36 ALA HA   H   7.454 -13.618  -1.630 1.00 . A A . 36 ALA HA   1 1 
        2  1645 1 1 36 ALA HB1  H   5.900 -13.644  -3.688 1.00 . A A . 36 ALA HB1  1 1 
        2  1646 1 1 36 ALA HB2  H   7.605 -13.257  -3.916 1.00 . A A . 36 ALA HB2  1 1 
        2  1647 1 1 36 ALA HB3  H   6.403 -11.967  -3.893 1.00 . A A . 36 ALA HB3  1 1 
        2  1648 1 1 36 ALA N    N   5.553 -12.881  -1.310 1.00 . A A . 36 ALA N    1 1 
        2  1649 1 1 36 ALA O    O   8.610 -11.175  -2.202 1.00 . A A . 36 ALA O    1 1 
        2  1650 1 1 37 GLY C    C   7.599  -8.440  -1.439 1.00 . A A . 37 GLY C    1 1 
        2  1651 1 1 37 GLY CA   C   7.600  -9.457  -0.315 1.00 . A A . 37 GLY CA   1 1 
        2  1652 1 1 37 GLY H    H   6.162 -11.010  -0.281 1.00 . A A . 37 GLY H    1 1 
        2  1653 1 1 37 GLY HA2  H   7.052  -9.053   0.523 1.00 . A A . 37 GLY HA2  1 1 
        2  1654 1 1 37 GLY HA3  H   8.620  -9.640  -0.010 1.00 . A A . 37 GLY HA3  1 1 
        2  1655 1 1 37 GLY N    N   6.996 -10.717  -0.705 1.00 . A A . 37 GLY N    1 1 
        2  1656 1 1 37 GLY O    O   8.638  -7.862  -1.762 1.00 . A A . 37 GLY O    1 1 
        2  1657 1 1 38 ARG C    C   6.436  -5.832  -2.615 1.00 . A A . 38 ARG C    1 1 
        2  1658 1 1 38 ARG CA   C   6.302  -7.263  -3.127 1.00 . A A . 38 ARG CA   1 1 
        2  1659 1 1 38 ARG CB   C   4.956  -7.441  -3.832 1.00 . A A . 38 ARG CB   1 1 
        2  1660 1 1 38 ARG CD   C   3.741  -8.419  -5.802 1.00 . A A . 38 ARG CD   1 1 
        2  1661 1 1 38 ARG CG   C   4.971  -8.508  -4.913 1.00 . A A . 38 ARG CG   1 1 
        2  1662 1 1 38 ARG CZ   C   4.619  -8.072  -8.078 1.00 . A A . 38 ARG CZ   1 1 
        2  1663 1 1 38 ARG H    H   5.640  -8.709  -1.730 1.00 . A A . 38 ARG H    1 1 
        2  1664 1 1 38 ARG HA   H   7.095  -7.455  -3.833 1.00 . A A . 38 ARG HA   1 1 
        2  1665 1 1 38 ARG HB2  H   4.212  -7.714  -3.097 1.00 . A A . 38 ARG HB2  1 1 
        2  1666 1 1 38 ARG HB3  H   4.673  -6.503  -4.286 1.00 . A A . 38 ARG HB3  1 1 
        2  1667 1 1 38 ARG HD2  H   3.455  -9.415  -6.101 1.00 . A A . 38 ARG HD2  1 1 
        2  1668 1 1 38 ARG HD3  H   2.937  -7.968  -5.237 1.00 . A A . 38 ARG HD3  1 1 
        2  1669 1 1 38 ARG HE   H   3.665  -6.692  -6.997 1.00 . A A . 38 ARG HE   1 1 
        2  1670 1 1 38 ARG HG2  H   5.853  -8.378  -5.521 1.00 . A A . 38 ARG HG2  1 1 
        2  1671 1 1 38 ARG HG3  H   4.995  -9.482  -4.443 1.00 . A A . 38 ARG HG3  1 1 
        2  1672 1 1 38 ARG HH11 H   4.939  -9.924  -7.330 1.00 . A A . 38 ARG HH11 1 1 
        2  1673 1 1 38 ARG HH12 H   5.543  -9.655  -8.931 1.00 . A A . 38 ARG HH12 1 1 
        2  1674 1 1 38 ARG HH21 H   4.459  -6.337  -9.102 1.00 . A A . 38 ARG HH21 1 1 
        2  1675 1 1 38 ARG HH22 H   5.274  -7.618  -9.936 1.00 . A A . 38 ARG HH22 1 1 
        2  1676 1 1 38 ARG N    N   6.433  -8.219  -2.034 1.00 . A A . 38 ARG N    1 1 
        2  1677 1 1 38 ARG NE   N   3.988  -7.617  -6.998 1.00 . A A . 38 ARG NE   1 1 
        2  1678 1 1 38 ARG NH1  N   5.071  -9.320  -8.115 1.00 . A A . 38 ARG NH1  1 1 
        2  1679 1 1 38 ARG NH2  N   4.798  -7.277  -9.125 1.00 . A A . 38 ARG NH2  1 1 
        2  1680 1 1 38 ARG O    O   5.568  -5.336  -1.897 1.00 . A A . 38 ARG O    1 1 
        2  1681 1 1 39 LYS C    C   6.774  -2.843  -3.212 1.00 . A A . 39 LYS C    1 1 
        2  1682 1 1 39 LYS CA   C   7.772  -3.799  -2.567 1.00 . A A . 39 LYS CA   1 1 
        2  1683 1 1 39 LYS CB   C   9.201  -3.381  -2.921 1.00 . A A . 39 LYS CB   1 1 
        2  1684 1 1 39 LYS CD   C  11.606  -3.800  -2.327 1.00 . A A . 39 LYS CD   1 1 
        2  1685 1 1 39 LYS CE   C  12.411  -2.512  -2.261 1.00 . A A . 39 LYS CE   1 1 
        2  1686 1 1 39 LYS CG   C  10.196  -3.603  -1.793 1.00 . A A . 39 LYS CG   1 1 
        2  1687 1 1 39 LYS H    H   8.183  -5.622  -3.563 1.00 . A A . 39 LYS H    1 1 
        2  1688 1 1 39 LYS HA   H   7.650  -3.757  -1.494 1.00 . A A . 39 LYS HA   1 1 
        2  1689 1 1 39 LYS HB2  H   9.529  -3.950  -3.779 1.00 . A A . 39 LYS HB2  1 1 
        2  1690 1 1 39 LYS HB3  H   9.205  -2.330  -3.173 1.00 . A A . 39 LYS HB3  1 1 
        2  1691 1 1 39 LYS HD2  H  12.103  -4.553  -1.734 1.00 . A A . 39 LYS HD2  1 1 
        2  1692 1 1 39 LYS HD3  H  11.550  -4.128  -3.355 1.00 . A A . 39 LYS HD3  1 1 
        2  1693 1 1 39 LYS HE2  H  12.382  -2.034  -3.229 1.00 . A A . 39 LYS HE2  1 1 
        2  1694 1 1 39 LYS HE3  H  11.963  -1.860  -1.526 1.00 . A A . 39 LYS HE3  1 1 
        2  1695 1 1 39 LYS HG2  H  10.186  -2.743  -1.141 1.00 . A A . 39 LYS HG2  1 1 
        2  1696 1 1 39 LYS HG3  H   9.906  -4.483  -1.238 1.00 . A A . 39 LYS HG3  1 1 
        2  1697 1 1 39 LYS HZ1  H  14.188  -1.982  -1.298 1.00 . A A . 39 LYS HZ1  1 1 
        2  1698 1 1 39 LYS HZ2  H  14.418  -2.833  -2.742 1.00 . A A . 39 LYS HZ2  1 1 
        2  1699 1 1 39 LYS HZ3  H  13.908  -3.651  -1.352 1.00 . A A . 39 LYS HZ3  1 1 
        2  1700 1 1 39 LYS N    N   7.528  -5.174  -2.990 1.00 . A A . 39 LYS N    1 1 
        2  1701 1 1 39 LYS NZ   N  13.831  -2.762  -1.887 1.00 . A A . 39 LYS NZ   1 1 
        2  1702 1 1 39 LYS O    O   7.105  -2.125  -4.155 1.00 . A A . 39 LYS O    1 1 
        2  1703 1 1 40 ILE C    C   4.117  -0.906  -2.197 1.00 . A A . 40 ILE C    1 1 
        2  1704 1 1 40 ILE CA   C   4.499  -1.973  -3.217 1.00 . A A . 40 ILE CA   1 1 
        2  1705 1 1 40 ILE CB   C   3.240  -2.779  -3.596 1.00 . A A . 40 ILE CB   1 1 
        2  1706 1 1 40 ILE CD1  C   2.402  -4.699  -5.040 1.00 . A A . 40 ILE CD1  1 1 
        2  1707 1 1 40 ILE CG1  C   3.597  -3.892  -4.583 1.00 . A A . 40 ILE CG1  1 1 
        2  1708 1 1 40 ILE CG2  C   2.177  -1.862  -4.186 1.00 . A A . 40 ILE CG2  1 1 
        2  1709 1 1 40 ILE H    H   5.346  -3.435  -1.943 1.00 . A A . 40 ILE H    1 1 
        2  1710 1 1 40 ILE HA   H   4.876  -1.490  -4.107 1.00 . A A . 40 ILE HA   1 1 
        2  1711 1 1 40 ILE HB   H   2.838  -3.221  -2.696 1.00 . A A . 40 ILE HB   1 1 
        2  1712 1 1 40 ILE HD11 H   2.726  -5.461  -5.734 1.00 . A A . 40 ILE HD11 1 1 
        2  1713 1 1 40 ILE HD12 H   1.693  -4.046  -5.527 1.00 . A A . 40 ILE HD12 1 1 
        2  1714 1 1 40 ILE HD13 H   1.934  -5.165  -4.186 1.00 . A A . 40 ILE HD13 1 1 
        2  1715 1 1 40 ILE HG12 H   4.056  -3.455  -5.457 1.00 . A A . 40 ILE HG12 1 1 
        2  1716 1 1 40 ILE HG13 H   4.297  -4.569  -4.114 1.00 . A A . 40 ILE HG13 1 1 
        2  1717 1 1 40 ILE HG21 H   1.777  -1.229  -3.409 1.00 . A A . 40 ILE HG21 1 1 
        2  1718 1 1 40 ILE HG22 H   1.382  -2.458  -4.609 1.00 . A A . 40 ILE HG22 1 1 
        2  1719 1 1 40 ILE HG23 H   2.617  -1.250  -4.960 1.00 . A A . 40 ILE HG23 1 1 
        2  1720 1 1 40 ILE N    N   5.549  -2.840  -2.695 1.00 . A A . 40 ILE N    1 1 
        2  1721 1 1 40 ILE O    O   4.359  -1.062  -1.001 1.00 . A A . 40 ILE O    1 1 
        2  1722 1 1 41 PHE C    C   1.765   1.851  -2.267 1.00 . A A . 41 PHE C    1 1 
        2  1723 1 1 41 PHE CA   C   3.093   1.264  -1.805 1.00 . A A . 41 PHE CA   1 1 
        2  1724 1 1 41 PHE CB   C   4.158   2.363  -1.763 1.00 . A A . 41 PHE CB   1 1 
        2  1725 1 1 41 PHE CD1  C   6.365   1.174  -1.837 1.00 . A A . 41 PHE CD1  1 1 
        2  1726 1 1 41 PHE CD2  C   5.739   2.277   0.185 1.00 . A A . 41 PHE CD2  1 1 
        2  1727 1 1 41 PHE CE1  C   7.553   0.775  -1.252 1.00 . A A . 41 PHE CE1  1 1 
        2  1728 1 1 41 PHE CE2  C   6.923   1.879   0.772 1.00 . A A . 41 PHE CE2  1 1 
        2  1729 1 1 41 PHE CG   C   5.446   1.929  -1.125 1.00 . A A . 41 PHE CG   1 1 
        2  1730 1 1 41 PHE CZ   C   7.832   1.127   0.053 1.00 . A A . 41 PHE CZ   1 1 
        2  1731 1 1 41 PHE H    H   3.345   0.243  -3.642 1.00 . A A . 41 PHE H    1 1 
        2  1732 1 1 41 PHE HA   H   2.968   0.858  -0.813 1.00 . A A . 41 PHE HA   1 1 
        2  1733 1 1 41 PHE HB2  H   4.376   2.680  -2.771 1.00 . A A . 41 PHE HB2  1 1 
        2  1734 1 1 41 PHE HB3  H   3.773   3.205  -1.201 1.00 . A A . 41 PHE HB3  1 1 
        2  1735 1 1 41 PHE HD1  H   6.148   0.900  -2.858 1.00 . A A . 41 PHE HD1  1 1 
        2  1736 1 1 41 PHE HD2  H   5.028   2.863   0.747 1.00 . A A . 41 PHE HD2  1 1 
        2  1737 1 1 41 PHE HE1  H   8.261   0.186  -1.818 1.00 . A A . 41 PHE HE1  1 1 
        2  1738 1 1 41 PHE HE2  H   7.139   2.155   1.794 1.00 . A A . 41 PHE HE2  1 1 
        2  1739 1 1 41 PHE HZ   H   8.760   0.814   0.512 1.00 . A A . 41 PHE HZ   1 1 
        2  1740 1 1 41 PHE N    N   3.514   0.176  -2.679 1.00 . A A . 41 PHE N    1 1 
        2  1741 1 1 41 PHE O    O   1.633   2.287  -3.411 1.00 . A A . 41 PHE O    1 1 
        2  1742 1 1 42 LEU C    C  -0.656   3.846  -1.233 1.00 . A A . 42 LEU C    1 1 
        2  1743 1 1 42 LEU CA   C  -0.531   2.399  -1.691 1.00 . A A . 42 LEU CA   1 1 
        2  1744 1 1 42 LEU CB   C  -1.627   1.550  -1.045 1.00 . A A . 42 LEU CB   1 1 
        2  1745 1 1 42 LEU CD1  C  -0.372  -0.176   0.291 1.00 . A A . 42 LEU CD1  1 1 
        2  1746 1 1 42 LEU CD2  C  -0.748   2.116   1.247 1.00 . A A . 42 LEU CD2  1 1 
        2  1747 1 1 42 LEU CG   C  -1.315   1.017   0.357 1.00 . A A . 42 LEU CG   1 1 
        2  1748 1 1 42 LEU H    H   0.946   1.504  -0.476 1.00 . A A . 42 LEU H    1 1 
        2  1749 1 1 42 LEU HA   H  -0.650   2.365  -2.764 1.00 . A A . 42 LEU HA   1 1 
        2  1750 1 1 42 LEU HB2  H  -2.524   2.148  -0.984 1.00 . A A . 42 LEU HB2  1 1 
        2  1751 1 1 42 LEU HB3  H  -1.824   0.706  -1.689 1.00 . A A . 42 LEU HB3  1 1 
        2  1752 1 1 42 LEU HD11 H   0.038  -0.256  -0.707 1.00 . A A . 42 LEU HD11 1 1 
        2  1753 1 1 42 LEU HD12 H  -0.916  -1.077   0.529 1.00 . A A . 42 LEU HD12 1 1 
        2  1754 1 1 42 LEU HD13 H   0.430  -0.042   0.999 1.00 . A A . 42 LEU HD13 1 1 
        2  1755 1 1 42 LEU HD21 H  -0.884   1.843   2.283 1.00 . A A . 42 LEU HD21 1 1 
        2  1756 1 1 42 LEU HD22 H  -1.269   3.042   1.050 1.00 . A A . 42 LEU HD22 1 1 
        2  1757 1 1 42 LEU HD23 H   0.302   2.245   1.043 1.00 . A A . 42 LEU HD23 1 1 
        2  1758 1 1 42 LEU HG   H  -2.230   0.677   0.802 1.00 . A A . 42 LEU HG   1 1 
        2  1759 1 1 42 LEU N    N   0.783   1.862  -1.373 1.00 . A A . 42 LEU N    1 1 
        2  1760 1 1 42 LEU O    O   0.004   4.266  -0.282 1.00 . A A . 42 LEU O    1 1 
        2  1761 1 1 43 THR C    C  -3.159   6.238  -1.120 1.00 . A A . 43 THR C    1 1 
        2  1762 1 1 43 THR CA   C  -1.723   6.005  -1.577 1.00 . A A . 43 THR CA   1 1 
        2  1763 1 1 43 THR CB   C  -1.406   6.897  -2.778 1.00 . A A . 43 THR CB   1 1 
        2  1764 1 1 43 THR CG2  C  -1.298   8.364  -2.422 1.00 . A A . 43 THR CG2  1 1 
        2  1765 1 1 43 THR H    H  -2.006   4.211  -2.662 1.00 . A A . 43 THR H    1 1 
        2  1766 1 1 43 THR HA   H  -1.056   6.257  -0.767 1.00 . A A . 43 THR HA   1 1 
        2  1767 1 1 43 THR HB   H  -2.193   6.790  -3.509 1.00 . A A . 43 THR HB   1 1 
        2  1768 1 1 43 THR HG1  H  -0.202   6.732  -4.314 1.00 . A A . 43 THR HG1  1 1 
        2  1769 1 1 43 THR HG21 H  -0.269   8.605  -2.200 1.00 . A A . 43 THR HG21 1 1 
        2  1770 1 1 43 THR HG22 H  -1.912   8.571  -1.559 1.00 . A A . 43 THR HG22 1 1 
        2  1771 1 1 43 THR HG23 H  -1.636   8.961  -3.257 1.00 . A A . 43 THR HG23 1 1 
        2  1772 1 1 43 THR N    N  -1.509   4.604  -1.914 1.00 . A A . 43 THR N    1 1 
        2  1773 1 1 43 THR O    O  -4.104   6.041  -1.886 1.00 . A A . 43 THR O    1 1 
        2  1774 1 1 43 THR OG1  O  -0.184   6.509  -3.381 1.00 . A A . 43 THR OG1  1 1 
        2  1775 1 1 44 ILE C    C  -5.063   8.361   0.434 1.00 . A A . 44 ILE C    1 1 
        2  1776 1 1 44 ILE CA   C  -4.636   6.920   0.690 1.00 . A A . 44 ILE CA   1 1 
        2  1777 1 1 44 ILE CB   C  -4.671   6.647   2.206 1.00 . A A . 44 ILE CB   1 1 
        2  1778 1 1 44 ILE CD1  C  -3.854   5.022   3.985 1.00 . A A . 44 ILE CD1  1 1 
        2  1779 1 1 44 ILE CG1  C  -4.096   5.263   2.512 1.00 . A A . 44 ILE CG1  1 1 
        2  1780 1 1 44 ILE CG2  C  -6.094   6.764   2.734 1.00 . A A . 44 ILE CG2  1 1 
        2  1781 1 1 44 ILE H    H  -2.522   6.797   0.692 1.00 . A A . 44 ILE H    1 1 
        2  1782 1 1 44 ILE HA   H  -5.339   6.255   0.209 1.00 . A A . 44 ILE HA   1 1 
        2  1783 1 1 44 ILE HB   H  -4.068   7.396   2.698 1.00 . A A . 44 ILE HB   1 1 
        2  1784 1 1 44 ILE HD11 H  -3.022   5.627   4.318 1.00 . A A . 44 ILE HD11 1 1 
        2  1785 1 1 44 ILE HD12 H  -3.627   3.979   4.147 1.00 . A A . 44 ILE HD12 1 1 
        2  1786 1 1 44 ILE HD13 H  -4.740   5.288   4.545 1.00 . A A . 44 ILE HD13 1 1 
        2  1787 1 1 44 ILE HG12 H  -4.786   4.508   2.163 1.00 . A A . 44 ILE HG12 1 1 
        2  1788 1 1 44 ILE HG13 H  -3.154   5.149   1.996 1.00 . A A . 44 ILE HG13 1 1 
        2  1789 1 1 44 ILE HG21 H  -6.530   5.780   2.813 1.00 . A A . 44 ILE HG21 1 1 
        2  1790 1 1 44 ILE HG22 H  -6.681   7.365   2.055 1.00 . A A . 44 ILE HG22 1 1 
        2  1791 1 1 44 ILE HG23 H  -6.078   7.232   3.707 1.00 . A A . 44 ILE HG23 1 1 
        2  1792 1 1 44 ILE N    N  -3.315   6.660   0.131 1.00 . A A . 44 ILE N    1 1 
        2  1793 1 1 44 ILE O    O  -4.478   9.298   0.977 1.00 . A A . 44 ILE O    1 1 
        2  1794 1 1 45 ASN C    C  -7.497  10.385   0.388 1.00 . A A . 45 ASN C    1 1 
        2  1795 1 1 45 ASN CA   C  -6.591   9.858  -0.722 1.00 . A A . 45 ASN CA   1 1 
        2  1796 1 1 45 ASN CB   C  -7.357   9.825  -2.047 1.00 . A A . 45 ASN CB   1 1 
        2  1797 1 1 45 ASN CG   C  -6.473   9.431  -3.215 1.00 . A A . 45 ASN CG   1 1 
        2  1798 1 1 45 ASN H    H  -6.513   7.742  -0.798 1.00 . A A . 45 ASN H    1 1 
        2  1799 1 1 45 ASN HA   H  -5.744  10.519  -0.823 1.00 . A A . 45 ASN HA   1 1 
        2  1800 1 1 45 ASN HB2  H  -8.162   9.110  -1.973 1.00 . A A . 45 ASN HB2  1 1 
        2  1801 1 1 45 ASN HB3  H  -7.767  10.805  -2.244 1.00 . A A . 45 ASN HB3  1 1 
        2  1802 1 1 45 ASN HD21 H  -7.260   7.602  -3.221 1.00 . A A . 45 ASN HD21 1 1 
        2  1803 1 1 45 ASN HD22 H  -6.042   7.908  -4.422 1.00 . A A . 45 ASN HD22 1 1 
        2  1804 1 1 45 ASN N    N  -6.088   8.529  -0.396 1.00 . A A . 45 ASN N    1 1 
        2  1805 1 1 45 ASN ND2  N  -6.604   8.189  -3.665 1.00 . A A . 45 ASN ND2  1 1 
        2  1806 1 1 45 ASN O    O  -7.814   9.667   1.336 1.00 . A A . 45 ASN O    1 1 
        2  1807 1 1 45 ASN OD1  O  -5.679  10.235  -3.706 1.00 . A A . 45 ASN OD1  1 1 
        2  1808 1 1 46 ALA C    C -10.250  11.954   0.987 1.00 . A A . 46 ALA C    1 1 
        2  1809 1 1 46 ALA CA   C  -8.779  12.264   1.256 1.00 . A A . 46 ALA CA   1 1 
        2  1810 1 1 46 ALA CB   C  -8.552  13.768   1.285 1.00 . A A . 46 ALA CB   1 1 
        2  1811 1 1 46 ALA H    H  -7.623  12.164  -0.515 1.00 . A A . 46 ALA H    1 1 
        2  1812 1 1 46 ALA HA   H  -8.511  11.867   2.225 1.00 . A A . 46 ALA HA   1 1 
        2  1813 1 1 46 ALA HB1  H  -7.794  14.004   2.016 1.00 . A A . 46 ALA HB1  1 1 
        2  1814 1 1 46 ALA HB2  H  -9.474  14.267   1.548 1.00 . A A . 46 ALA HB2  1 1 
        2  1815 1 1 46 ALA HB3  H  -8.228  14.100   0.309 1.00 . A A . 46 ALA HB3  1 1 
        2  1816 1 1 46 ALA N    N  -7.909  11.642   0.263 1.00 . A A . 46 ALA N    1 1 
        2  1817 1 1 46 ALA O    O -11.130  12.469   1.670 1.00 . A A . 46 ALA O    1 1 
        2  1818 1 1 47 ASP C    C -12.170   9.310   0.096 1.00 . A A . 47 ASP C    1 1 
        2  1819 1 1 47 ASP CA   C -11.870  10.732  -0.361 1.00 . A A . 47 ASP CA   1 1 
        2  1820 1 1 47 ASP CB   C -12.090  10.849  -1.874 1.00 . A A . 47 ASP CB   1 1 
        2  1821 1 1 47 ASP CG   C -10.800  10.839  -2.673 1.00 . A A . 47 ASP CG   1 1 
        2  1822 1 1 47 ASP H    H  -9.768  10.728  -0.518 1.00 . A A . 47 ASP H    1 1 
        2  1823 1 1 47 ASP HA   H -12.540  11.410   0.144 1.00 . A A . 47 ASP HA   1 1 
        2  1824 1 1 47 ASP HB2  H -12.690  10.017  -2.204 1.00 . A A . 47 ASP HB2  1 1 
        2  1825 1 1 47 ASP HB3  H -12.610  11.773  -2.082 1.00 . A A . 47 ASP HB3  1 1 
        2  1826 1 1 47 ASP N    N -10.500  11.110  -0.009 1.00 . A A . 47 ASP N    1 1 
        2  1827 1 1 47 ASP O    O -13.340   8.921   0.212 1.00 . A A . 47 ASP O    1 1 
        2  1828 1 1 47 ASP OD1  O  -9.989  11.773  -2.501 1.00 . A A . 47 ASP OD1  1 1 
        2  1829 1 1 47 ASP OD2  O -10.600   9.898  -3.470 1.00 . A A . 47 ASP OD2  1 1 
        2  1830 1 1 48 GLY C    C -10.870   6.163  -0.270 1.00 . A A . 48 GLY C    1 1 
        2  1831 1 1 48 GLY CA   C -11.300   7.163   0.786 1.00 . A A . 48 GLY CA   1 1 
        2  1832 1 1 48 GLY H    H -10.220   8.897   0.239 1.00 . A A . 48 GLY H    1 1 
        2  1833 1 1 48 GLY HA2  H -10.710   7.001   1.680 1.00 . A A . 48 GLY HA2  1 1 
        2  1834 1 1 48 GLY HA3  H -12.350   7.001   1.019 1.00 . A A . 48 GLY HA3  1 1 
        2  1835 1 1 48 GLY N    N -11.130   8.535   0.351 1.00 . A A . 48 GLY N    1 1 
        2  1836 1 1 48 GLY O    O -11.190   4.975  -0.172 1.00 . A A . 48 GLY O    1 1 
        2  1837 1 1 49 SER C    C  -8.214   5.449  -2.189 1.00 . A A . 49 SER C    1 1 
        2  1838 1 1 49 SER CA   C  -9.692   5.779  -2.362 1.00 . A A . 49 SER CA   1 1 
        2  1839 1 1 49 SER CB   C  -9.928   6.448  -3.715 1.00 . A A . 49 SER CB   1 1 
        2  1840 1 1 49 SER H    H  -9.944   7.595  -1.310 1.00 . A A . 49 SER H    1 1 
        2  1841 1 1 49 SER HA   H -10.250   4.866  -2.325 1.00 . A A . 49 SER HA   1 1 
        2  1842 1 1 49 SER HB2  H -10.350   7.423  -3.559 1.00 . A A . 49 SER HB2  1 1 
        2  1843 1 1 49 SER HB3  H  -8.987   6.543  -4.233 1.00 . A A . 49 SER HB3  1 1 
        2  1844 1 1 49 SER HG   H -10.310   5.075  -5.059 1.00 . A A . 49 SER HG   1 1 
        2  1845 1 1 49 SER N    N -10.160   6.641  -1.285 1.00 . A A . 49 SER N    1 1 
        2  1846 1 1 49 SER O    O  -7.383   6.342  -2.025 1.00 . A A . 49 SER O    1 1 
        2  1847 1 1 49 SER OG   O -10.810   5.684  -4.515 1.00 . A A . 49 SER OG   1 1 
        2  1848 1 1 50 VAL C    C  -6.050   2.951  -3.313 1.00 . A A . 50 VAL C    1 1 
        2  1849 1 1 50 VAL CA   C  -6.514   3.712  -2.074 1.00 . A A . 50 VAL CA   1 1 
        2  1850 1 1 50 VAL CB   C  -6.342   2.803  -0.840 1.00 . A A . 50 VAL CB   1 1 
        2  1851 1 1 50 VAL CG1  C  -4.899   2.824  -0.363 1.00 . A A . 50 VAL CG1  1 1 
        2  1852 1 1 50 VAL CG2  C  -7.287   3.219   0.279 1.00 . A A . 50 VAL CG2  1 1 
        2  1853 1 1 50 VAL H    H  -8.600   3.496  -2.361 1.00 . A A . 50 VAL H    1 1 
        2  1854 1 1 50 VAL HA   H  -5.890   4.584  -1.943 1.00 . A A . 50 VAL HA   1 1 
        2  1855 1 1 50 VAL HB   H  -6.585   1.790  -1.129 1.00 . A A . 50 VAL HB   1 1 
        2  1856 1 1 50 VAL HG11 H  -4.253   3.097  -1.183 1.00 . A A . 50 VAL HG11 1 1 
        2  1857 1 1 50 VAL HG12 H  -4.624   1.845   0.002 1.00 . A A . 50 VAL HG12 1 1 
        2  1858 1 1 50 VAL HG13 H  -4.795   3.547   0.432 1.00 . A A . 50 VAL HG13 1 1 
        2  1859 1 1 50 VAL HG21 H  -7.638   4.223   0.099 1.00 . A A . 50 VAL HG21 1 1 
        2  1860 1 1 50 VAL HG22 H  -6.764   3.186   1.224 1.00 . A A . 50 VAL HG22 1 1 
        2  1861 1 1 50 VAL HG23 H  -8.128   2.542   0.311 1.00 . A A . 50 VAL HG23 1 1 
        2  1862 1 1 50 VAL N    N  -7.893   4.161  -2.227 1.00 . A A . 50 VAL N    1 1 
        2  1863 1 1 50 VAL O    O  -6.688   1.988  -3.735 1.00 . A A . 50 VAL O    1 1 
        2  1864 1 1 51 TYR C    C  -2.939   2.336  -4.867 1.00 . A A . 51 TYR C    1 1 
        2  1865 1 1 51 TYR CA   C  -4.392   2.742  -5.082 1.00 . A A . 51 TYR CA   1 1 
        2  1866 1 1 51 TYR CB   C  -4.507   3.670  -6.294 1.00 . A A . 51 TYR CB   1 1 
        2  1867 1 1 51 TYR CD1  C  -2.365   4.982  -6.557 1.00 . A A . 51 TYR CD1  1 1 
        2  1868 1 1 51 TYR CD2  C  -4.271   6.104  -5.666 1.00 . A A . 51 TYR CD2  1 1 
        2  1869 1 1 51 TYR CE1  C  -1.624   6.143  -6.446 1.00 . A A . 51 TYR CE1  1 1 
        2  1870 1 1 51 TYR CE2  C  -3.536   7.269  -5.553 1.00 . A A . 51 TYR CE2  1 1 
        2  1871 1 1 51 TYR CG   C  -3.698   4.941  -6.168 1.00 . A A . 51 TYR CG   1 1 
        2  1872 1 1 51 TYR CZ   C  -2.214   7.283  -5.945 1.00 . A A . 51 TYR CZ   1 1 
        2  1873 1 1 51 TYR H    H  -4.468   4.162  -3.510 1.00 . A A . 51 TYR H    1 1 
        2  1874 1 1 51 TYR HA   H  -4.976   1.853  -5.267 1.00 . A A . 51 TYR HA   1 1 
        2  1875 1 1 51 TYR HB2  H  -4.162   3.145  -7.173 1.00 . A A . 51 TYR HB2  1 1 
        2  1876 1 1 51 TYR HB3  H  -5.542   3.946  -6.429 1.00 . A A . 51 TYR HB3  1 1 
        2  1877 1 1 51 TYR HD1  H  -1.906   4.087  -6.949 1.00 . A A . 51 TYR HD1  1 1 
        2  1878 1 1 51 TYR HD2  H  -5.306   6.090  -5.359 1.00 . A A . 51 TYR HD2  1 1 
        2  1879 1 1 51 TYR HE1  H  -0.589   6.154  -6.753 1.00 . A A . 51 TYR HE1  1 1 
        2  1880 1 1 51 TYR HE2  H  -3.999   8.163  -5.160 1.00 . A A . 51 TYR HE2  1 1 
        2  1881 1 1 51 TYR HH   H  -0.578   8.228  -5.583 1.00 . A A . 51 TYR HH   1 1 
        2  1882 1 1 51 TYR N    N  -4.936   3.388  -3.892 1.00 . A A . 51 TYR N    1 1 
        2  1883 1 1 51 TYR O    O  -2.118   3.137  -4.420 1.00 . A A . 51 TYR O    1 1 
        2  1884 1 1 51 TYR OH   O  -1.480   8.443  -5.834 1.00 . A A . 51 TYR OH   1 1 
        2  1885 1 1 52 ALA C    C  -0.406   0.898  -6.230 1.00 . A A . 52 ALA C    1 1 
        2  1886 1 1 52 ALA CA   C  -1.275   0.563  -5.024 1.00 . A A . 52 ALA CA   1 1 
        2  1887 1 1 52 ALA CB   C  -1.311  -0.941  -4.802 1.00 . A A . 52 ALA CB   1 1 
        2  1888 1 1 52 ALA H    H  -3.328   0.491  -5.532 1.00 . A A . 52 ALA H    1 1 
        2  1889 1 1 52 ALA HA   H  -0.846   1.021  -4.145 1.00 . A A . 52 ALA HA   1 1 
        2  1890 1 1 52 ALA HB1  H  -1.466  -1.149  -3.753 1.00 . A A . 52 ALA HB1  1 1 
        2  1891 1 1 52 ALA HB2  H  -0.374  -1.374  -5.119 1.00 . A A . 52 ALA HB2  1 1 
        2  1892 1 1 52 ALA HB3  H  -2.118  -1.371  -5.377 1.00 . A A . 52 ALA HB3  1 1 
        2  1893 1 1 52 ALA N    N  -2.629   1.082  -5.185 1.00 . A A . 52 ALA N    1 1 
        2  1894 1 1 52 ALA O    O  -0.691   0.476  -7.349 1.00 . A A . 52 ALA O    1 1 
        2  1895 1 1 53 GLU C    C   2.786   1.114  -7.089 1.00 . A A . 53 GLU C    1 1 
        2  1896 1 1 53 GLU CA   C   1.576   2.042  -7.054 1.00 . A A . 53 GLU CA   1 1 
        2  1897 1 1 53 GLU CB   C   2.031   3.491  -6.863 1.00 . A A . 53 GLU CB   1 1 
        2  1898 1 1 53 GLU CD   C   1.901   5.872  -7.699 1.00 . A A . 53 GLU CD   1 1 
        2  1899 1 1 53 GLU CG   C   1.317   4.475  -7.774 1.00 . A A . 53 GLU CG   1 1 
        2  1900 1 1 53 GLU H    H   0.836   1.957  -5.075 1.00 . A A . 53 GLU H    1 1 
        2  1901 1 1 53 GLU HA   H   1.047   1.962  -7.993 1.00 . A A . 53 GLU HA   1 1 
        2  1902 1 1 53 GLU HB2  H   1.848   3.782  -5.841 1.00 . A A . 53 GLU HB2  1 1 
        2  1903 1 1 53 GLU HB3  H   3.092   3.555  -7.061 1.00 . A A . 53 GLU HB3  1 1 
        2  1904 1 1 53 GLU HG2  H   1.396   4.124  -8.793 1.00 . A A . 53 GLU HG2  1 1 
        2  1905 1 1 53 GLU HG3  H   0.277   4.519  -7.489 1.00 . A A . 53 GLU HG3  1 1 
        2  1906 1 1 53 GLU N    N   0.660   1.656  -5.990 1.00 . A A . 53 GLU N    1 1 
        2  1907 1 1 53 GLU O    O   3.426   0.873  -6.066 1.00 . A A . 53 GLU O    1 1 
        2  1908 1 1 53 GLU OE1  O   2.400   6.249  -6.617 1.00 . A A . 53 GLU OE1  1 1 
        2  1909 1 1 53 GLU OE2  O   1.859   6.590  -8.720 1.00 . A A . 53 GLU OE2  1 1 
        2  1910 1 1 54 GLU C    C   5.473   0.450  -8.862 1.00 . A A . 54 GLU C    1 1 
        2  1911 1 1 54 GLU CA   C   4.221  -0.313  -8.441 1.00 . A A . 54 GLU CA   1 1 
        2  1912 1 1 54 GLU CB   C   3.890  -1.387  -9.480 1.00 . A A . 54 GLU CB   1 1 
        2  1913 1 1 54 GLU CD   C   5.122  -3.209 -10.720 1.00 . A A . 54 GLU CD   1 1 
        2  1914 1 1 54 GLU CG   C   4.758  -2.630  -9.368 1.00 . A A . 54 GLU CG   1 1 
        2  1915 1 1 54 GLU H    H   2.540   0.820  -9.051 1.00 . A A . 54 GLU H    1 1 
        2  1916 1 1 54 GLU HA   H   4.407  -0.790  -7.491 1.00 . A A . 54 GLU HA   1 1 
        2  1917 1 1 54 GLU HB2  H   2.859  -1.684  -9.357 1.00 . A A . 54 GLU HB2  1 1 
        2  1918 1 1 54 GLU HB3  H   4.021  -0.970 -10.467 1.00 . A A . 54 GLU HB3  1 1 
        2  1919 1 1 54 GLU HG2  H   5.668  -2.371  -8.847 1.00 . A A . 54 GLU HG2  1 1 
        2  1920 1 1 54 GLU HG3  H   4.221  -3.379  -8.804 1.00 . A A . 54 GLU HG3  1 1 
        2  1921 1 1 54 GLU N    N   3.090   0.592  -8.273 1.00 . A A . 54 GLU N    1 1 
        2  1922 1 1 54 GLU O    O   5.434   1.269  -9.779 1.00 . A A . 54 GLU O    1 1 
        2  1923 1 1 54 GLU OE1  O   4.217  -3.715 -11.414 1.00 . A A . 54 GLU OE1  1 1 
        2  1924 1 1 54 GLU OE2  O   6.317  -3.157 -11.086 1.00 . A A . 54 GLU OE2  1 1 
        2  1925 1 1 55 VAL C    C   8.522   0.195  -9.695 1.00 . A A . 55 VAL C    1 1 
        2  1926 1 1 55 VAL CA   C   7.847   0.832  -8.483 1.00 . A A . 55 VAL CA   1 1 
        2  1927 1 1 55 VAL CB   C   8.811   0.773  -7.283 1.00 . A A . 55 VAL CB   1 1 
        2  1928 1 1 55 VAL CG1  C  10.015   1.673  -7.515 1.00 . A A . 55 VAL CG1  1 1 
        2  1929 1 1 55 VAL CG2  C   8.089   1.159  -5.999 1.00 . A A . 55 VAL CG2  1 1 
        2  1930 1 1 55 VAL H    H   6.548  -0.490  -7.463 1.00 . A A . 55 VAL H    1 1 
        2  1931 1 1 55 VAL HA   H   7.640   1.869  -8.703 1.00 . A A . 55 VAL HA   1 1 
        2  1932 1 1 55 VAL HB   H   9.163  -0.244  -7.178 1.00 . A A . 55 VAL HB   1 1 
        2  1933 1 1 55 VAL HG11 H   9.703   2.706  -7.488 1.00 . A A . 55 VAL HG11 1 1 
        2  1934 1 1 55 VAL HG12 H  10.447   1.452  -8.480 1.00 . A A . 55 VAL HG12 1 1 
        2  1935 1 1 55 VAL HG13 H  10.749   1.498  -6.742 1.00 . A A . 55 VAL HG13 1 1 
        2  1936 1 1 55 VAL HG21 H   7.212   0.540  -5.879 1.00 . A A . 55 VAL HG21 1 1 
        2  1937 1 1 55 VAL HG22 H   7.794   2.196  -6.051 1.00 . A A . 55 VAL HG22 1 1 
        2  1938 1 1 55 VAL HG23 H   8.749   1.013  -5.157 1.00 . A A . 55 VAL HG23 1 1 
        2  1939 1 1 55 VAL N    N   6.581   0.174  -8.182 1.00 . A A . 55 VAL N    1 1 
        2  1940 1 1 55 VAL O    O   8.368  -1.000  -9.946 1.00 . A A . 55 VAL O    1 1 
        2  1941 1 1 56 LYS C    C  11.479   0.637 -11.467 1.00 . A A . 56 LYS C    1 1 
        2  1942 1 1 56 LYS CA   C   9.965   0.514 -11.630 1.00 . A A . 56 LYS CA   1 1 
        2  1943 1 1 56 LYS CB   C   9.511   1.293 -12.867 1.00 . A A . 56 LYS CB   1 1 
        2  1944 1 1 56 LYS CD   C  10.356   1.337 -15.235 1.00 . A A . 56 LYS CD   1 1 
        2  1945 1 1 56 LYS CE   C  10.605   0.520 -16.492 1.00 . A A . 56 LYS CE   1 1 
        2  1946 1 1 56 LYS CG   C   9.661   0.513 -14.163 1.00 . A A . 56 LYS CG   1 1 
        2  1947 1 1 56 LYS H    H   9.353   1.945 -10.193 1.00 . A A . 56 LYS H    1 1 
        2  1948 1 1 56 LYS HA   H   9.712  -0.527 -11.758 1.00 . A A . 56 LYS HA   1 1 
        2  1949 1 1 56 LYS HB2  H   8.470   1.557 -12.748 1.00 . A A . 56 LYS HB2  1 1 
        2  1950 1 1 56 LYS HB3  H  10.097   2.197 -12.944 1.00 . A A . 56 LYS HB3  1 1 
        2  1951 1 1 56 LYS HD2  H   9.735   2.183 -15.485 1.00 . A A . 56 LYS HD2  1 1 
        2  1952 1 1 56 LYS HD3  H  11.303   1.686 -14.849 1.00 . A A . 56 LYS HD3  1 1 
        2  1953 1 1 56 LYS HE2  H  11.438  -0.145 -16.315 1.00 . A A . 56 LYS HE2  1 1 
        2  1954 1 1 56 LYS HE3  H   9.721  -0.064 -16.708 1.00 . A A . 56 LYS HE3  1 1 
        2  1955 1 1 56 LYS HG2  H  10.244  -0.375 -13.972 1.00 . A A . 56 LYS HG2  1 1 
        2  1956 1 1 56 LYS HG3  H   8.680   0.232 -14.517 1.00 . A A . 56 LYS HG3  1 1 
        2  1957 1 1 56 LYS HZ1  H  11.616   0.917 -18.277 1.00 . A A . 56 LYS HZ1  1 1 
        2  1958 1 1 56 LYS HZ2  H  11.303   2.294 -17.346 1.00 . A A . 56 LYS HZ2  1 1 
        2  1959 1 1 56 LYS HZ3  H  10.052   1.561 -18.216 1.00 . A A . 56 LYS HZ3  1 1 
        2  1960 1 1 56 LYS N    N   9.269   1.001 -10.443 1.00 . A A . 56 LYS N    1 1 
        2  1961 1 1 56 LYS NZ   N  10.915   1.383 -17.664 1.00 . A A . 56 LYS NZ   1 1 
        2  1962 1 1 56 LYS O    O  12.076   1.632 -11.877 1.00 . A A . 56 LYS O    1 1 
        2  1963 1 1 57 PRO C    C  14.346  -0.274 -11.969 1.00 . A A . 57 PRO C    1 1 
        2  1964 1 1 57 PRO CA   C  13.574  -0.383 -10.657 1.00 . A A . 57 PRO CA   1 1 
        2  1965 1 1 57 PRO CB   C  13.846  -1.737  -9.991 1.00 . A A . 57 PRO CB   1 1 
        2  1966 1 1 57 PRO CD   C  11.489  -1.605 -10.351 1.00 . A A . 57 PRO CD   1 1 
        2  1967 1 1 57 PRO CG   C  12.533  -2.161  -9.427 1.00 . A A . 57 PRO CG   1 1 
        2  1968 1 1 57 PRO HA   H  13.878   0.416  -9.996 1.00 . A A . 57 PRO HA   1 1 
        2  1969 1 1 57 PRO HB2  H  14.203  -2.439 -10.731 1.00 . A A . 57 PRO HB2  1 1 
        2  1970 1 1 57 PRO HB3  H  14.586  -1.617  -9.215 1.00 . A A . 57 PRO HB3  1 1 
        2  1971 1 1 57 PRO HD2  H  11.283  -2.301 -11.152 1.00 . A A . 57 PRO HD2  1 1 
        2  1972 1 1 57 PRO HD3  H  10.586  -1.372  -9.808 1.00 . A A . 57 PRO HD3  1 1 
        2  1973 1 1 57 PRO HG2  H  12.475  -3.240  -9.401 1.00 . A A . 57 PRO HG2  1 1 
        2  1974 1 1 57 PRO HG3  H  12.410  -1.754  -8.435 1.00 . A A . 57 PRO HG3  1 1 
        2  1975 1 1 57 PRO N    N  12.121  -0.381 -10.868 1.00 . A A . 57 PRO N    1 1 
        2  1976 1 1 57 PRO O    O  13.805  -0.545 -13.041 1.00 . A A . 57 PRO O    1 1 
        2  1977 1 1 58 ASP C    C  16.899  -1.099 -13.578 1.00 . A A . 58 ASP C    1 1 
        2  1978 1 1 58 ASP CA   C  16.451   0.267 -13.059 1.00 . A A . 58 ASP CA   1 1 
        2  1979 1 1 58 ASP CB   C  17.671   1.134 -12.741 1.00 . A A . 58 ASP CB   1 1 
        2  1980 1 1 58 ASP CG   C  17.512   2.557 -13.237 1.00 . A A . 58 ASP CG   1 1 
        2  1981 1 1 58 ASP H    H  15.985   0.324 -10.995 1.00 . A A . 58 ASP H    1 1 
        2  1982 1 1 58 ASP HA   H  15.866   0.754 -13.825 1.00 . A A . 58 ASP HA   1 1 
        2  1983 1 1 58 ASP HB2  H  17.815   1.161 -11.668 1.00 . A A . 58 ASP HB2  1 1 
        2  1984 1 1 58 ASP HB3  H  18.545   0.704 -13.210 1.00 . A A . 58 ASP HB3  1 1 
        2  1985 1 1 58 ASP N    N  15.610   0.124 -11.877 1.00 . A A . 58 ASP N    1 1 
        2  1986 1 1 58 ASP O    O  16.605  -1.466 -14.714 1.00 . A A . 58 ASP O    1 1 
        2  1987 1 1 58 ASP OD1  O  16.476   3.183 -12.925 1.00 . A A . 58 ASP OD1  1 1 
        2  1988 1 1 58 ASP OD2  O  18.420   3.047 -13.940 1.00 . A A . 58 ASP OD2  1 1 
        2  1989 1 1 59 PRO C    C  17.004  -4.249 -13.102 1.00 . A A . 59 PRO C    1 1 
        2  1990 1 1 59 PRO CA   C  18.110  -3.198 -13.127 1.00 . A A . 59 PRO CA   1 1 
        2  1991 1 1 59 PRO CB   C  19.161  -3.499 -12.061 1.00 . A A . 59 PRO CB   1 1 
        2  1992 1 1 59 PRO CD   C  18.021  -1.507 -11.371 1.00 . A A . 59 PRO CD   1 1 
        2  1993 1 1 59 PRO CG   C  18.701  -2.750 -10.859 1.00 . A A . 59 PRO CG   1 1 
        2  1994 1 1 59 PRO HA   H  18.571  -3.186 -14.103 1.00 . A A . 59 PRO HA   1 1 
        2  1995 1 1 59 PRO HB2  H  19.197  -4.562 -11.877 1.00 . A A . 59 PRO HB2  1 1 
        2  1996 1 1 59 PRO HB3  H  20.128  -3.152 -12.396 1.00 . A A . 59 PRO HB3  1 1 
        2  1997 1 1 59 PRO HD2  H  17.155  -1.277 -10.769 1.00 . A A . 59 PRO HD2  1 1 
        2  1998 1 1 59 PRO HD3  H  18.710  -0.676 -11.377 1.00 . A A . 59 PRO HD3  1 1 
        2  1999 1 1 59 PRO HG2  H  18.003  -3.353 -10.296 1.00 . A A . 59 PRO HG2  1 1 
        2  2000 1 1 59 PRO HG3  H  19.549  -2.486 -10.245 1.00 . A A . 59 PRO HG3  1 1 
        2  2001 1 1 59 PRO N    N  17.622  -1.870 -12.747 1.00 . A A . 59 PRO N    1 1 
        2  2002 1 1 59 PRO O    O  17.088  -5.236 -12.372 1.00 . A A . 59 PRO O    1 1 
        2  2003 1 1 60 SER C    C  15.225  -6.230 -14.727 1.00 . A A . 60 SER C    1 1 
        2  2004 1 1 60 SER CA   C  14.843  -4.958 -13.975 1.00 . A A . 60 SER CA   1 1 
        2  2005 1 1 60 SER CB   C  13.647  -4.289 -14.653 1.00 . A A . 60 SER CB   1 1 
        2  2006 1 1 60 SER H    H  15.957  -3.224 -14.464 1.00 . A A . 60 SER H    1 1 
        2  2007 1 1 60 SER HA   H  14.571  -5.221 -12.964 1.00 . A A . 60 SER HA   1 1 
        2  2008 1 1 60 SER HB2  H  13.957  -3.876 -15.601 1.00 . A A . 60 SER HB2  1 1 
        2  2009 1 1 60 SER HB3  H  12.871  -5.024 -14.816 1.00 . A A . 60 SER HB3  1 1 
        2  2010 1 1 60 SER HG   H  12.166  -3.231 -13.926 1.00 . A A . 60 SER HG   1 1 
        2  2011 1 1 60 SER N    N  15.968  -4.031 -13.906 1.00 . A A . 60 SER N    1 1 
        2  2012 1 1 60 SER O    O  14.574  -7.266 -14.581 1.00 . A A . 60 SER O    1 1 
        2  2013 1 1 60 SER OG   O  13.123  -3.245 -13.850 1.00 . A A . 60 SER OG   1 1 
        2  2014 1 1 61 ASN C    C  17.563  -8.243 -15.441 1.00 . A A . 61 ASN C    1 1 
        2  2015 1 1 61 ASN CA   C  16.738  -7.298 -16.308 1.00 . A A . 61 ASN CA   1 1 
        2  2016 1 1 61 ASN CB   C  17.564  -6.835 -17.508 1.00 . A A . 61 ASN CB   1 1 
        2  2017 1 1 61 ASN CG   C  17.304  -7.670 -18.746 1.00 . A A . 61 ASN CG   1 1 
        2  2018 1 1 61 ASN H    H  16.759  -5.299 -15.614 1.00 . A A . 61 ASN H    1 1 
        2  2019 1 1 61 ASN HA   H  15.866  -7.826 -16.663 1.00 . A A . 61 ASN HA   1 1 
        2  2020 1 1 61 ASN HB2  H  17.319  -5.808 -17.732 1.00 . A A . 61 ASN HB2  1 1 
        2  2021 1 1 61 ASN HB3  H  18.614  -6.905 -17.264 1.00 . A A . 61 ASN HB3  1 1 
        2  2022 1 1 61 ASN HD21 H  18.906  -8.785 -18.358 1.00 . A A . 61 ASN HD21 1 1 
        2  2023 1 1 61 ASN HD22 H  18.015  -9.213 -19.785 1.00 . A A . 61 ASN HD22 1 1 
        2  2024 1 1 61 ASN N    N  16.279  -6.149 -15.536 1.00 . A A . 61 ASN N    1 1 
        2  2025 1 1 61 ASN ND2  N  18.161  -8.655 -18.988 1.00 . A A . 61 ASN ND2  1 1 
        2  2026 1 1 61 ASN O    O  17.916  -7.915 -14.307 1.00 . A A . 61 ASN O    1 1 
        2  2027 1 1 61 ASN OD1  O  16.343  -7.433 -19.478 1.00 . A A . 61 ASN OD1  1 1 
        2  2028 1 1 62 LYS C    C  20.141 -10.084 -15.316 1.00 . A A . 62 LYS C    1 1 
        2  2029 1 1 62 LYS CA   C  18.652 -10.413 -15.257 1.00 . A A . 62 LYS CA   1 1 
        2  2030 1 1 62 LYS CB   C  18.398 -11.809 -15.835 1.00 . A A . 62 LYS CB   1 1 
        2  2031 1 1 62 LYS CD   C  16.153 -12.749 -15.206 1.00 . A A . 62 LYS CD   1 1 
        2  2032 1 1 62 LYS CE   C  15.582 -14.156 -15.114 1.00 . A A . 62 LYS CE   1 1 
        2  2033 1 1 62 LYS CG   C  17.640 -12.729 -14.890 1.00 . A A . 62 LYS CG   1 1 
        2  2034 1 1 62 LYS H    H  17.558  -9.622 -16.888 1.00 . A A . 62 LYS H    1 1 
        2  2035 1 1 62 LYS HA   H  18.333 -10.398 -14.226 1.00 . A A . 62 LYS HA   1 1 
        2  2036 1 1 62 LYS HB2  H  17.824 -11.711 -16.744 1.00 . A A . 62 LYS HB2  1 1 
        2  2037 1 1 62 LYS HB3  H  19.346 -12.270 -16.067 1.00 . A A . 62 LYS HB3  1 1 
        2  2038 1 1 62 LYS HD2  H  15.637 -12.115 -14.501 1.00 . A A . 62 LYS HD2  1 1 
        2  2039 1 1 62 LYS HD3  H  16.003 -12.374 -16.209 1.00 . A A . 62 LYS HD3  1 1 
        2  2040 1 1 62 LYS HE2  H  16.389 -14.865 -15.218 1.00 . A A . 62 LYS HE2  1 1 
        2  2041 1 1 62 LYS HE3  H  15.117 -14.278 -14.148 1.00 . A A . 62 LYS HE3  1 1 
        2  2042 1 1 62 LYS HG2  H  18.033 -13.731 -14.987 1.00 . A A . 62 LYS HG2  1 1 
        2  2043 1 1 62 LYS HG3  H  17.780 -12.382 -13.878 1.00 . A A . 62 LYS HG3  1 1 
        2  2044 1 1 62 LYS HZ1  H  13.712 -13.855 -15.997 1.00 . A A . 62 LYS HZ1  1 1 
        2  2045 1 1 62 LYS HZ2  H  14.315 -15.422 -16.189 1.00 . A A . 62 LYS HZ2  1 1 
        2  2046 1 1 62 LYS HZ3  H  14.953 -14.152 -17.107 1.00 . A A . 62 LYS HZ3  1 1 
        2  2047 1 1 62 LYS N    N  17.869  -9.419 -15.981 1.00 . A A . 62 LYS N    1 1 
        2  2048 1 1 62 LYS NZ   N  14.570 -14.415 -16.176 1.00 . A A . 62 LYS NZ   1 1 
        2  2049 1 1 62 LYS O    O  20.531  -8.995 -15.737 1.00 . A A . 62 LYS O    1 1 
        2  2050 1 1 63 LYS C    C  22.989 -11.071 -16.291 1.00 . A A . 63 LYS C    1 1 
        2  2051 1 1 63 LYS CA   C  22.415 -10.846 -14.897 1.00 . A A . 63 LYS CA   1 1 
        2  2052 1 1 63 LYS CB   C  23.077 -11.799 -13.898 1.00 . A A . 63 LYS CB   1 1 
        2  2053 1 1 63 LYS CD   C  24.240 -11.610 -11.677 1.00 . A A . 63 LYS CD   1 1 
        2  2054 1 1 63 LYS CE   C  23.646 -10.544 -10.768 1.00 . A A . 63 LYS CE   1 1 
        2  2055 1 1 63 LYS CG   C  24.231 -11.170 -13.132 1.00 . A A . 63 LYS CG   1 1 
        2  2056 1 1 63 LYS H    H  20.599 -11.882 -14.568 1.00 . A A . 63 LYS H    1 1 
        2  2057 1 1 63 LYS HA   H  22.617  -9.829 -14.597 1.00 . A A . 63 LYS HA   1 1 
        2  2058 1 1 63 LYS HB2  H  22.335 -12.127 -13.185 1.00 . A A . 63 LYS HB2  1 1 
        2  2059 1 1 63 LYS HB3  H  23.455 -12.657 -14.433 1.00 . A A . 63 LYS HB3  1 1 
        2  2060 1 1 63 LYS HD2  H  23.659 -12.514 -11.580 1.00 . A A . 63 LYS HD2  1 1 
        2  2061 1 1 63 LYS HD3  H  25.260 -11.799 -11.375 1.00 . A A . 63 LYS HD3  1 1 
        2  2062 1 1 63 LYS HE2  H  24.451 -10.027 -10.267 1.00 . A A . 63 LYS HE2  1 1 
        2  2063 1 1 63 LYS HE3  H  23.090  -9.843 -11.372 1.00 . A A . 63 LYS HE3  1 1 
        2  2064 1 1 63 LYS HG2  H  25.160 -11.466 -13.593 1.00 . A A . 63 LYS HG2  1 1 
        2  2065 1 1 63 LYS HG3  H  24.133 -10.095 -13.174 1.00 . A A . 63 LYS HG3  1 1 
        2  2066 1 1 63 LYS HZ1  H  21.748 -11.059 -10.061 1.00 . A A . 63 LYS HZ1  1 1 
        2  2067 1 1 63 LYS HZ2  H  22.839 -10.624  -8.843 1.00 . A A . 63 LYS HZ2  1 1 
        2  2068 1 1 63 LYS HZ3  H  22.969 -12.134  -9.592 1.00 . A A . 63 LYS HZ3  1 1 
        2  2069 1 1 63 LYS N    N  20.969 -11.034 -14.893 1.00 . A A . 63 LYS N    1 1 
        2  2070 1 1 63 LYS NZ   N  22.738 -11.132  -9.745 1.00 . A A . 63 LYS NZ   1 1 
        2  2071 1 1 63 LYS O    O  22.592 -12.001 -16.994 1.00 . A A . 63 LYS O    1 1 
        2  2072 1 1 64 THR C    C  25.938 -10.952 -17.888 1.00 . A A . 64 THR C    1 1 
        2  2073 1 1 64 THR CA   C  24.554 -10.318 -17.996 1.00 . A A . 64 THR CA   1 1 
        2  2074 1 1 64 THR CB   C  24.659  -8.934 -18.642 1.00 . A A . 64 THR CB   1 1 
        2  2075 1 1 64 THR CG2  C  24.954  -8.989 -20.126 1.00 . A A . 64 THR CG2  1 1 
        2  2076 1 1 64 THR H    H  24.198  -9.494 -16.079 1.00 . A A . 64 THR H    1 1 
        2  2077 1 1 64 THR HA   H  23.930 -10.947 -18.614 1.00 . A A . 64 THR HA   1 1 
        2  2078 1 1 64 THR HB   H  25.457  -8.385 -18.167 1.00 . A A . 64 THR HB   1 1 
        2  2079 1 1 64 THR HG1  H  23.269  -8.113 -17.533 1.00 . A A . 64 THR HG1  1 1 
        2  2080 1 1 64 THR HG21 H  25.577  -9.845 -20.337 1.00 . A A . 64 THR HG21 1 1 
        2  2081 1 1 64 THR HG22 H  25.468  -8.087 -20.423 1.00 . A A . 64 THR HG22 1 1 
        2  2082 1 1 64 THR HG23 H  24.027  -9.074 -20.674 1.00 . A A . 64 THR HG23 1 1 
        2  2083 1 1 64 THR N    N  23.925 -10.214 -16.683 1.00 . A A . 64 THR N    1 1 
        2  2084 1 1 64 THR O    O  26.928 -10.395 -18.361 1.00 . A A . 64 THR O    1 1 
        2  2085 1 1 64 THR OG1  O  23.455  -8.209 -18.471 1.00 . A A . 64 THR OG1  1 1 
        2  2086 1 1 65 THR C    C  27.361 -14.001 -18.071 1.00 . A A . 65 THR C    1 1 
        2  2087 1 1 65 THR CA   C  27.258 -12.835 -17.090 1.00 . A A . 65 THR CA   1 1 
        2  2088 1 1 65 THR CB   C  27.388 -13.349 -15.656 1.00 . A A . 65 THR CB   1 1 
        2  2089 1 1 65 THR CG2  C  28.707 -14.040 -15.384 1.00 . A A . 65 THR CG2  1 1 
        2  2090 1 1 65 THR H    H  25.173 -12.518 -16.906 1.00 . A A . 65 THR H    1 1 
        2  2091 1 1 65 THR HA   H  28.061 -12.143 -17.289 1.00 . A A . 65 THR HA   1 1 
        2  2092 1 1 65 THR HB   H  26.597 -14.061 -15.466 1.00 . A A . 65 THR HB   1 1 
        2  2093 1 1 65 THR HG1  H  27.328 -12.629 -13.836 1.00 . A A . 65 THR HG1  1 1 
        2  2094 1 1 65 THR HG21 H  29.131 -14.385 -16.314 1.00 . A A . 65 THR HG21 1 1 
        2  2095 1 1 65 THR HG22 H  28.543 -14.882 -14.727 1.00 . A A . 65 THR HG22 1 1 
        2  2096 1 1 65 THR HG23 H  29.387 -13.344 -14.914 1.00 . A A . 65 THR HG23 1 1 
        2  2097 1 1 65 THR N    N  25.998 -12.123 -17.262 1.00 . A A . 65 THR N    1 1 
        2  2098 1 1 65 THR O    O  28.417 -14.241 -18.655 1.00 . A A . 65 THR O    1 1 
        2  2099 1 1 65 THR OG1  O  27.260 -12.285 -14.730 1.00 . A A . 65 THR OG1  1 1 
        2  2100 1 1 66 ALA C    C  27.230 -16.923 -18.740 1.00 . A A . 66 ALA C    1 1 
        2  2101 1 1 66 ALA CA   C  26.221 -15.856 -19.157 1.00 . A A . 66 ALA CA   1 1 
        2  2102 1 1 66 ALA CB   C  26.491 -15.400 -20.582 1.00 . A A . 66 ALA CB   1 1 
        2  2103 1 1 66 ALA H    H  25.446 -14.476 -17.753 1.00 . A A . 66 ALA H    1 1 
        2  2104 1 1 66 ALA HA   H  25.229 -16.282 -19.122 1.00 . A A . 66 ALA HA   1 1 
        2  2105 1 1 66 ALA HB1  H  27.557 -15.350 -20.748 1.00 . A A . 66 ALA HB1  1 1 
        2  2106 1 1 66 ALA HB2  H  26.058 -14.423 -20.736 1.00 . A A . 66 ALA HB2  1 1 
        2  2107 1 1 66 ALA HB3  H  26.051 -16.103 -21.274 1.00 . A A . 66 ALA HB3  1 1 
        2  2108 1 1 66 ALA N    N  26.256 -14.718 -18.247 1.00 . A A . 66 ALA N    1 1 
        2  2109 1 1 66 ALA O    O  27.366 -17.924 -19.474 1.00 . A A . 66 ALA O    1 1 
        2  2110 1 1 66 ALA OXT  O  27.875 -16.748 -17.685 1.00 . A A . 66 ALA OXT  1 1 
        3  2111 1 1  1 MET C    C   2.722  14.077   0.816 1.00 . A A .  1 MET C    1 1 
        3  2112 1 1  1 MET CA   C   3.080  15.294   1.662 1.00 . A A .  1 MET CA   1 1 
        3  2113 1 1  1 MET CB   C   1.899  15.687   2.552 1.00 . A A .  1 MET CB   1 1 
        3  2114 1 1  1 MET CE   C   2.655  15.473   6.580 1.00 . A A .  1 MET CE   1 1 
        3  2115 1 1  1 MET CG   C   2.314  16.193   3.924 1.00 . A A .  1 MET CG   1 1 
        3  2116 1 1  1 MET H1   H   2.555  16.815   0.379 1.00 . A A .  1 MET H1   1 1 
        3  2117 1 1  1 MET H2   H   4.099  16.126   0.080 1.00 . A A .  1 MET H2   1 1 
        3  2118 1 1  1 MET H3   H   3.872  17.178   1.417 1.00 . A A .  1 MET H3   1 1 
        3  2119 1 1  1 MET HA   H   3.929  15.054   2.284 1.00 . A A .  1 MET HA   1 1 
        3  2120 1 1  1 MET HB2  H   1.335  16.465   2.061 1.00 . A A .  1 MET HB2  1 1 
        3  2121 1 1  1 MET HB3  H   1.263  14.823   2.688 1.00 . A A .  1 MET HB3  1 1 
        3  2122 1 1  1 MET HE1  H   3.471  16.049   6.989 1.00 . A A .  1 MET HE1  1 1 
        3  2123 1 1  1 MET HE2  H   2.464  14.619   7.212 1.00 . A A .  1 MET HE2  1 1 
        3  2124 1 1  1 MET HE3  H   1.768  16.089   6.530 1.00 . A A .  1 MET HE3  1 1 
        3  2125 1 1  1 MET HG2  H   3.016  17.002   3.797 1.00 . A A .  1 MET HG2  1 1 
        3  2126 1 1  1 MET HG3  H   1.436  16.557   4.438 1.00 . A A .  1 MET HG3  1 1 
        3  2127 1 1  1 MET N    N   3.433  16.459   0.807 1.00 . A A .  1 MET N    1 1 
        3  2128 1 1  1 MET O    O   2.018  14.192  -0.188 1.00 . A A .  1 MET O    1 1 
        3  2129 1 1  1 MET SD   S   3.085  14.913   4.933 1.00 . A A .  1 MET SD   1 1 
        3  2130 1 1  2 GLU C    C   2.356  10.618   1.442 1.00 . A A .  2 GLU C    1 1 
        3  2131 1 1  2 GLU CA   C   2.941  11.673   0.509 1.00 . A A .  2 GLU CA   1 1 
        3  2132 1 1  2 GLU CB   C   4.223  11.145  -0.138 1.00 . A A .  2 GLU CB   1 1 
        3  2133 1 1  2 GLU CD   C   4.257  11.530  -2.634 1.00 . A A .  2 GLU CD   1 1 
        3  2134 1 1  2 GLU CG   C   4.007  10.539  -1.515 1.00 . A A .  2 GLU CG   1 1 
        3  2135 1 1  2 GLU H    H   3.765  12.885   2.036 1.00 . A A .  2 GLU H    1 1 
        3  2136 1 1  2 GLU HA   H   2.222  11.890  -0.267 1.00 . A A .  2 GLU HA   1 1 
        3  2137 1 1  2 GLU HB2  H   4.927  11.960  -0.235 1.00 . A A .  2 GLU HB2  1 1 
        3  2138 1 1  2 GLU HB3  H   4.651  10.387   0.502 1.00 . A A .  2 GLU HB3  1 1 
        3  2139 1 1  2 GLU HG2  H   4.680   9.705  -1.637 1.00 . A A .  2 GLU HG2  1 1 
        3  2140 1 1  2 GLU HG3  H   2.986  10.191  -1.582 1.00 . A A .  2 GLU HG3  1 1 
        3  2141 1 1  2 GLU N    N   3.211  12.912   1.229 1.00 . A A .  2 GLU N    1 1 
        3  2142 1 1  2 GLU O    O   2.754  10.509   2.601 1.00 . A A .  2 GLU O    1 1 
        3  2143 1 1  2 GLU OE1  O   4.144  12.749  -2.383 1.00 . A A .  2 GLU OE1  1 1 
        3  2144 1 1  2 GLU OE2  O   4.567  11.089  -3.761 1.00 . A A .  2 GLU OE2  1 1 
        3  2145 1 1  3 GLN C    C   0.969   7.431   1.064 1.00 . A A .  3 GLN C    1 1 
        3  2146 1 1  3 GLN CA   C   0.762   8.797   1.712 1.00 . A A .  3 GLN CA   1 1 
        3  2147 1 1  3 GLN CB   C  -0.734   9.094   1.860 1.00 . A A .  3 GLN CB   1 1 
        3  2148 1 1  3 GLN CD   C  -0.738   8.488   4.312 1.00 . A A .  3 GLN CD   1 1 
        3  2149 1 1  3 GLN CG   C  -1.131   9.512   3.267 1.00 . A A .  3 GLN CG   1 1 
        3  2150 1 1  3 GLN H    H   1.131   9.980  -0.003 1.00 . A A .  3 GLN H    1 1 
        3  2151 1 1  3 GLN HA   H   1.218   8.789   2.691 1.00 . A A .  3 GLN HA   1 1 
        3  2152 1 1  3 GLN HB2  H  -0.998   9.894   1.183 1.00 . A A .  3 GLN HB2  1 1 
        3  2153 1 1  3 GLN HB3  H  -1.296   8.211   1.598 1.00 . A A .  3 GLN HB3  1 1 
        3  2154 1 1  3 GLN HE21 H   0.337   9.856   5.280 1.00 . A A .  3 GLN HE21 1 1 
        3  2155 1 1  3 GLN HE22 H   0.325   8.268   5.981 1.00 . A A .  3 GLN HE22 1 1 
        3  2156 1 1  3 GLN HG2  H  -0.647  10.448   3.501 1.00 . A A .  3 GLN HG2  1 1 
        3  2157 1 1  3 GLN HG3  H  -2.203   9.645   3.299 1.00 . A A .  3 GLN HG3  1 1 
        3  2158 1 1  3 GLN N    N   1.406   9.845   0.927 1.00 . A A .  3 GLN N    1 1 
        3  2159 1 1  3 GLN NE2  N   0.055   8.914   5.290 1.00 . A A .  3 GLN NE2  1 1 
        3  2160 1 1  3 GLN O    O   0.050   6.612   1.005 1.00 . A A .  3 GLN O    1 1 
        3  2161 1 1  3 GLN OE1  O  -1.141   7.327   4.244 1.00 . A A .  3 GLN OE1  1 1 
        3  2162 1 1  4 ARG C    C   3.004   4.903   0.951 1.00 . A A .  4 ARG C    1 1 
        3  2163 1 1  4 ARG CA   C   2.512   5.923  -0.068 1.00 . A A .  4 ARG CA   1 1 
        3  2164 1 1  4 ARG CB   C   3.569   6.135  -1.148 1.00 . A A .  4 ARG CB   1 1 
        3  2165 1 1  4 ARG CD   C   6.061   6.012  -0.810 1.00 . A A .  4 ARG CD   1 1 
        3  2166 1 1  4 ARG CG   C   4.812   6.864  -0.655 1.00 . A A .  4 ARG CG   1 1 
        3  2167 1 1  4 ARG CZ   C   8.443   6.341  -1.348 1.00 . A A .  4 ARG CZ   1 1 
        3  2168 1 1  4 ARG H    H   2.873   7.881   0.653 1.00 . A A .  4 ARG H    1 1 
        3  2169 1 1  4 ARG HA   H   1.612   5.545  -0.530 1.00 . A A .  4 ARG HA   1 1 
        3  2170 1 1  4 ARG HB2  H   3.868   5.173  -1.536 1.00 . A A .  4 ARG HB2  1 1 
        3  2171 1 1  4 ARG HB3  H   3.132   6.713  -1.946 1.00 . A A .  4 ARG HB3  1 1 
        3  2172 1 1  4 ARG HD2  H   6.328   5.607   0.154 1.00 . A A .  4 ARG HD2  1 1 
        3  2173 1 1  4 ARG HD3  H   5.849   5.201  -1.493 1.00 . A A .  4 ARG HD3  1 1 
        3  2174 1 1  4 ARG HE   H   7.001   7.679  -1.679 1.00 . A A .  4 ARG HE   1 1 
        3  2175 1 1  4 ARG HG2  H   4.935   7.771  -1.226 1.00 . A A .  4 ARG HG2  1 1 
        3  2176 1 1  4 ARG HG3  H   4.681   7.108   0.390 1.00 . A A .  4 ARG HG3  1 1 
        3  2177 1 1  4 ARG HH11 H   8.014   4.551  -0.507 1.00 . A A .  4 ARG HH11 1 1 
        3  2178 1 1  4 ARG HH12 H   9.682   4.806  -0.898 1.00 . A A .  4 ARG HH12 1 1 
        3  2179 1 1  4 ARG HH21 H   9.194   8.016  -2.195 1.00 . A A .  4 ARG HH21 1 1 
        3  2180 1 1  4 ARG HH22 H  10.352   6.773  -1.856 1.00 . A A .  4 ARG HH22 1 1 
        3  2181 1 1  4 ARG N    N   2.183   7.191   0.577 1.00 . A A .  4 ARG N    1 1 
        3  2182 1 1  4 ARG NE   N   7.189   6.784  -1.328 1.00 . A A .  4 ARG NE   1 1 
        3  2183 1 1  4 ARG NH1  N   8.737   5.134  -0.879 1.00 . A A .  4 ARG NH1  1 1 
        3  2184 1 1  4 ARG NH2  N   9.409   7.105  -1.840 1.00 . A A .  4 ARG NH2  1 1 
        3  2185 1 1  4 ARG O    O   4.205   4.669   1.083 1.00 . A A .  4 ARG O    1 1 
        3  2186 1 1  5 ILE C    C   2.663   1.957   2.066 1.00 . A A .  5 ILE C    1 1 
        3  2187 1 1  5 ILE CA   C   2.386   3.315   2.684 1.00 . A A .  5 ILE CA   1 1 
        3  2188 1 1  5 ILE CB   C   1.241   3.168   3.704 1.00 . A A .  5 ILE CB   1 1 
        3  2189 1 1  5 ILE CD1  C  -0.722   4.592   4.463 1.00 . A A .  5 ILE CD1  1 1 
        3  2190 1 1  5 ILE CG1  C   0.752   4.543   4.130 1.00 . A A .  5 ILE CG1  1 1 
        3  2191 1 1  5 ILE CG2  C   1.695   2.366   4.915 1.00 . A A .  5 ILE CG2  1 1 
        3  2192 1 1  5 ILE H    H   1.127   4.548   1.521 1.00 . A A .  5 ILE H    1 1 
        3  2193 1 1  5 ILE HA   H   3.267   3.649   3.212 1.00 . A A .  5 ILE HA   1 1 
        3  2194 1 1  5 ILE HB   H   0.430   2.635   3.231 1.00 . A A .  5 ILE HB   1 1 
        3  2195 1 1  5 ILE HD11 H  -1.282   4.860   3.579 1.00 . A A .  5 ILE HD11 1 1 
        3  2196 1 1  5 ILE HD12 H  -0.893   5.329   5.234 1.00 . A A .  5 ILE HD12 1 1 
        3  2197 1 1  5 ILE HD13 H  -1.045   3.622   4.814 1.00 . A A .  5 ILE HD13 1 1 
        3  2198 1 1  5 ILE HG12 H   1.302   4.858   4.997 1.00 . A A .  5 ILE HG12 1 1 
        3  2199 1 1  5 ILE HG13 H   0.939   5.233   3.330 1.00 . A A .  5 ILE HG13 1 1 
        3  2200 1 1  5 ILE HG21 H   1.075   2.611   5.764 1.00 . A A .  5 ILE HG21 1 1 
        3  2201 1 1  5 ILE HG22 H   2.724   2.603   5.139 1.00 . A A .  5 ILE HG22 1 1 
        3  2202 1 1  5 ILE HG23 H   1.607   1.310   4.699 1.00 . A A .  5 ILE HG23 1 1 
        3  2203 1 1  5 ILE N    N   2.064   4.308   1.670 1.00 . A A .  5 ILE N    1 1 
        3  2204 1 1  5 ILE O    O   2.332   1.703   0.908 1.00 . A A .  5 ILE O    1 1 
        3  2205 1 1  6 THR C    C   2.372  -1.151   2.433 1.00 . A A .  6 THR C    1 1 
        3  2206 1 1  6 THR CA   C   3.606  -0.255   2.412 1.00 . A A .  6 THR CA   1 1 
        3  2207 1 1  6 THR CB   C   4.702  -0.851   3.299 1.00 . A A .  6 THR CB   1 1 
        3  2208 1 1  6 THR CG2  C   6.085  -0.743   2.693 1.00 . A A .  6 THR CG2  1 1 
        3  2209 1 1  6 THR H    H   3.502   1.373   3.766 1.00 . A A .  6 THR H    1 1 
        3  2210 1 1  6 THR HA   H   3.971  -0.188   1.398 1.00 . A A .  6 THR HA   1 1 
        3  2211 1 1  6 THR HB   H   4.493  -1.899   3.457 1.00 . A A .  6 THR HB   1 1 
        3  2212 1 1  6 THR HG1  H   5.279  -0.714   5.164 1.00 . A A .  6 THR HG1  1 1 
        3  2213 1 1  6 THR HG21 H   6.819  -1.072   3.413 1.00 . A A .  6 THR HG21 1 1 
        3  2214 1 1  6 THR HG22 H   6.281   0.286   2.424 1.00 . A A .  6 THR HG22 1 1 
        3  2215 1 1  6 THR HG23 H   6.143  -1.364   1.812 1.00 . A A .  6 THR HG23 1 1 
        3  2216 1 1  6 THR N    N   3.273   1.093   2.856 1.00 . A A .  6 THR N    1 1 
        3  2217 1 1  6 THR O    O   1.478  -0.972   3.261 1.00 . A A .  6 THR O    1 1 
        3  2218 1 1  6 THR OG1  O   4.733  -0.207   4.559 1.00 . A A .  6 THR OG1  1 1 
        3  2219 1 1  7 LEU C    C   1.082  -3.870   2.707 1.00 . A A .  7 LEU C    1 1 
        3  2220 1 1  7 LEU CA   C   1.202  -3.037   1.435 1.00 . A A .  7 LEU CA   1 1 
        3  2221 1 1  7 LEU CB   C   1.358  -3.958   0.222 1.00 . A A .  7 LEU CB   1 1 
        3  2222 1 1  7 LEU CD1  C  -0.995  -4.162  -0.614 1.00 . A A .  7 LEU CD1  1 1 
        3  2223 1 1  7 LEU CD2  C   0.612  -6.052  -0.934 1.00 . A A .  7 LEU CD2  1 1 
        3  2224 1 1  7 LEU CG   C   0.188  -4.911  -0.021 1.00 . A A .  7 LEU CG   1 1 
        3  2225 1 1  7 LEU H    H   3.071  -2.207   0.887 1.00 . A A .  7 LEU H    1 1 
        3  2226 1 1  7 LEU HA   H   0.303  -2.452   1.316 1.00 . A A .  7 LEU HA   1 1 
        3  2227 1 1  7 LEU HB2  H   1.484  -3.342  -0.656 1.00 . A A .  7 LEU HB2  1 1 
        3  2228 1 1  7 LEU HB3  H   2.252  -4.548   0.358 1.00 . A A .  7 LEU HB3  1 1 
        3  2229 1 1  7 LEU HD11 H  -0.736  -3.803  -1.600 1.00 . A A .  7 LEU HD11 1 1 
        3  2230 1 1  7 LEU HD12 H  -1.247  -3.326   0.020 1.00 . A A .  7 LEU HD12 1 1 
        3  2231 1 1  7 LEU HD13 H  -1.844  -4.827  -0.686 1.00 . A A .  7 LEU HD13 1 1 
        3  2232 1 1  7 LEU HD21 H   1.638  -6.318  -0.725 1.00 . A A .  7 LEU HD21 1 1 
        3  2233 1 1  7 LEU HD22 H   0.523  -5.742  -1.964 1.00 . A A .  7 LEU HD22 1 1 
        3  2234 1 1  7 LEU HD23 H  -0.024  -6.908  -0.759 1.00 . A A .  7 LEU HD23 1 1 
        3  2235 1 1  7 LEU HG   H  -0.125  -5.335   0.923 1.00 . A A .  7 LEU HG   1 1 
        3  2236 1 1  7 LEU N    N   2.328  -2.115   1.519 1.00 . A A .  7 LEU N    1 1 
        3  2237 1 1  7 LEU O    O  -0.019  -4.091   3.213 1.00 . A A .  7 LEU O    1 1 
        3  2238 1 1  8 LYS C    C   1.618  -4.382   5.603 1.00 . A A .  8 LYS C    1 1 
        3  2239 1 1  8 LYS CA   C   2.239  -5.137   4.432 1.00 . A A .  8 LYS CA   1 1 
        3  2240 1 1  8 LYS CB   C   3.674  -5.540   4.775 1.00 . A A .  8 LYS CB   1 1 
        3  2241 1 1  8 LYS CD   C   4.403  -7.815   5.568 1.00 . A A .  8 LYS CD   1 1 
        3  2242 1 1  8 LYS CE   C   5.329  -8.337   6.654 1.00 . A A .  8 LYS CE   1 1 
        3  2243 1 1  8 LYS CG   C   3.773  -6.488   5.961 1.00 . A A .  8 LYS CG   1 1 
        3  2244 1 1  8 LYS H    H   3.064  -4.119   2.769 1.00 . A A .  8 LYS H    1 1 
        3  2245 1 1  8 LYS HA   H   1.660  -6.028   4.247 1.00 . A A .  8 LYS HA   1 1 
        3  2246 1 1  8 LYS HB2  H   4.115  -6.024   3.916 1.00 . A A .  8 LYS HB2  1 1 
        3  2247 1 1  8 LYS HB3  H   4.241  -4.650   5.006 1.00 . A A .  8 LYS HB3  1 1 
        3  2248 1 1  8 LYS HD2  H   3.620  -8.539   5.398 1.00 . A A .  8 LYS HD2  1 1 
        3  2249 1 1  8 LYS HD3  H   4.971  -7.677   4.658 1.00 . A A .  8 LYS HD3  1 1 
        3  2250 1 1  8 LYS HE2  H   6.344  -8.069   6.403 1.00 . A A .  8 LYS HE2  1 1 
        3  2251 1 1  8 LYS HE3  H   5.058  -7.874   7.592 1.00 . A A .  8 LYS HE3  1 1 
        3  2252 1 1  8 LYS HG2  H   4.378  -6.029   6.727 1.00 . A A .  8 LYS HG2  1 1 
        3  2253 1 1  8 LYS HG3  H   2.780  -6.671   6.346 1.00 . A A .  8 LYS HG3  1 1 
        3  2254 1 1  8 LYS HZ1  H   4.242 -10.109   6.848 1.00 . A A .  8 LYS HZ1  1 1 
        3  2255 1 1  8 LYS HZ2  H   5.724 -10.121   7.665 1.00 . A A .  8 LYS HZ2  1 1 
        3  2256 1 1  8 LYS HZ3  H   5.685 -10.282   5.982 1.00 . A A .  8 LYS HZ3  1 1 
        3  2257 1 1  8 LYS N    N   2.218  -4.328   3.220 1.00 . A A .  8 LYS N    1 1 
        3  2258 1 1  8 LYS NZ   N   5.239  -9.816   6.798 1.00 . A A .  8 LYS NZ   1 1 
        3  2259 1 1  8 LYS O    O   0.953  -4.973   6.454 1.00 . A A .  8 LYS O    1 1 
        3  2260 1 1  9 ASP C    C  -0.212  -2.079   6.567 1.00 . A A .  9 ASP C    1 1 
        3  2261 1 1  9 ASP CA   C   1.299  -2.233   6.704 1.00 . A A .  9 ASP CA   1 1 
        3  2262 1 1  9 ASP CB   C   1.962  -0.857   6.685 1.00 . A A .  9 ASP CB   1 1 
        3  2263 1 1  9 ASP CG   C   3.465  -0.936   6.878 1.00 . A A .  9 ASP CG   1 1 
        3  2264 1 1  9 ASP H    H   2.375  -2.658   4.931 1.00 . A A .  9 ASP H    1 1 
        3  2265 1 1  9 ASP HA   H   1.515  -2.716   7.646 1.00 . A A .  9 ASP HA   1 1 
        3  2266 1 1  9 ASP HB2  H   1.765  -0.384   5.736 1.00 . A A .  9 ASP HB2  1 1 
        3  2267 1 1  9 ASP HB3  H   1.547  -0.253   7.478 1.00 . A A .  9 ASP HB3  1 1 
        3  2268 1 1  9 ASP N    N   1.837  -3.071   5.640 1.00 . A A .  9 ASP N    1 1 
        3  2269 1 1  9 ASP O    O  -0.964  -2.361   7.500 1.00 . A A .  9 ASP O    1 1 
        3  2270 1 1  9 ASP OD1  O   4.038  -2.021   6.645 1.00 . A A .  9 ASP OD1  1 1 
        3  2271 1 1  9 ASP OD2  O   4.069   0.088   7.262 1.00 . A A .  9 ASP OD2  1 1 
        3  2272 1 1 10 TYR C    C  -2.848  -2.721   5.319 1.00 . A A . 10 TYR C    1 1 
        3  2273 1 1 10 TYR CA   C  -2.067  -1.424   5.134 1.00 . A A . 10 TYR CA   1 1 
        3  2274 1 1 10 TYR CB   C  -2.274  -0.888   3.717 1.00 . A A . 10 TYR CB   1 1 
        3  2275 1 1 10 TYR CD1  C  -4.771  -1.154   3.461 1.00 . A A . 10 TYR CD1  1 1 
        3  2276 1 1 10 TYR CD2  C  -3.845   1.034   3.259 1.00 . A A . 10 TYR CD2  1 1 
        3  2277 1 1 10 TYR CE1  C  -6.036  -0.643   3.240 1.00 . A A . 10 TYR CE1  1 1 
        3  2278 1 1 10 TYR CE2  C  -5.108   1.552   3.037 1.00 . A A . 10 TYR CE2  1 1 
        3  2279 1 1 10 TYR CG   C  -3.656  -0.325   3.475 1.00 . A A . 10 TYR CG   1 1 
        3  2280 1 1 10 TYR CZ   C  -6.198   0.710   3.028 1.00 . A A . 10 TYR CZ   1 1 
        3  2281 1 1 10 TYR H    H   0.002  -1.413   4.693 1.00 . A A . 10 TYR H    1 1 
        3  2282 1 1 10 TYR HA   H  -2.433  -0.695   5.841 1.00 . A A . 10 TYR HA   1 1 
        3  2283 1 1 10 TYR HB2  H  -1.559  -0.101   3.531 1.00 . A A . 10 TYR HB2  1 1 
        3  2284 1 1 10 TYR HB3  H  -2.111  -1.688   3.010 1.00 . A A . 10 TYR HB3  1 1 
        3  2285 1 1 10 TYR HD1  H  -4.640  -2.213   3.627 1.00 . A A . 10 TYR HD1  1 1 
        3  2286 1 1 10 TYR HD2  H  -2.988   1.691   3.266 1.00 . A A . 10 TYR HD2  1 1 
        3  2287 1 1 10 TYR HE1  H  -6.890  -1.303   3.233 1.00 . A A . 10 TYR HE1  1 1 
        3  2288 1 1 10 TYR HE2  H  -5.233   2.612   2.871 1.00 . A A . 10 TYR HE2  1 1 
        3  2289 1 1 10 TYR HH   H  -7.697   1.806   3.530 1.00 . A A . 10 TYR HH   1 1 
        3  2290 1 1 10 TYR N    N  -0.648  -1.624   5.397 1.00 . A A . 10 TYR N    1 1 
        3  2291 1 1 10 TYR O    O  -4.008  -2.707   5.729 1.00 . A A . 10 TYR O    1 1 
        3  2292 1 1 10 TYR OH   O  -7.458   1.222   2.807 1.00 . A A . 10 TYR OH   1 1 
        3  2293 1 1 11 ALA C    C  -3.001  -5.536   6.611 1.00 . A A . 11 ALA C    1 1 
        3  2294 1 1 11 ALA CA   C  -2.840  -5.148   5.145 1.00 . A A . 11 ALA CA   1 1 
        3  2295 1 1 11 ALA CB   C  -2.036  -6.205   4.403 1.00 . A A . 11 ALA CB   1 1 
        3  2296 1 1 11 ALA H    H  -1.281  -3.792   4.690 1.00 . A A . 11 ALA H    1 1 
        3  2297 1 1 11 ALA HA   H  -3.818  -5.089   4.690 1.00 . A A . 11 ALA HA   1 1 
        3  2298 1 1 11 ALA HB1  H  -1.146  -6.442   4.968 1.00 . A A . 11 ALA HB1  1 1 
        3  2299 1 1 11 ALA HB2  H  -1.756  -5.827   3.431 1.00 . A A . 11 ALA HB2  1 1 
        3  2300 1 1 11 ALA HB3  H  -2.635  -7.096   4.285 1.00 . A A . 11 ALA HB3  1 1 
        3  2301 1 1 11 ALA N    N  -2.204  -3.843   5.012 1.00 . A A . 11 ALA N    1 1 
        3  2302 1 1 11 ALA O    O  -4.034  -6.072   7.011 1.00 . A A . 11 ALA O    1 1 
        3  2303 1 1 12 MET C    C  -2.728  -4.517   9.625 1.00 . A A . 12 MET C    1 1 
        3  2304 1 1 12 MET CA   C  -1.996  -5.591   8.823 1.00 . A A . 12 MET CA   1 1 
        3  2305 1 1 12 MET CB   C  -0.570  -5.761   9.352 1.00 . A A . 12 MET CB   1 1 
        3  2306 1 1 12 MET CE   C  -1.542  -6.559  12.107 1.00 . A A . 12 MET CE   1 1 
        3  2307 1 1 12 MET CG   C  -0.234  -7.190   9.747 1.00 . A A . 12 MET CG   1 1 
        3  2308 1 1 12 MET H    H  -1.176  -4.846   7.030 1.00 . A A . 12 MET H    1 1 
        3  2309 1 1 12 MET HA   H  -2.521  -6.520   8.933 1.00 . A A . 12 MET HA   1 1 
        3  2310 1 1 12 MET HB2  H   0.125  -5.451   8.584 1.00 . A A . 12 MET HB2  1 1 
        3  2311 1 1 12 MET HB3  H  -0.439  -5.129  10.218 1.00 . A A . 12 MET HB3  1 1 
        3  2312 1 1 12 MET HE1  H  -1.652  -6.714  13.171 1.00 . A A . 12 MET HE1  1 1 
        3  2313 1 1 12 MET HE2  H  -2.407  -6.954  11.595 1.00 . A A . 12 MET HE2  1 1 
        3  2314 1 1 12 MET HE3  H  -1.455  -5.502  11.904 1.00 . A A . 12 MET HE3  1 1 
        3  2315 1 1 12 MET HG2  H  -1.020  -7.840   9.396 1.00 . A A . 12 MET HG2  1 1 
        3  2316 1 1 12 MET HG3  H   0.699  -7.468   9.279 1.00 . A A . 12 MET HG3  1 1 
        3  2317 1 1 12 MET N    N  -1.972  -5.267   7.405 1.00 . A A . 12 MET N    1 1 
        3  2318 1 1 12 MET O    O  -3.224  -4.777  10.721 1.00 . A A . 12 MET O    1 1 
        3  2319 1 1 12 MET SD   S  -0.070  -7.400  11.531 1.00 . A A . 12 MET SD   1 1 
        3  2320 1 1 13 ARG C    C  -4.943  -2.184   9.445 1.00 . A A . 13 ARG C    1 1 
        3  2321 1 1 13 ARG CA   C  -3.446  -2.195   9.742 1.00 . A A . 13 ARG CA   1 1 
        3  2322 1 1 13 ARG CB   C  -2.817  -0.869   9.310 1.00 . A A . 13 ARG CB   1 1 
        3  2323 1 1 13 ARG CD   C  -2.911   1.615   9.693 1.00 . A A . 13 ARG CD   1 1 
        3  2324 1 1 13 ARG CG   C  -2.970   0.239  10.339 1.00 . A A . 13 ARG CG   1 1 
        3  2325 1 1 13 ARG CZ   C  -1.407   3.566   9.643 1.00 . A A . 13 ARG CZ   1 1 
        3  2326 1 1 13 ARG H    H  -2.363  -3.165   8.204 1.00 . A A . 13 ARG H    1 1 
        3  2327 1 1 13 ARG HA   H  -3.307  -2.315  10.805 1.00 . A A . 13 ARG HA   1 1 
        3  2328 1 1 13 ARG HB2  H  -1.761  -1.025   9.134 1.00 . A A . 13 ARG HB2  1 1 
        3  2329 1 1 13 ARG HB3  H  -3.285  -0.543   8.391 1.00 . A A . 13 ARG HB3  1 1 
        3  2330 1 1 13 ARG HD2  H  -3.006   1.501   8.622 1.00 . A A . 13 ARG HD2  1 1 
        3  2331 1 1 13 ARG HD3  H  -3.735   2.208  10.064 1.00 . A A . 13 ARG HD3  1 1 
        3  2332 1 1 13 ARG HE   H  -0.965   1.803  10.466 1.00 . A A . 13 ARG HE   1 1 
        3  2333 1 1 13 ARG HG2  H  -3.923   0.127  10.836 1.00 . A A . 13 ARG HG2  1 1 
        3  2334 1 1 13 ARG HG3  H  -2.169   0.157  11.063 1.00 . A A . 13 ARG HG3  1 1 
        3  2335 1 1 13 ARG HH11 H  -3.202   3.868   8.758 1.00 . A A . 13 ARG HH11 1 1 
        3  2336 1 1 13 ARG HH12 H  -2.126   5.225   8.737 1.00 . A A . 13 ARG HH12 1 1 
        3  2337 1 1 13 ARG HH21 H   0.450   3.587  10.438 1.00 . A A . 13 ARG HH21 1 1 
        3  2338 1 1 13 ARG HH22 H  -0.053   5.066   9.689 1.00 . A A . 13 ARG HH22 1 1 
        3  2339 1 1 13 ARG N    N  -2.783  -3.310   9.076 1.00 . A A . 13 ARG N    1 1 
        3  2340 1 1 13 ARG NE   N  -1.658   2.305   9.986 1.00 . A A . 13 ARG NE   1 1 
        3  2341 1 1 13 ARG NH1  N  -2.320   4.278   8.992 1.00 . A A . 13 ARG NH1  1 1 
        3  2342 1 1 13 ARG NH2  N  -0.242   4.118   9.949 1.00 . A A . 13 ARG NH2  1 1 
        3  2343 1 1 13 ARG O    O  -5.763  -2.432  10.328 1.00 . A A . 13 ARG O    1 1 
        3  2344 1 1 14 PHE C    C  -7.243  -3.207   7.506 1.00 . A A . 14 PHE C    1 1 
        3  2345 1 1 14 PHE CA   C  -6.677  -1.816   7.782 1.00 . A A . 14 PHE CA   1 1 
        3  2346 1 1 14 PHE CB   C  -6.771  -0.949   6.537 1.00 . A A . 14 PHE CB   1 1 
        3  2347 1 1 14 PHE CD1  C  -6.956   1.434   7.293 1.00 . A A . 14 PHE CD1  1 1 
        3  2348 1 1 14 PHE CD2  C  -4.887   0.700   6.375 1.00 . A A . 14 PHE CD2  1 1 
        3  2349 1 1 14 PHE CE1  C  -6.429   2.685   7.483 1.00 . A A . 14 PHE CE1  1 1 
        3  2350 1 1 14 PHE CE2  C  -4.359   1.952   6.564 1.00 . A A . 14 PHE CE2  1 1 
        3  2351 1 1 14 PHE CG   C  -6.194   0.422   6.736 1.00 . A A . 14 PHE CG   1 1 
        3  2352 1 1 14 PHE CZ   C  -5.131   2.942   7.117 1.00 . A A . 14 PHE CZ   1 1 
        3  2353 1 1 14 PHE H    H  -4.599  -1.678   7.542 1.00 . A A . 14 PHE H    1 1 
        3  2354 1 1 14 PHE HA   H  -7.247  -1.354   8.574 1.00 . A A . 14 PHE HA   1 1 
        3  2355 1 1 14 PHE HB2  H  -6.234  -1.424   5.730 1.00 . A A . 14 PHE HB2  1 1 
        3  2356 1 1 14 PHE HB3  H  -7.799  -0.842   6.263 1.00 . A A . 14 PHE HB3  1 1 
        3  2357 1 1 14 PHE HD1  H  -7.967   1.238   7.580 1.00 . A A . 14 PHE HD1  1 1 
        3  2358 1 1 14 PHE HD2  H  -4.282  -0.067   5.942 1.00 . A A . 14 PHE HD2  1 1 
        3  2359 1 1 14 PHE HE1  H  -7.034   3.468   7.917 1.00 . A A . 14 PHE HE1  1 1 
        3  2360 1 1 14 PHE HE2  H  -3.336   2.156   6.280 1.00 . A A . 14 PHE HE2  1 1 
        3  2361 1 1 14 PHE HZ   H  -4.723   3.908   7.264 1.00 . A A . 14 PHE HZ   1 1 
        3  2362 1 1 14 PHE N    N  -5.292  -1.880   8.200 1.00 . A A . 14 PHE N    1 1 
        3  2363 1 1 14 PHE O    O  -8.405  -3.484   7.802 1.00 . A A . 14 PHE O    1 1 
        3  2364 1 1 15 GLY C    C  -6.792  -5.736   5.149 1.00 . A A . 15 GLY C    1 1 
        3  2365 1 1 15 GLY CA   C  -6.858  -5.426   6.630 1.00 . A A . 15 GLY CA   1 1 
        3  2366 1 1 15 GLY H    H  -5.500  -3.803   6.721 1.00 . A A . 15 GLY H    1 1 
        3  2367 1 1 15 GLY HA2  H  -6.232  -6.127   7.162 1.00 . A A . 15 GLY HA2  1 1 
        3  2368 1 1 15 GLY HA3  H  -7.877  -5.544   6.966 1.00 . A A . 15 GLY HA3  1 1 
        3  2369 1 1 15 GLY N    N  -6.415  -4.078   6.936 1.00 . A A . 15 GLY N    1 1 
        3  2370 1 1 15 GLY O    O  -7.242  -4.942   4.321 1.00 . A A . 15 GLY O    1 1 
        3  2371 1 1 16 GLN C    C  -7.467  -7.314   2.727 1.00 . A A . 16 GLN C    1 1 
        3  2372 1 1 16 GLN CA   C  -6.107  -7.307   3.418 1.00 . A A . 16 GLN CA   1 1 
        3  2373 1 1 16 GLN CB   C  -5.474  -8.697   3.332 1.00 . A A . 16 GLN CB   1 1 
        3  2374 1 1 16 GLN CD   C  -5.290 -10.702   4.859 1.00 . A A . 16 GLN CD   1 1 
        3  2375 1 1 16 GLN CG   C  -6.221  -9.755   4.128 1.00 . A A . 16 GLN CG   1 1 
        3  2376 1 1 16 GLN H    H  -5.891  -7.483   5.516 1.00 . A A . 16 GLN H    1 1 
        3  2377 1 1 16 GLN HA   H  -5.466  -6.598   2.915 1.00 . A A . 16 GLN HA   1 1 
        3  2378 1 1 16 GLN HB2  H  -5.447  -9.005   2.299 1.00 . A A . 16 GLN HB2  1 1 
        3  2379 1 1 16 GLN HB3  H  -4.463  -8.642   3.709 1.00 . A A . 16 GLN HB3  1 1 
        3  2380 1 1 16 GLN HE21 H  -5.184  -9.443   6.397 1.00 . A A . 16 GLN HE21 1 1 
        3  2381 1 1 16 GLN HE22 H  -4.265 -10.909   6.553 1.00 . A A . 16 GLN HE22 1 1 
        3  2382 1 1 16 GLN HG2  H  -6.851  -9.264   4.853 1.00 . A A . 16 GLN HG2  1 1 
        3  2383 1 1 16 GLN HG3  H  -6.836 -10.329   3.449 1.00 . A A . 16 GLN HG3  1 1 
        3  2384 1 1 16 GLN N    N  -6.230  -6.892   4.811 1.00 . A A . 16 GLN N    1 1 
        3  2385 1 1 16 GLN NE2  N  -4.871 -10.312   6.057 1.00 . A A . 16 GLN NE2  1 1 
        3  2386 1 1 16 GLN O    O  -7.564  -7.089   1.521 1.00 . A A . 16 GLN O    1 1 
        3  2387 1 1 16 GLN OE1  O  -4.952 -11.772   4.353 1.00 . A A . 16 GLN OE1  1 1 
        3  2388 1 1 17 THR C    C -10.320  -6.215   2.544 1.00 . A A . 17 THR C    1 1 
        3  2389 1 1 17 THR CA   C  -9.873  -7.608   2.967 1.00 . A A . 17 THR CA   1 1 
        3  2390 1 1 17 THR CB   C -10.830  -8.179   4.009 1.00 . A A . 17 THR CB   1 1 
        3  2391 1 1 17 THR CG2  C -12.260  -8.277   3.516 1.00 . A A . 17 THR CG2  1 1 
        3  2392 1 1 17 THR H    H  -8.376  -7.744   4.456 1.00 . A A . 17 THR H    1 1 
        3  2393 1 1 17 THR HA   H  -9.871  -8.252   2.100 1.00 . A A . 17 THR HA   1 1 
        3  2394 1 1 17 THR HB   H -10.830  -7.537   4.878 1.00 . A A . 17 THR HB   1 1 
        3  2395 1 1 17 THR HG1  H -10.550 -10.089   3.681 1.00 . A A . 17 THR HG1  1 1 
        3  2396 1 1 17 THR HG21 H -12.840  -8.870   4.207 1.00 . A A . 17 THR HG21 1 1 
        3  2397 1 1 17 THR HG22 H -12.270  -8.745   2.542 1.00 . A A . 17 THR HG22 1 1 
        3  2398 1 1 17 THR HG23 H -12.680  -7.287   3.444 1.00 . A A . 17 THR HG23 1 1 
        3  2399 1 1 17 THR N    N  -8.517  -7.573   3.502 1.00 . A A . 17 THR N    1 1 
        3  2400 1 1 17 THR O    O -10.870  -6.032   1.454 1.00 . A A . 17 THR O    1 1 
        3  2401 1 1 17 THR OG1  O -10.430  -9.475   4.410 1.00 . A A . 17 THR OG1  1 1 
        3  2402 1 1 18 LYS C    C  -9.646  -3.275   1.998 1.00 . A A . 18 LYS C    1 1 
        3  2403 1 1 18 LYS CA   C -10.480  -3.857   3.131 1.00 . A A . 18 LYS CA   1 1 
        3  2404 1 1 18 LYS CB   C -10.330  -2.996   4.386 1.00 . A A . 18 LYS CB   1 1 
        3  2405 1 1 18 LYS CD   C -10.520  -0.596   5.111 1.00 . A A . 18 LYS CD   1 1 
        3  2406 1 1 18 LYS CE   C -10.450  -0.858   6.606 1.00 . A A . 18 LYS CE   1 1 
        3  2407 1 1 18 LYS CG   C -11.190  -1.743   4.373 1.00 . A A . 18 LYS CG   1 1 
        3  2408 1 1 18 LYS H    H  -9.663  -5.444   4.264 1.00 . A A . 18 LYS H    1 1 
        3  2409 1 1 18 LYS HA   H -11.520  -3.858   2.830 1.00 . A A . 18 LYS HA   1 1 
        3  2410 1 1 18 LYS HB2  H -10.600  -3.586   5.249 1.00 . A A . 18 LYS HB2  1 1 
        3  2411 1 1 18 LYS HB3  H  -9.300  -2.695   4.479 1.00 . A A . 18 LYS HB3  1 1 
        3  2412 1 1 18 LYS HD2  H  -9.517  -0.479   4.734 1.00 . A A . 18 LYS HD2  1 1 
        3  2413 1 1 18 LYS HD3  H -11.080   0.310   4.936 1.00 . A A . 18 LYS HD3  1 1 
        3  2414 1 1 18 LYS HE2  H -11.360  -1.360   6.911 1.00 . A A . 18 LYS HE2  1 1 
        3  2415 1 1 18 LYS HE3  H  -9.609  -1.493   6.813 1.00 . A A . 18 LYS HE3  1 1 
        3  2416 1 1 18 LYS HG2  H -11.360  -1.447   3.350 1.00 . A A . 18 LYS HG2  1 1 
        3  2417 1 1 18 LYS HG3  H -12.130  -1.962   4.851 1.00 . A A . 18 LYS HG3  1 1 
        3  2418 1 1 18 LYS HZ1  H -11.250   0.731   7.705 1.00 . A A . 18 LYS HZ1  1 1 
        3  2419 1 1 18 LYS HZ2  H  -9.888   1.143   6.796 1.00 . A A . 18 LYS HZ2  1 1 
        3  2420 1 1 18 LYS HZ3  H  -9.717   0.245   8.219 1.00 . A A . 18 LYS HZ3  1 1 
        3  2421 1 1 18 LYS N    N -10.100  -5.235   3.413 1.00 . A A . 18 LYS N    1 1 
        3  2422 1 1 18 LYS NZ   N -10.310   0.404   7.387 1.00 . A A . 18 LYS NZ   1 1 
        3  2423 1 1 18 LYS O    O -10.130  -2.476   1.199 1.00 . A A . 18 LYS O    1 1 
        3  2424 1 1 19 THR C    C  -7.999  -3.548  -0.491 1.00 . A A . 19 THR C    1 1 
        3  2425 1 1 19 THR CA   C  -7.475  -3.198   0.898 1.00 . A A . 19 THR CA   1 1 
        3  2426 1 1 19 THR CB   C  -6.078  -3.791   1.094 1.00 . A A . 19 THR CB   1 1 
        3  2427 1 1 19 THR CG2  C  -4.969  -2.874   0.627 1.00 . A A . 19 THR CG2  1 1 
        3  2428 1 1 19 THR H    H  -8.050  -4.318   2.600 1.00 . A A . 19 THR H    1 1 
        3  2429 1 1 19 THR HA   H  -7.415  -2.123   0.986 1.00 . A A . 19 THR HA   1 1 
        3  2430 1 1 19 THR HB   H  -6.007  -4.711   0.531 1.00 . A A . 19 THR HB   1 1 
        3  2431 1 1 19 THR HG1  H  -6.149  -3.353   3.001 1.00 . A A . 19 THR HG1  1 1 
        3  2432 1 1 19 THR HG21 H  -4.499  -3.296  -0.250 1.00 . A A . 19 THR HG21 1 1 
        3  2433 1 1 19 THR HG22 H  -4.235  -2.768   1.412 1.00 . A A . 19 THR HG22 1 1 
        3  2434 1 1 19 THR HG23 H  -5.379  -1.907   0.383 1.00 . A A . 19 THR HG23 1 1 
        3  2435 1 1 19 THR N    N  -8.381  -3.680   1.934 1.00 . A A . 19 THR N    1 1 
        3  2436 1 1 19 THR O    O  -8.125  -2.680  -1.355 1.00 . A A . 19 THR O    1 1 
        3  2437 1 1 19 THR OG1  O  -5.846  -4.086   2.460 1.00 . A A . 19 THR OG1  1 1 
        3  2438 1 1 20 ALA C    C -10.100  -4.573  -2.351 1.00 . A A . 20 ALA C    1 1 
        3  2439 1 1 20 ALA CA   C  -8.812  -5.291  -1.982 1.00 . A A . 20 ALA CA   1 1 
        3  2440 1 1 20 ALA CB   C  -9.030  -6.796  -1.947 1.00 . A A . 20 ALA CB   1 1 
        3  2441 1 1 20 ALA H    H  -8.179  -5.470   0.029 1.00 . A A . 20 ALA H    1 1 
        3  2442 1 1 20 ALA HA   H  -8.067  -5.077  -2.734 1.00 . A A . 20 ALA HA   1 1 
        3  2443 1 1 20 ALA HB1  H  -8.729  -7.225  -2.891 1.00 . A A . 20 ALA HB1  1 1 
        3  2444 1 1 20 ALA HB2  H -10.070  -7.004  -1.775 1.00 . A A . 20 ALA HB2  1 1 
        3  2445 1 1 20 ALA HB3  H  -8.443  -7.227  -1.152 1.00 . A A . 20 ALA HB3  1 1 
        3  2446 1 1 20 ALA N    N  -8.302  -4.826  -0.698 1.00 . A A . 20 ALA N    1 1 
        3  2447 1 1 20 ALA O    O -10.400  -4.376  -3.529 1.00 . A A . 20 ALA O    1 1 
        3  2448 1 1 21 LYS C    C -11.890  -2.056  -2.015 1.00 . A A . 21 LYS C    1 1 
        3  2449 1 1 21 LYS CA   C -12.130  -3.490  -1.556 1.00 . A A . 21 LYS CA   1 1 
        3  2450 1 1 21 LYS CB   C -12.970  -3.497  -0.272 1.00 . A A . 21 LYS CB   1 1 
        3  2451 1 1 21 LYS CD   C -15.360  -3.870   0.416 1.00 . A A . 21 LYS CD   1 1 
        3  2452 1 1 21 LYS CE   C -16.630  -3.958  -0.416 1.00 . A A . 21 LYS CE   1 1 
        3  2453 1 1 21 LYS CG   C -14.160  -4.439  -0.329 1.00 . A A . 21 LYS CG   1 1 
        3  2454 1 1 21 LYS H    H -10.580  -4.372  -0.419 1.00 . A A . 21 LYS H    1 1 
        3  2455 1 1 21 LYS HA   H -12.670  -4.018  -2.328 1.00 . A A . 21 LYS HA   1 1 
        3  2456 1 1 21 LYS HB2  H -12.340  -3.796   0.553 1.00 . A A . 21 LYS HB2  1 1 
        3  2457 1 1 21 LYS HB3  H -13.340  -2.498  -0.089 1.00 . A A . 21 LYS HB3  1 1 
        3  2458 1 1 21 LYS HD2  H -15.500  -4.429   1.328 1.00 . A A . 21 LYS HD2  1 1 
        3  2459 1 1 21 LYS HD3  H -15.160  -2.834   0.653 1.00 . A A . 21 LYS HD3  1 1 
        3  2460 1 1 21 LYS HE2  H -16.780  -4.985  -0.716 1.00 . A A . 21 LYS HE2  1 1 
        3  2461 1 1 21 LYS HE3  H -17.460  -3.635   0.189 1.00 . A A . 21 LYS HE3  1 1 
        3  2462 1 1 21 LYS HG2  H -14.430  -4.596  -1.363 1.00 . A A . 21 LYS HG2  1 1 
        3  2463 1 1 21 LYS HG3  H -13.880  -5.382   0.119 1.00 . A A . 21 LYS HG3  1 1 
        3  2464 1 1 21 LYS HZ1  H -16.260  -3.677  -2.453 1.00 . A A . 21 LYS HZ1  1 1 
        3  2465 1 1 21 LYS HZ2  H -15.860  -2.340  -1.494 1.00 . A A . 21 LYS HZ2  1 1 
        3  2466 1 1 21 LYS HZ3  H -17.480  -2.686  -1.836 1.00 . A A . 21 LYS HZ3  1 1 
        3  2467 1 1 21 LYS N    N -10.870  -4.186  -1.337 1.00 . A A . 21 LYS N    1 1 
        3  2468 1 1 21 LYS NZ   N -16.550  -3.106  -1.636 1.00 . A A . 21 LYS NZ   1 1 
        3  2469 1 1 21 LYS O    O -12.580  -1.553  -2.900 1.00 . A A . 21 LYS O    1 1 
        3  2470 1 1 22 ASP C    C  -9.726   0.027  -3.023 1.00 . A A . 22 ASP C    1 1 
        3  2471 1 1 22 ASP CA   C -10.570  -0.026  -1.757 1.00 . A A . 22 ASP CA   1 1 
        3  2472 1 1 22 ASP CB   C  -9.834   0.647  -0.599 1.00 . A A . 22 ASP CB   1 1 
        3  2473 1 1 22 ASP CG   C -10.740   1.530   0.233 1.00 . A A . 22 ASP CG   1 1 
        3  2474 1 1 22 ASP H    H -10.390  -1.856  -0.711 1.00 . A A . 22 ASP H    1 1 
        3  2475 1 1 22 ASP HA   H -11.500   0.503  -1.935 1.00 . A A . 22 ASP HA   1 1 
        3  2476 1 1 22 ASP HB2  H  -9.417  -0.116   0.044 1.00 . A A . 22 ASP HB2  1 1 
        3  2477 1 1 22 ASP HB3  H  -9.035   1.257  -0.998 1.00 . A A . 22 ASP HB3  1 1 
        3  2478 1 1 22 ASP N    N -10.900  -1.402  -1.409 1.00 . A A . 22 ASP N    1 1 
        3  2479 1 1 22 ASP O    O  -9.793   0.989  -3.786 1.00 . A A . 22 ASP O    1 1 
        3  2480 1 1 22 ASP OD1  O -11.480   2.347  -0.358 1.00 . A A . 22 ASP OD1  1 1 
        3  2481 1 1 22 ASP OD2  O -10.710   1.405   1.475 1.00 . A A . 22 ASP OD2  1 1 
        3  2482 1 1 23 LEU C    C  -8.853  -1.530  -5.640 1.00 . A A . 23 LEU C    1 1 
        3  2483 1 1 23 LEU CA   C  -8.065  -1.085  -4.412 1.00 . A A . 23 LEU CA   1 1 
        3  2484 1 1 23 LEU CB   C  -6.904  -2.048  -4.157 1.00 . A A . 23 LEU CB   1 1 
        3  2485 1 1 23 LEU CD1  C  -5.564  -1.598  -2.086 1.00 . A A . 23 LEU CD1  1 1 
        3  2486 1 1 23 LEU CD2  C  -4.400  -1.967  -4.266 1.00 . A A . 23 LEU CD2  1 1 
        3  2487 1 1 23 LEU CG   C  -5.638  -1.399  -3.591 1.00 . A A . 23 LEU CG   1 1 
        3  2488 1 1 23 LEU H    H  -8.919  -1.752  -2.593 1.00 . A A . 23 LEU H    1 1 
        3  2489 1 1 23 LEU HA   H  -7.668  -0.097  -4.592 1.00 . A A . 23 LEU HA   1 1 
        3  2490 1 1 23 LEU HB2  H  -7.239  -2.806  -3.464 1.00 . A A . 23 LEU HB2  1 1 
        3  2491 1 1 23 LEU HB3  H  -6.650  -2.526  -5.092 1.00 . A A . 23 LEU HB3  1 1 
        3  2492 1 1 23 LEU HD11 H  -5.644  -2.650  -1.856 1.00 . A A . 23 LEU HD11 1 1 
        3  2493 1 1 23 LEU HD12 H  -6.376  -1.065  -1.612 1.00 . A A . 23 LEU HD12 1 1 
        3  2494 1 1 23 LEU HD13 H  -4.623  -1.219  -1.718 1.00 . A A . 23 LEU HD13 1 1 
        3  2495 1 1 23 LEU HD21 H  -3.536  -1.385  -3.982 1.00 . A A . 23 LEU HD21 1 1 
        3  2496 1 1 23 LEU HD22 H  -4.523  -1.926  -5.339 1.00 . A A . 23 LEU HD22 1 1 
        3  2497 1 1 23 LEU HD23 H  -4.260  -2.992  -3.959 1.00 . A A . 23 LEU HD23 1 1 
        3  2498 1 1 23 LEU HG   H  -5.669  -0.337  -3.786 1.00 . A A . 23 LEU HG   1 1 
        3  2499 1 1 23 LEU N    N  -8.929  -1.014  -3.238 1.00 . A A . 23 LEU N    1 1 
        3  2500 1 1 23 LEU O    O  -8.690  -0.977  -6.727 1.00 . A A . 23 LEU O    1 1 
        3  2501 1 1 24 GLY C    C  -9.982  -4.349  -7.103 1.00 . A A . 24 GLY C    1 1 
        3  2502 1 1 24 GLY CA   C -10.500  -3.033  -6.562 1.00 . A A . 24 GLY CA   1 1 
        3  2503 1 1 24 GLY H    H  -9.794  -2.935  -4.569 1.00 . A A . 24 GLY H    1 1 
        3  2504 1 1 24 GLY HA2  H -11.520  -3.176  -6.221 1.00 . A A . 24 GLY HA2  1 1 
        3  2505 1 1 24 GLY HA3  H -10.500  -2.303  -7.357 1.00 . A A . 24 GLY HA3  1 1 
        3  2506 1 1 24 GLY N    N  -9.706  -2.533  -5.459 1.00 . A A . 24 GLY N    1 1 
        3  2507 1 1 24 GLY O    O -10.140  -4.651  -8.286 1.00 . A A . 24 GLY O    1 1 
        3  2508 1 1 25 VAL C    C  -9.258  -7.531  -5.686 1.00 . A A . 25 VAL C    1 1 
        3  2509 1 1 25 VAL CA   C  -8.802  -6.426  -6.633 1.00 . A A . 25 VAL CA   1 1 
        3  2510 1 1 25 VAL CB   C  -7.262  -6.396  -6.663 1.00 . A A . 25 VAL CB   1 1 
        3  2511 1 1 25 VAL CG1  C  -6.766  -5.620  -7.873 1.00 . A A . 25 VAL CG1  1 1 
        3  2512 1 1 25 VAL CG2  C  -6.714  -5.800  -5.375 1.00 . A A . 25 VAL CG2  1 1 
        3  2513 1 1 25 VAL H    H  -9.253  -4.839  -5.307 1.00 . A A . 25 VAL H    1 1 
        3  2514 1 1 25 VAL HA   H  -9.157  -6.650  -7.629 1.00 . A A . 25 VAL HA   1 1 
        3  2515 1 1 25 VAL HB   H  -6.903  -7.411  -6.745 1.00 . A A . 25 VAL HB   1 1 
        3  2516 1 1 25 VAL HG11 H  -6.864  -6.231  -8.757 1.00 . A A . 25 VAL HG11 1 1 
        3  2517 1 1 25 VAL HG12 H  -5.728  -5.357  -7.730 1.00 . A A . 25 VAL HG12 1 1 
        3  2518 1 1 25 VAL HG13 H  -7.352  -4.720  -7.989 1.00 . A A . 25 VAL HG13 1 1 
        3  2519 1 1 25 VAL HG21 H  -6.544  -4.742  -5.512 1.00 . A A . 25 VAL HG21 1 1 
        3  2520 1 1 25 VAL HG22 H  -5.784  -6.284  -5.122 1.00 . A A . 25 VAL HG22 1 1 
        3  2521 1 1 25 VAL HG23 H  -7.427  -5.949  -4.577 1.00 . A A . 25 VAL HG23 1 1 
        3  2522 1 1 25 VAL N    N  -9.351  -5.136  -6.237 1.00 . A A . 25 VAL N    1 1 
        3  2523 1 1 25 VAL O    O -10.000  -7.282  -4.737 1.00 . A A . 25 VAL O    1 1 
        3  2524 1 1 26 GLN C    C  -8.141 -10.093  -4.005 1.00 . A A . 26 GLN C    1 1 
        3  2525 1 1 26 GLN CA   C  -9.163  -9.893  -5.118 1.00 . A A . 26 GLN CA   1 1 
        3  2526 1 1 26 GLN CB   C  -9.261 -11.160  -5.971 1.00 . A A . 26 GLN CB   1 1 
        3  2527 1 1 26 GLN CD   C -11.040 -12.911  -6.352 1.00 . A A . 26 GLN CD   1 1 
        3  2528 1 1 26 GLN CG   C -10.660 -11.446  -6.475 1.00 . A A . 26 GLN CG   1 1 
        3  2529 1 1 26 GLN H    H  -8.213  -8.889  -6.714 1.00 . A A . 26 GLN H    1 1 
        3  2530 1 1 26 GLN HA   H -10.120  -9.692  -4.675 1.00 . A A . 26 GLN HA   1 1 
        3  2531 1 1 26 GLN HB2  H  -8.610 -11.055  -6.827 1.00 . A A . 26 GLN HB2  1 1 
        3  2532 1 1 26 GLN HB3  H  -8.934 -12.004  -5.382 1.00 . A A . 26 GLN HB3  1 1 
        3  2533 1 1 26 GLN HE21 H -12.090 -12.806  -8.036 1.00 . A A . 26 GLN HE21 1 1 
        3  2534 1 1 26 GLN HE22 H -12.070 -14.349  -7.258 1.00 . A A . 26 GLN HE22 1 1 
        3  2535 1 1 26 GLN HG2  H -11.360 -10.861  -5.899 1.00 . A A . 26 GLN HG2  1 1 
        3  2536 1 1 26 GLN HG3  H -10.720 -11.160  -7.514 1.00 . A A . 26 GLN HG3  1 1 
        3  2537 1 1 26 GLN N    N  -8.804  -8.752  -5.947 1.00 . A A . 26 GLN N    1 1 
        3  2538 1 1 26 GLN NE2  N -11.810 -13.405  -7.313 1.00 . A A . 26 GLN NE2  1 1 
        3  2539 1 1 26 GLN O    O  -6.937  -9.948  -4.218 1.00 . A A . 26 GLN O    1 1 
        3  2540 1 1 26 GLN OE1  O -10.640 -13.589  -5.405 1.00 . A A . 26 GLN OE1  1 1 
        3  2541 1 1 27 GLN C    C  -6.699 -11.695  -1.965 1.00 . A A . 27 GLN C    1 1 
        3  2542 1 1 27 GLN CA   C  -7.767 -10.647  -1.662 1.00 . A A . 27 GLN CA   1 1 
        3  2543 1 1 27 GLN CB   C  -8.596 -11.080  -0.452 1.00 . A A . 27 GLN CB   1 1 
        3  2544 1 1 27 GLN CD   C -10.800  -9.895  -0.129 1.00 . A A . 27 GLN CD   1 1 
        3  2545 1 1 27 GLN CG   C  -9.329  -9.933   0.224 1.00 . A A . 27 GLN CG   1 1 
        3  2546 1 1 27 GLN H    H  -9.600 -10.526  -2.715 1.00 . A A . 27 GLN H    1 1 
        3  2547 1 1 27 GLN HA   H  -7.278  -9.714  -1.436 1.00 . A A . 27 GLN HA   1 1 
        3  2548 1 1 27 GLN HB2  H  -9.327 -11.808  -0.773 1.00 . A A . 27 GLN HB2  1 1 
        3  2549 1 1 27 GLN HB3  H  -7.940 -11.538   0.274 1.00 . A A . 27 GLN HB3  1 1 
        3  2550 1 1 27 GLN HE21 H -10.810  -7.912   0.019 1.00 . A A . 27 GLN HE21 1 1 
        3  2551 1 1 27 GLN HE22 H -12.320  -8.642  -0.400 1.00 . A A . 27 GLN HE22 1 1 
        3  2552 1 1 27 GLN HG2  H  -9.233 -10.042   1.294 1.00 . A A . 27 GLN HG2  1 1 
        3  2553 1 1 27 GLN HG3  H  -8.876  -9.002  -0.084 1.00 . A A . 27 GLN HG3  1 1 
        3  2554 1 1 27 GLN N    N  -8.631 -10.427  -2.818 1.00 . A A . 27 GLN N    1 1 
        3  2555 1 1 27 GLN NE2  N -11.370  -8.696  -0.175 1.00 . A A . 27 GLN NE2  1 1 
        3  2556 1 1 27 GLN O    O  -5.645 -11.722  -1.330 1.00 . A A . 27 GLN O    1 1 
        3  2557 1 1 27 GLN OE1  O -11.420 -10.933  -0.358 1.00 . A A . 27 GLN OE1  1 1 
        3  2558 1 1 28 SER C    C  -4.746 -13.003  -3.856 1.00 . A A . 28 SER C    1 1 
        3  2559 1 1 28 SER CA   C  -6.045 -13.602  -3.326 1.00 . A A . 28 SER CA   1 1 
        3  2560 1 1 28 SER CB   C  -6.672 -14.507  -4.387 1.00 . A A . 28 SER CB   1 1 
        3  2561 1 1 28 SER H    H  -7.836 -12.479  -3.406 1.00 . A A . 28 SER H    1 1 
        3  2562 1 1 28 SER HA   H  -5.825 -14.191  -2.448 1.00 . A A . 28 SER HA   1 1 
        3  2563 1 1 28 SER HB2  H  -6.107 -15.424  -4.456 1.00 . A A . 28 SER HB2  1 1 
        3  2564 1 1 28 SER HB3  H  -7.691 -14.734  -4.107 1.00 . A A . 28 SER HB3  1 1 
        3  2565 1 1 28 SER HG   H  -7.374 -13.217  -5.685 1.00 . A A . 28 SER HG   1 1 
        3  2566 1 1 28 SER N    N  -6.980 -12.553  -2.938 1.00 . A A . 28 SER N    1 1 
        3  2567 1 1 28 SER O    O  -3.676 -13.596  -3.717 1.00 . A A . 28 SER O    1 1 
        3  2568 1 1 28 SER OG   O  -6.678 -13.879  -5.656 1.00 . A A . 28 SER OG   1 1 
        3  2569 1 1 29 ALA C    C  -2.862 -10.480  -3.914 1.00 . A A . 29 ALA C    1 1 
        3  2570 1 1 29 ALA CA   C  -3.680 -11.146  -5.014 1.00 . A A . 29 ALA CA   1 1 
        3  2571 1 1 29 ALA CB   C  -4.107 -10.120  -6.053 1.00 . A A . 29 ALA CB   1 1 
        3  2572 1 1 29 ALA H    H  -5.728 -11.402  -4.543 1.00 . A A . 29 ALA H    1 1 
        3  2573 1 1 29 ALA HA   H  -3.067 -11.887  -5.505 1.00 . A A . 29 ALA HA   1 1 
        3  2574 1 1 29 ALA HB1  H  -3.412 -10.132  -6.878 1.00 . A A . 29 ALA HB1  1 1 
        3  2575 1 1 29 ALA HB2  H  -4.118  -9.138  -5.605 1.00 . A A . 29 ALA HB2  1 1 
        3  2576 1 1 29 ALA HB3  H  -5.097 -10.362  -6.412 1.00 . A A . 29 ALA HB3  1 1 
        3  2577 1 1 29 ALA N    N  -4.848 -11.825  -4.463 1.00 . A A . 29 ALA N    1 1 
        3  2578 1 1 29 ALA O    O  -1.632 -10.495  -3.947 1.00 . A A . 29 ALA O    1 1 
        3  2579 1 1 30 ILE C    C  -2.088 -10.249  -1.003 1.00 . A A . 30 ILE C    1 1 
        3  2580 1 1 30 ILE CA   C  -2.884  -9.240  -1.823 1.00 . A A . 30 ILE CA   1 1 
        3  2581 1 1 30 ILE CB   C  -3.896  -8.506  -0.912 1.00 . A A . 30 ILE CB   1 1 
        3  2582 1 1 30 ILE CD1  C  -5.335  -7.630  -2.826 1.00 . A A . 30 ILE CD1  1 1 
        3  2583 1 1 30 ILE CG1  C  -4.472  -7.284  -1.633 1.00 . A A . 30 ILE CG1  1 1 
        3  2584 1 1 30 ILE CG2  C  -3.243  -8.086   0.398 1.00 . A A . 30 ILE CG2  1 1 
        3  2585 1 1 30 ILE H    H  -4.531  -9.929  -2.960 1.00 . A A . 30 ILE H    1 1 
        3  2586 1 1 30 ILE HA   H  -2.203  -8.508  -2.235 1.00 . A A . 30 ILE HA   1 1 
        3  2587 1 1 30 ILE HB   H  -4.700  -9.189  -0.681 1.00 . A A . 30 ILE HB   1 1 
        3  2588 1 1 30 ILE HD11 H  -5.994  -8.445  -2.568 1.00 . A A . 30 ILE HD11 1 1 
        3  2589 1 1 30 ILE HD12 H  -4.705  -7.925  -3.652 1.00 . A A . 30 ILE HD12 1 1 
        3  2590 1 1 30 ILE HD13 H  -5.920  -6.769  -3.109 1.00 . A A . 30 ILE HD13 1 1 
        3  2591 1 1 30 ILE HG12 H  -5.078  -6.719  -0.940 1.00 . A A . 30 ILE HG12 1 1 
        3  2592 1 1 30 ILE HG13 H  -3.657  -6.664  -1.980 1.00 . A A . 30 ILE HG13 1 1 
        3  2593 1 1 30 ILE HG21 H  -3.837  -7.312   0.864 1.00 . A A . 30 ILE HG21 1 1 
        3  2594 1 1 30 ILE HG22 H  -2.251  -7.708   0.201 1.00 . A A . 30 ILE HG22 1 1 
        3  2595 1 1 30 ILE HG23 H  -3.180  -8.939   1.059 1.00 . A A . 30 ILE HG23 1 1 
        3  2596 1 1 30 ILE N    N  -3.552  -9.903  -2.937 1.00 . A A . 30 ILE N    1 1 
        3  2597 1 1 30 ILE O    O  -1.053  -9.918  -0.426 1.00 . A A . 30 ILE O    1 1 
        3  2598 1 1 31 ASN C    C  -0.596 -12.928  -0.882 1.00 . A A . 31 ASN C    1 1 
        3  2599 1 1 31 ASN CA   C  -1.913 -12.544  -0.215 1.00 . A A . 31 ASN CA   1 1 
        3  2600 1 1 31 ASN CB   C  -2.826 -13.769  -0.107 1.00 . A A . 31 ASN CB   1 1 
        3  2601 1 1 31 ASN CG   C  -3.085 -14.173   1.332 1.00 . A A . 31 ASN CG   1 1 
        3  2602 1 1 31 ASN H    H  -3.405 -11.687  -1.439 1.00 . A A . 31 ASN H    1 1 
        3  2603 1 1 31 ASN HA   H  -1.708 -12.170   0.775 1.00 . A A . 31 ASN HA   1 1 
        3  2604 1 1 31 ASN HB2  H  -3.775 -13.545  -0.572 1.00 . A A . 31 ASN HB2  1 1 
        3  2605 1 1 31 ASN HB3  H  -2.366 -14.602  -0.618 1.00 . A A . 31 ASN HB3  1 1 
        3  2606 1 1 31 ASN HD21 H  -1.133 -14.107   1.723 1.00 . A A . 31 ASN HD21 1 1 
        3  2607 1 1 31 ASN HD22 H  -2.156 -14.550   3.053 1.00 . A A . 31 ASN HD22 1 1 
        3  2608 1 1 31 ASN N    N  -2.579 -11.484  -0.959 1.00 . A A . 31 ASN N    1 1 
        3  2609 1 1 31 ASN ND2  N  -2.017 -14.288   2.115 1.00 . A A . 31 ASN ND2  1 1 
        3  2610 1 1 31 ASN O    O   0.427 -13.076  -0.215 1.00 . A A . 31 ASN O    1 1 
        3  2611 1 1 31 ASN OD1  O  -4.228 -14.379   1.735 1.00 . A A . 31 ASN OD1  1 1 
        3  2612 1 1 32 LYS C    C   1.547 -12.297  -3.025 1.00 . A A . 32 LYS C    1 1 
        3  2613 1 1 32 LYS CA   C   0.559 -13.453  -2.958 1.00 . A A . 32 LYS CA   1 1 
        3  2614 1 1 32 LYS CB   C   0.176 -13.886  -4.374 1.00 . A A . 32 LYS CB   1 1 
        3  2615 1 1 32 LYS CD   C   0.066 -16.396  -4.458 1.00 . A A . 32 LYS CD   1 1 
        3  2616 1 1 32 LYS CE   C  -0.724 -17.517  -5.110 1.00 . A A . 32 LYS CE   1 1 
        3  2617 1 1 32 LYS CG   C  -0.735 -15.103  -4.413 1.00 . A A . 32 LYS CG   1 1 
        3  2618 1 1 32 LYS H    H  -1.475 -12.956  -2.678 1.00 . A A . 32 LYS H    1 1 
        3  2619 1 1 32 LYS HA   H   1.025 -14.278  -2.453 1.00 . A A . 32 LYS HA   1 1 
        3  2620 1 1 32 LYS HB2  H  -0.329 -13.068  -4.864 1.00 . A A . 32 LYS HB2  1 1 
        3  2621 1 1 32 LYS HB3  H   1.077 -14.120  -4.922 1.00 . A A . 32 LYS HB3  1 1 
        3  2622 1 1 32 LYS HD2  H   0.970 -16.229  -5.023 1.00 . A A . 32 LYS HD2  1 1 
        3  2623 1 1 32 LYS HD3  H   0.318 -16.685  -3.447 1.00 . A A . 32 LYS HD3  1 1 
        3  2624 1 1 32 LYS HE2  H  -0.200 -18.448  -4.956 1.00 . A A . 32 LYS HE2  1 1 
        3  2625 1 1 32 LYS HE3  H  -1.699 -17.572  -4.646 1.00 . A A . 32 LYS HE3  1 1 
        3  2626 1 1 32 LYS HG2  H  -1.354 -15.105  -3.529 1.00 . A A . 32 LYS HG2  1 1 
        3  2627 1 1 32 LYS HG3  H  -1.358 -15.046  -5.293 1.00 . A A . 32 LYS HG3  1 1 
        3  2628 1 1 32 LYS HZ1  H  -0.129 -17.765  -7.097 1.00 . A A . 32 LYS HZ1  1 1 
        3  2629 1 1 32 LYS HZ2  H  -0.876 -16.280  -6.787 1.00 . A A . 32 LYS HZ2  1 1 
        3  2630 1 1 32 LYS HZ3  H  -1.807 -17.688  -6.889 1.00 . A A . 32 LYS HZ3  1 1 
        3  2631 1 1 32 LYS N    N  -0.631 -13.086  -2.201 1.00 . A A . 32 LYS N    1 1 
        3  2632 1 1 32 LYS NZ   N  -0.896 -17.297  -6.574 1.00 . A A . 32 LYS NZ   1 1 
        3  2633 1 1 32 LYS O    O   2.752 -12.502  -3.176 1.00 . A A . 32 LYS O    1 1 
        3  2634 1 1 33 TRP C    C   2.760  -9.784  -1.755 1.00 . A A . 33 TRP C    1 1 
        3  2635 1 1 33 TRP CA   C   1.845  -9.889  -2.972 1.00 . A A . 33 TRP CA   1 1 
        3  2636 1 1 33 TRP CB   C   0.923  -8.684  -3.053 1.00 . A A . 33 TRP CB   1 1 
        3  2637 1 1 33 TRP CD1  C   0.567  -9.225  -5.498 1.00 . A A . 33 TRP CD1  1 1 
        3  2638 1 1 33 TRP CD2  C  -0.852  -7.711  -4.696 1.00 . A A . 33 TRP CD2  1 1 
        3  2639 1 1 33 TRP CE2  C  -1.144  -7.912  -6.057 1.00 . A A . 33 TRP CE2  1 1 
        3  2640 1 1 33 TRP CE3  C  -1.616  -6.804  -3.969 1.00 . A A . 33 TRP CE3  1 1 
        3  2641 1 1 33 TRP CG   C   0.254  -8.548  -4.373 1.00 . A A . 33 TRP CG   1 1 
        3  2642 1 1 33 TRP CH2  C  -2.909  -6.351  -5.968 1.00 . A A . 33 TRP CH2  1 1 
        3  2643 1 1 33 TRP CZ2  C  -2.171  -7.238  -6.705 1.00 . A A . 33 TRP CZ2  1 1 
        3  2644 1 1 33 TRP CZ3  C  -2.642  -6.131  -4.610 1.00 . A A . 33 TRP CZ3  1 1 
        3  2645 1 1 33 TRP H    H   0.060 -10.979  -2.805 1.00 . A A . 33 TRP H    1 1 
        3  2646 1 1 33 TRP HA   H   2.447  -9.932  -3.868 1.00 . A A . 33 TRP HA   1 1 
        3  2647 1 1 33 TRP HB2  H   0.154  -8.797  -2.320 1.00 . A A . 33 TRP HB2  1 1 
        3  2648 1 1 33 TRP HB3  H   1.485  -7.787  -2.861 1.00 . A A . 33 TRP HB3  1 1 
        3  2649 1 1 33 TRP HD1  H   1.359  -9.945  -5.549 1.00 . A A . 33 TRP HD1  1 1 
        3  2650 1 1 33 TRP HE1  H  -0.222  -9.186  -7.444 1.00 . A A . 33 TRP HE1  1 1 
        3  2651 1 1 33 TRP HE3  H  -1.420  -6.631  -2.921 1.00 . A A . 33 TRP HE3  1 1 
        3  2652 1 1 33 TRP HH2  H  -3.720  -5.804  -6.429 1.00 . A A . 33 TRP HH2  1 1 
        3  2653 1 1 33 TRP HZ2  H  -2.390  -7.398  -7.750 1.00 . A A . 33 TRP HZ2  1 1 
        3  2654 1 1 33 TRP HZ3  H  -3.244  -5.423  -4.061 1.00 . A A . 33 TRP HZ3  1 1 
        3  2655 1 1 33 TRP N    N   1.029 -11.082  -2.918 1.00 . A A . 33 TRP N    1 1 
        3  2656 1 1 33 TRP NE1  N  -0.259  -8.846  -6.528 1.00 . A A . 33 TRP NE1  1 1 
        3  2657 1 1 33 TRP O    O   3.947  -9.488  -1.882 1.00 . A A . 33 TRP O    1 1 
        3  2658 1 1 34 ILE C    C   3.726 -11.259   0.910 1.00 . A A . 34 ILE C    1 1 
        3  2659 1 1 34 ILE CA   C   2.960  -9.962   0.663 1.00 . A A . 34 ILE CA   1 1 
        3  2660 1 1 34 ILE CB   C   2.046  -9.683   1.873 1.00 . A A . 34 ILE CB   1 1 
        3  2661 1 1 34 ILE CD1  C  -0.080  -8.427   2.491 1.00 . A A . 34 ILE CD1  1 1 
        3  2662 1 1 34 ILE CG1  C   1.129  -8.495   1.581 1.00 . A A . 34 ILE CG1  1 1 
        3  2663 1 1 34 ILE CG2  C   2.879  -9.424   3.119 1.00 . A A . 34 ILE CG2  1 1 
        3  2664 1 1 34 ILE H    H   1.245 -10.261  -0.540 1.00 . A A . 34 ILE H    1 1 
        3  2665 1 1 34 ILE HA   H   3.666  -9.149   0.577 1.00 . A A . 34 ILE HA   1 1 
        3  2666 1 1 34 ILE HB   H   1.443 -10.560   2.049 1.00 . A A . 34 ILE HB   1 1 
        3  2667 1 1 34 ILE HD11 H   0.217  -8.040   3.455 1.00 . A A . 34 ILE HD11 1 1 
        3  2668 1 1 34 ILE HD12 H  -0.494  -9.416   2.612 1.00 . A A . 34 ILE HD12 1 1 
        3  2669 1 1 34 ILE HD13 H  -0.823  -7.776   2.054 1.00 . A A . 34 ILE HD13 1 1 
        3  2670 1 1 34 ILE HG12 H   1.686  -7.578   1.704 1.00 . A A . 34 ILE HG12 1 1 
        3  2671 1 1 34 ILE HG13 H   0.774  -8.562   0.563 1.00 . A A . 34 ILE HG13 1 1 
        3  2672 1 1 34 ILE HG21 H   3.569 -10.242   3.266 1.00 . A A . 34 ILE HG21 1 1 
        3  2673 1 1 34 ILE HG22 H   2.228  -9.344   3.977 1.00 . A A . 34 ILE HG22 1 1 
        3  2674 1 1 34 ILE HG23 H   3.430  -8.504   3.000 1.00 . A A . 34 ILE HG23 1 1 
        3  2675 1 1 34 ILE N    N   2.197 -10.030  -0.576 1.00 . A A . 34 ILE N    1 1 
        3  2676 1 1 34 ILE O    O   4.780 -11.256   1.545 1.00 . A A . 34 ILE O    1 1 
        3  2677 1 1 35 HIS C    C   5.175 -13.707  -0.134 1.00 . A A . 35 HIS C    1 1 
        3  2678 1 1 35 HIS CA   C   3.824 -13.666   0.564 1.00 . A A . 35 HIS CA   1 1 
        3  2679 1 1 35 HIS CB   C   2.916 -14.765   0.011 1.00 . A A . 35 HIS CB   1 1 
        3  2680 1 1 35 HIS CD2  C   1.454 -16.657   1.012 1.00 . A A . 35 HIS CD2  1 1 
        3  2681 1 1 35 HIS CE1  C   1.257 -15.869   3.049 1.00 . A A . 35 HIS CE1  1 1 
        3  2682 1 1 35 HIS CG   C   2.137 -15.489   1.064 1.00 . A A . 35 HIS CG   1 1 
        3  2683 1 1 35 HIS H    H   2.350 -12.302  -0.098 1.00 . A A . 35 HIS H    1 1 
        3  2684 1 1 35 HIS HA   H   3.976 -13.830   1.612 1.00 . A A . 35 HIS HA   1 1 
        3  2685 1 1 35 HIS HB2  H   2.211 -14.325  -0.679 1.00 . A A . 35 HIS HB2  1 1 
        3  2686 1 1 35 HIS HB3  H   3.519 -15.490  -0.514 1.00 . A A . 35 HIS HB3  1 1 
        3  2687 1 1 35 HIS HD1  H   2.373 -14.190   2.706 1.00 . A A . 35 HIS HD1  1 1 
        3  2688 1 1 35 HIS HD2  H   1.350 -17.301   0.150 1.00 . A A . 35 HIS HD2  1 1 
        3  2689 1 1 35 HIS HE1  H   0.981 -15.763   4.087 1.00 . A A . 35 HIS HE1  1 1 
        3  2690 1 1 35 HIS HE2  H   0.441 -17.678   2.542 1.00 . A A . 35 HIS HE2  1 1 
        3  2691 1 1 35 HIS N    N   3.191 -12.363   0.400 1.00 . A A . 35 HIS N    1 1 
        3  2692 1 1 35 HIS ND1  N   1.993 -15.021   2.353 1.00 . A A . 35 HIS ND1  1 1 
        3  2693 1 1 35 HIS NE2  N   0.917 -16.870   2.258 1.00 . A A . 35 HIS NE2  1 1 
        3  2694 1 1 35 HIS O    O   6.202 -13.995   0.479 1.00 . A A . 35 HIS O    1 1 
        3  2695 1 1 36 ALA C    C   7.306 -12.279  -1.825 1.00 . A A . 36 ALA C    1 1 
        3  2696 1 1 36 ALA CA   C   6.367 -13.413  -2.231 1.00 . A A . 36 ALA CA   1 1 
        3  2697 1 1 36 ALA CB   C   6.014 -13.306  -3.706 1.00 . A A . 36 ALA CB   1 1 
        3  2698 1 1 36 ALA H    H   4.298 -13.197  -1.837 1.00 . A A . 36 ALA H    1 1 
        3  2699 1 1 36 ALA HA   H   6.870 -14.353  -2.074 1.00 . A A . 36 ALA HA   1 1 
        3  2700 1 1 36 ALA HB1  H   6.878 -13.558  -4.302 1.00 . A A . 36 ALA HB1  1 1 
        3  2701 1 1 36 ALA HB2  H   5.703 -12.294  -3.929 1.00 . A A . 36 ALA HB2  1 1 
        3  2702 1 1 36 ALA HB3  H   5.207 -13.987  -3.933 1.00 . A A . 36 ALA HB3  1 1 
        3  2703 1 1 36 ALA N    N   5.154 -13.415  -1.420 1.00 . A A . 36 ALA N    1 1 
        3  2704 1 1 36 ALA O    O   8.499 -12.314  -2.122 1.00 . A A . 36 ALA O    1 1 
        3  2705 1 1 37 GLY C    C   7.582  -9.024  -1.722 1.00 . A A . 37 GLY C    1 1 
        3  2706 1 1 37 GLY CA   C   7.566 -10.152  -0.709 1.00 . A A . 37 GLY CA   1 1 
        3  2707 1 1 37 GLY H    H   5.804 -11.303  -0.935 1.00 . A A . 37 GLY H    1 1 
        3  2708 1 1 37 GLY HA2  H   7.169  -9.778   0.223 1.00 . A A . 37 GLY HA2  1 1 
        3  2709 1 1 37 GLY HA3  H   8.579 -10.489  -0.547 1.00 . A A . 37 GLY HA3  1 1 
        3  2710 1 1 37 GLY N    N   6.761 -11.278  -1.144 1.00 . A A . 37 GLY N    1 1 
        3  2711 1 1 37 GLY O    O   8.546  -8.262  -1.798 1.00 . A A . 37 GLY O    1 1 
        3  2712 1 1 38 ARG C    C   6.349  -6.493  -2.870 1.00 . A A . 38 ARG C    1 1 
        3  2713 1 1 38 ARG CA   C   6.405  -7.874  -3.515 1.00 . A A . 38 ARG CA   1 1 
        3  2714 1 1 38 ARG CB   C   5.164  -8.097  -4.380 1.00 . A A . 38 ARG CB   1 1 
        3  2715 1 1 38 ARG CD   C   6.437  -7.849  -6.535 1.00 . A A . 38 ARG CD   1 1 
        3  2716 1 1 38 ARG CG   C   5.227  -7.398  -5.729 1.00 . A A . 38 ARG CG   1 1 
        3  2717 1 1 38 ARG CZ   C   8.630  -6.957  -7.217 1.00 . A A . 38 ARG CZ   1 1 
        3  2718 1 1 38 ARG H    H   5.775  -9.553  -2.394 1.00 . A A . 38 ARG H    1 1 
        3  2719 1 1 38 ARG HA   H   7.284  -7.929  -4.141 1.00 . A A . 38 ARG HA   1 1 
        3  2720 1 1 38 ARG HB2  H   5.045  -9.156  -4.552 1.00 . A A . 38 ARG HB2  1 1 
        3  2721 1 1 38 ARG HB3  H   4.299  -7.728  -3.849 1.00 . A A . 38 ARG HB3  1 1 
        3  2722 1 1 38 ARG HD2  H   6.900  -8.684  -6.032 1.00 . A A . 38 ARG HD2  1 1 
        3  2723 1 1 38 ARG HD3  H   6.102  -8.159  -7.514 1.00 . A A . 38 ARG HD3  1 1 
        3  2724 1 1 38 ARG HE   H   7.170  -5.886  -6.377 1.00 . A A . 38 ARG HE   1 1 
        3  2725 1 1 38 ARG HG2  H   4.331  -7.628  -6.286 1.00 . A A . 38 ARG HG2  1 1 
        3  2726 1 1 38 ARG HG3  H   5.290  -6.332  -5.568 1.00 . A A . 38 ARG HG3  1 1 
        3  2727 1 1 38 ARG HH11 H   8.380  -8.933  -7.575 1.00 . A A . 38 ARG HH11 1 1 
        3  2728 1 1 38 ARG HH12 H   9.915  -8.282  -8.046 1.00 . A A . 38 ARG HH12 1 1 
        3  2729 1 1 38 ARG HH21 H   9.188  -5.027  -6.998 1.00 . A A . 38 ARG HH21 1 1 
        3  2730 1 1 38 ARG HH22 H  10.374  -6.064  -7.717 1.00 . A A . 38 ARG HH22 1 1 
        3  2731 1 1 38 ARG N    N   6.512  -8.916  -2.502 1.00 . A A . 38 ARG N    1 1 
        3  2732 1 1 38 ARG NE   N   7.421  -6.781  -6.687 1.00 . A A . 38 ARG NE   1 1 
        3  2733 1 1 38 ARG NH1  N   9.006  -8.155  -7.648 1.00 . A A . 38 ARG NH1  1 1 
        3  2734 1 1 38 ARG NH2  N   9.465  -5.932  -7.319 1.00 . A A . 38 ARG NH2  1 1 
        3  2735 1 1 38 ARG O    O   5.375  -6.148  -2.201 1.00 . A A . 38 ARG O    1 1 
        3  2736 1 1 39 LYS C    C   6.534  -3.412  -3.257 1.00 . A A . 39 LYS C    1 1 
        3  2737 1 1 39 LYS CA   C   7.469  -4.361  -2.514 1.00 . A A . 39 LYS CA   1 1 
        3  2738 1 1 39 LYS CB   C   8.906  -3.835  -2.569 1.00 . A A . 39 LYS CB   1 1 
        3  2739 1 1 39 LYS CD   C  10.415  -2.532  -1.033 1.00 . A A . 39 LYS CD   1 1 
        3  2740 1 1 39 LYS CE   C  11.880  -2.848  -0.775 1.00 . A A . 39 LYS CE   1 1 
        3  2741 1 1 39 LYS CG   C   9.591  -3.799  -1.212 1.00 . A A . 39 LYS CG   1 1 
        3  2742 1 1 39 LYS H    H   8.146  -6.035  -3.618 1.00 . A A . 39 LYS H    1 1 
        3  2743 1 1 39 LYS HA   H   7.157  -4.418  -1.481 1.00 . A A . 39 LYS HA   1 1 
        3  2744 1 1 39 LYS HB2  H   9.484  -4.472  -3.223 1.00 . A A . 39 LYS HB2  1 1 
        3  2745 1 1 39 LYS HB3  H   8.898  -2.834  -2.973 1.00 . A A . 39 LYS HB3  1 1 
        3  2746 1 1 39 LYS HD2  H  10.340  -1.934  -1.929 1.00 . A A . 39 LYS HD2  1 1 
        3  2747 1 1 39 LYS HD3  H  10.022  -1.975  -0.193 1.00 . A A . 39 LYS HD3  1 1 
        3  2748 1 1 39 LYS HE2  H  11.950  -3.836  -0.344 1.00 . A A . 39 LYS HE2  1 1 
        3  2749 1 1 39 LYS HE3  H  12.410  -2.828  -1.716 1.00 . A A . 39 LYS HE3  1 1 
        3  2750 1 1 39 LYS HG2  H   8.838  -3.838  -0.439 1.00 . A A . 39 LYS HG2  1 1 
        3  2751 1 1 39 LYS HG3  H  10.242  -4.657  -1.126 1.00 . A A . 39 LYS HG3  1 1 
        3  2752 1 1 39 LYS HZ1  H  13.379  -2.262   0.557 1.00 . A A . 39 LYS HZ1  1 1 
        3  2753 1 1 39 LYS HZ2  H  11.850  -1.646   0.934 1.00 . A A . 39 LYS HZ2  1 1 
        3  2754 1 1 39 LYS HZ3  H  12.733  -0.989  -0.351 1.00 . A A . 39 LYS HZ3  1 1 
        3  2755 1 1 39 LYS N    N   7.400  -5.704  -3.075 1.00 . A A . 39 LYS N    1 1 
        3  2756 1 1 39 LYS NZ   N  12.504  -1.869   0.156 1.00 . A A . 39 LYS NZ   1 1 
        3  2757 1 1 39 LYS O    O   6.813  -3.010  -4.388 1.00 . A A . 39 LYS O    1 1 
        3  2758 1 1 40 ILE C    C   4.112  -1.011  -2.262 1.00 . A A . 40 ILE C    1 1 
        3  2759 1 1 40 ILE CA   C   4.453  -2.153  -3.212 1.00 . A A . 40 ILE CA   1 1 
        3  2760 1 1 40 ILE CB   C   3.157  -2.894  -3.590 1.00 . A A . 40 ILE CB   1 1 
        3  2761 1 1 40 ILE CD1  C   2.254  -4.882  -4.902 1.00 . A A . 40 ILE CD1  1 1 
        3  2762 1 1 40 ILE CG1  C   3.480  -4.142  -4.414 1.00 . A A . 40 ILE CG1  1 1 
        3  2763 1 1 40 ILE CG2  C   2.220  -1.972  -4.356 1.00 . A A . 40 ILE CG2  1 1 
        3  2764 1 1 40 ILE H    H   5.264  -3.408  -1.714 1.00 . A A . 40 ILE H    1 1 
        3  2765 1 1 40 ILE HA   H   4.885  -1.744  -4.114 1.00 . A A . 40 ILE HA   1 1 
        3  2766 1 1 40 ILE HB   H   2.662  -3.193  -2.678 1.00 . A A . 40 ILE HB   1 1 
        3  2767 1 1 40 ILE HD11 H   1.663  -4.226  -5.524 1.00 . A A . 40 ILE HD11 1 1 
        3  2768 1 1 40 ILE HD12 H   1.664  -5.199  -4.053 1.00 . A A . 40 ILE HD12 1 1 
        3  2769 1 1 40 ILE HD13 H   2.556  -5.745  -5.474 1.00 . A A . 40 ILE HD13 1 1 
        3  2770 1 1 40 ILE HG12 H   4.059  -3.855  -5.280 1.00 . A A . 40 ILE HG12 1 1 
        3  2771 1 1 40 ILE HG13 H   4.062  -4.824  -3.810 1.00 . A A . 40 ILE HG13 1 1 
        3  2772 1 1 40 ILE HG21 H   1.401  -2.547  -4.765 1.00 . A A . 40 ILE HG21 1 1 
        3  2773 1 1 40 ILE HG22 H   2.761  -1.496  -5.161 1.00 . A A . 40 ILE HG22 1 1 
        3  2774 1 1 40 ILE HG23 H   1.831  -1.218  -3.688 1.00 . A A . 40 ILE HG23 1 1 
        3  2775 1 1 40 ILE N    N   5.429  -3.056  -2.614 1.00 . A A . 40 ILE N    1 1 
        3  2776 1 1 40 ILE O    O   4.326  -1.108  -1.054 1.00 . A A . 40 ILE O    1 1 
        3  2777 1 1 41 PHE C    C   1.879   1.817  -2.481 1.00 . A A . 41 PHE C    1 1 
        3  2778 1 1 41 PHE CA   C   3.208   1.234  -2.015 1.00 . A A . 41 PHE CA   1 1 
        3  2779 1 1 41 PHE CB   C   4.296   2.305  -2.086 1.00 . A A . 41 PHE CB   1 1 
        3  2780 1 1 41 PHE CD1  C   5.814   2.075  -0.102 1.00 . A A . 41 PHE CD1  1 1 
        3  2781 1 1 41 PHE CD2  C   6.593   1.303  -2.219 1.00 . A A . 41 PHE CD2  1 1 
        3  2782 1 1 41 PHE CE1  C   7.006   1.690   0.481 1.00 . A A . 41 PHE CE1  1 1 
        3  2783 1 1 41 PHE CE2  C   7.788   0.916  -1.642 1.00 . A A . 41 PHE CE2  1 1 
        3  2784 1 1 41 PHE CG   C   5.593   1.885  -1.457 1.00 . A A . 41 PHE CG   1 1 
        3  2785 1 1 41 PHE CZ   C   7.994   1.110  -0.290 1.00 . A A . 41 PHE CZ   1 1 
        3  2786 1 1 41 PHE H    H   3.430   0.093  -3.785 1.00 . A A . 41 PHE H    1 1 
        3  2787 1 1 41 PHE HA   H   3.103   0.907  -0.991 1.00 . A A . 41 PHE HA   1 1 
        3  2788 1 1 41 PHE HB2  H   4.491   2.541  -3.122 1.00 . A A . 41 PHE HB2  1 1 
        3  2789 1 1 41 PHE HB3  H   3.949   3.193  -1.579 1.00 . A A . 41 PHE HB3  1 1 
        3  2790 1 1 41 PHE HD1  H   5.041   2.528   0.502 1.00 . A A . 41 PHE HD1  1 1 
        3  2791 1 1 41 PHE HD2  H   6.433   1.151  -3.276 1.00 . A A . 41 PHE HD2  1 1 
        3  2792 1 1 41 PHE HE1  H   7.164   1.844   1.538 1.00 . A A . 41 PHE HE1  1 1 
        3  2793 1 1 41 PHE HE2  H   8.558   0.462  -2.246 1.00 . A A . 41 PHE HE2  1 1 
        3  2794 1 1 41 PHE HZ   H   8.927   0.809   0.164 1.00 . A A . 41 PHE HZ   1 1 
        3  2795 1 1 41 PHE N    N   3.578   0.073  -2.817 1.00 . A A . 41 PHE N    1 1 
        3  2796 1 1 41 PHE O    O   1.766   2.317  -3.601 1.00 . A A . 41 PHE O    1 1 
        3  2797 1 1 42 LEU C    C  -0.607   3.702  -1.409 1.00 . A A . 42 LEU C    1 1 
        3  2798 1 1 42 LEU CA   C  -0.446   2.278  -1.932 1.00 . A A . 42 LEU CA   1 1 
        3  2799 1 1 42 LEU CB   C  -1.544   1.375  -1.358 1.00 . A A . 42 LEU CB   1 1 
        3  2800 1 1 42 LEU CD1  C  -0.218  -0.459  -0.247 1.00 . A A . 42 LEU CD1  1 1 
        3  2801 1 1 42 LEU CD2  C  -0.706   1.668   1.001 1.00 . A A . 42 LEU CD2  1 1 
        3  2802 1 1 42 LEU CG   C  -1.215   0.673  -0.035 1.00 . A A . 42 LEU CG   1 1 
        3  2803 1 1 42 LEU H    H   1.027   1.346  -0.737 1.00 . A A . 42 LEU H    1 1 
        3  2804 1 1 42 LEU HA   H  -0.537   2.294  -3.008 1.00 . A A . 42 LEU HA   1 1 
        3  2805 1 1 42 LEU HB2  H  -2.427   1.979  -1.207 1.00 . A A . 42 LEU HB2  1 1 
        3  2806 1 1 42 LEU HB3  H  -1.772   0.617  -2.092 1.00 . A A . 42 LEU HB3  1 1 
        3  2807 1 1 42 LEU HD11 H   0.140  -0.438  -1.266 1.00 . A A . 42 LEU HD11 1 1 
        3  2808 1 1 42 LEU HD12 H  -0.702  -1.406  -0.056 1.00 . A A . 42 LEU HD12 1 1 
        3  2809 1 1 42 LEU HD13 H   0.615  -0.338   0.430 1.00 . A A . 42 LEU HD13 1 1 
        3  2810 1 1 42 LEU HD21 H  -0.465   1.144   1.913 1.00 . A A . 42 LEU HD21 1 1 
        3  2811 1 1 42 LEU HD22 H  -1.472   2.403   1.200 1.00 . A A . 42 LEU HD22 1 1 
        3  2812 1 1 42 LEU HD23 H   0.176   2.163   0.627 1.00 . A A . 42 LEU HD23 1 1 
        3  2813 1 1 42 LEU HG   H  -2.116   0.234   0.351 1.00 . A A . 42 LEU HG   1 1 
        3  2814 1 1 42 LEU N    N   0.875   1.752  -1.613 1.00 . A A . 42 LEU N    1 1 
        3  2815 1 1 42 LEU O    O  -0.051   4.061  -0.374 1.00 . A A . 42 LEU O    1 1 
        3  2816 1 1 43 THR C    C  -3.040   6.096  -1.273 1.00 . A A . 43 THR C    1 1 
        3  2817 1 1 43 THR CA   C  -1.604   5.895  -1.747 1.00 . A A . 43 THR CA   1 1 
        3  2818 1 1 43 THR CB   C  -1.304   6.832  -2.917 1.00 . A A . 43 THR CB   1 1 
        3  2819 1 1 43 THR CG2  C  -1.149   8.279  -2.500 1.00 . A A . 43 THR CG2  1 1 
        3  2820 1 1 43 THR H    H  -1.787   4.167  -2.956 1.00 . A A . 43 THR H    1 1 
        3  2821 1 1 43 THR HA   H  -0.934   6.126  -0.932 1.00 . A A . 43 THR HA   1 1 
        3  2822 1 1 43 THR HB   H  -2.119   6.778  -3.625 1.00 . A A . 43 THR HB   1 1 
        3  2823 1 1 43 THR HG1  H   0.641   6.612  -3.007 1.00 . A A . 43 THR HG1  1 1 
        3  2824 1 1 43 THR HG21 H  -1.941   8.868  -2.939 1.00 . A A . 43 THR HG21 1 1 
        3  2825 1 1 43 THR HG22 H  -0.194   8.652  -2.841 1.00 . A A . 43 THR HG22 1 1 
        3  2826 1 1 43 THR HG23 H  -1.200   8.352  -1.424 1.00 . A A . 43 THR HG23 1 1 
        3  2827 1 1 43 THR N    N  -1.371   4.510  -2.136 1.00 . A A . 43 THR N    1 1 
        3  2828 1 1 43 THR O    O  -3.989   5.784  -1.991 1.00 . A A . 43 THR O    1 1 
        3  2829 1 1 43 THR OG1  O  -0.113   6.445  -3.579 1.00 . A A . 43 THR OG1  1 1 
        3  2830 1 1 44 ILE C    C  -5.069   8.203   0.038 1.00 . A A . 44 ILE C    1 1 
        3  2831 1 1 44 ILE CA   C  -4.509   6.866   0.506 1.00 . A A . 44 ILE CA   1 1 
        3  2832 1 1 44 ILE CB   C  -4.472   6.846   2.046 1.00 . A A . 44 ILE CB   1 1 
        3  2833 1 1 44 ILE CD1  C  -3.701   5.483   4.055 1.00 . A A . 44 ILE CD1  1 1 
        3  2834 1 1 44 ILE CG1  C  -3.758   5.589   2.545 1.00 . A A . 44 ILE CG1  1 1 
        3  2835 1 1 44 ILE CG2  C  -5.883   6.921   2.610 1.00 . A A . 44 ILE CG2  1 1 
        3  2836 1 1 44 ILE H    H  -2.391   6.850   0.462 1.00 . A A . 44 ILE H    1 1 
        3  2837 1 1 44 ILE HA   H  -5.165   6.075   0.174 1.00 . A A . 44 ILE HA   1 1 
        3  2838 1 1 44 ILE HB   H  -3.929   7.717   2.382 1.00 . A A . 44 ILE HB   1 1 
        3  2839 1 1 44 ILE HD11 H  -3.219   4.557   4.332 1.00 . A A . 44 ILE HD11 1 1 
        3  2840 1 1 44 ILE HD12 H  -4.704   5.501   4.454 1.00 . A A . 44 ILE HD12 1 1 
        3  2841 1 1 44 ILE HD13 H  -3.139   6.315   4.453 1.00 . A A . 44 ILE HD13 1 1 
        3  2842 1 1 44 ILE HG12 H  -4.274   4.717   2.172 1.00 . A A . 44 ILE HG12 1 1 
        3  2843 1 1 44 ILE HG13 H  -2.743   5.587   2.173 1.00 . A A . 44 ILE HG13 1 1 
        3  2844 1 1 44 ILE HG21 H  -6.416   6.014   2.367 1.00 . A A . 44 ILE HG21 1 1 
        3  2845 1 1 44 ILE HG22 H  -6.398   7.768   2.181 1.00 . A A . 44 ILE HG22 1 1 
        3  2846 1 1 44 ILE HG23 H  -5.836   7.035   3.685 1.00 . A A . 44 ILE HG23 1 1 
        3  2847 1 1 44 ILE N    N  -3.188   6.621  -0.062 1.00 . A A . 44 ILE N    1 1 
        3  2848 1 1 44 ILE O    O  -4.426   9.243   0.185 1.00 . A A . 44 ILE O    1 1 
        3  2849 1 1 45 ASN C    C  -7.691  10.077   0.099 1.00 . A A . 45 ASN C    1 1 
        3  2850 1 1 45 ASN CA   C  -6.919   9.381  -1.018 1.00 . A A . 45 ASN CA   1 1 
        3  2851 1 1 45 ASN CB   C  -7.864   9.046  -2.173 1.00 . A A . 45 ASN CB   1 1 
        3  2852 1 1 45 ASN CG   C  -7.171   8.278  -3.283 1.00 . A A . 45 ASN CG   1 1 
        3  2853 1 1 45 ASN H    H  -6.734   7.310  -0.616 1.00 . A A . 45 ASN H    1 1 
        3  2854 1 1 45 ASN HA   H  -6.149  10.048  -1.377 1.00 . A A . 45 ASN HA   1 1 
        3  2855 1 1 45 ASN HB2  H  -8.680   8.445  -1.801 1.00 . A A . 45 ASN HB2  1 1 
        3  2856 1 1 45 ASN HB3  H  -8.257   9.964  -2.587 1.00 . A A . 45 ASN HB3  1 1 
        3  2857 1 1 45 ASN HD21 H  -8.908   8.029  -4.223 1.00 . A A . 45 ASN HD21 1 1 
        3  2858 1 1 45 ASN HD22 H  -7.519   7.333  -5.001 1.00 . A A . 45 ASN HD22 1 1 
        3  2859 1 1 45 ASN N    N  -6.271   8.170  -0.527 1.00 . A A . 45 ASN N    1 1 
        3  2860 1 1 45 ASN ND2  N  -7.944   7.835  -4.267 1.00 . A A . 45 ASN ND2  1 1 
        3  2861 1 1 45 ASN O    O  -7.854   9.529   1.189 1.00 . A A . 45 ASN O    1 1 
        3  2862 1 1 45 ASN OD1  O  -5.956   8.085  -3.253 1.00 . A A . 45 ASN OD1  1 1 
        3  2863 1 1 46 ALA C    C -10.380  11.628   0.847 1.00 . A A . 46 ALA C    1 1 
        3  2864 1 1 46 ALA CA   C  -8.918  12.058   0.801 1.00 . A A . 46 ALA CA   1 1 
        3  2865 1 1 46 ALA CB   C  -8.815  13.545   0.493 1.00 . A A . 46 ALA CB   1 1 
        3  2866 1 1 46 ALA H    H  -8.000  11.671  -1.067 1.00 . A A . 46 ALA H    1 1 
        3  2867 1 1 46 ALA HA   H  -8.474  11.886   1.770 1.00 . A A . 46 ALA HA   1 1 
        3  2868 1 1 46 ALA HB1  H  -9.702  13.866  -0.033 1.00 . A A . 46 ALA HB1  1 1 
        3  2869 1 1 46 ALA HB2  H  -7.946  13.725  -0.123 1.00 . A A . 46 ALA HB2  1 1 
        3  2870 1 1 46 ALA HB3  H  -8.724  14.099   1.415 1.00 . A A . 46 ALA HB3  1 1 
        3  2871 1 1 46 ALA N    N  -8.162  11.288  -0.180 1.00 . A A . 46 ALA N    1 1 
        3  2872 1 1 46 ALA O    O -11.160  12.157   1.634 1.00 . A A . 46 ALA O    1 1 
        3  2873 1 1 47 ASP C    C -12.220   8.793   0.599 1.00 . A A . 47 ASP C    1 1 
        3  2874 1 1 47 ASP CA   C -12.120  10.172  -0.047 1.00 . A A . 47 ASP CA   1 1 
        3  2875 1 1 47 ASP CB   C -12.620  10.108  -1.495 1.00 . A A . 47 ASP CB   1 1 
        3  2876 1 1 47 ASP CG   C -11.500  10.091  -2.520 1.00 . A A . 47 ASP CG   1 1 
        3  2877 1 1 47 ASP H    H -10.080  10.279  -0.602 1.00 . A A . 47 ASP H    1 1 
        3  2878 1 1 47 ASP HA   H -12.730  10.860   0.507 1.00 . A A . 47 ASP HA   1 1 
        3  2879 1 1 47 ASP HB2  H -13.200   9.209  -1.622 1.00 . A A . 47 ASP HB2  1 1 
        3  2880 1 1 47 ASP HB3  H -13.240  10.969  -1.687 1.00 . A A . 47 ASP HB3  1 1 
        3  2881 1 1 47 ASP N    N -10.740  10.666   0.002 1.00 . A A . 47 ASP N    1 1 
        3  2882 1 1 47 ASP O    O -13.310   8.367   0.995 1.00 . A A . 47 ASP O    1 1 
        3  2883 1 1 47 ASP OD1  O -10.840   9.038  -2.666 1.00 . A A . 47 ASP OD1  1 1 
        3  2884 1 1 47 ASP OD2  O -11.280  11.132  -3.177 1.00 . A A . 47 ASP OD2  1 1 
        3  2885 1 1 48 GLY C    C -10.650   5.701   0.317 1.00 . A A . 48 GLY C    1 1 
        3  2886 1 1 48 GLY CA   C -11.080   6.778   1.296 1.00 . A A . 48 GLY CA   1 1 
        3  2887 1 1 48 GLY H    H -10.260   8.491   0.366 1.00 . A A . 48 GLY H    1 1 
        3  2888 1 1 48 GLY HA2  H -10.400   6.780   2.134 1.00 . A A . 48 GLY HA2  1 1 
        3  2889 1 1 48 GLY HA3  H -12.080   6.548   1.652 1.00 . A A . 48 GLY HA3  1 1 
        3  2890 1 1 48 GLY N    N -11.100   8.102   0.701 1.00 . A A . 48 GLY N    1 1 
        3  2891 1 1 48 GLY O    O -10.730   4.512   0.622 1.00 . A A . 48 GLY O    1 1 
        3  2892 1 1 49 SER C    C  -8.252   4.957  -1.805 1.00 . A A . 49 SER C    1 1 
        3  2893 1 1 49 SER CA   C  -9.760   5.173  -1.883 1.00 . A A . 49 SER CA   1 1 
        3  2894 1 1 49 SER CB   C -10.140   5.675  -3.271 1.00 . A A . 49 SER CB   1 1 
        3  2895 1 1 49 SER H    H -10.160   7.076  -1.051 1.00 . A A . 49 SER H    1 1 
        3  2896 1 1 49 SER HA   H -10.250   4.235  -1.704 1.00 . A A . 49 SER HA   1 1 
        3  2897 1 1 49 SER HB2  H -10.630   6.633  -3.180 1.00 . A A . 49 SER HB2  1 1 
        3  2898 1 1 49 SER HB3  H  -9.261   5.775  -3.876 1.00 . A A . 49 SER HB3  1 1 
        3  2899 1 1 49 SER HG   H -11.540   5.243  -4.573 1.00 . A A . 49 SER HG   1 1 
        3  2900 1 1 49 SER N    N -10.200   6.115  -0.863 1.00 . A A . 49 SER N    1 1 
        3  2901 1 1 49 SER O    O  -7.497   5.886  -1.517 1.00 . A A . 49 SER O    1 1 
        3  2902 1 1 49 SER OG   O -11.030   4.773  -3.910 1.00 . A A . 49 SER OG   1 1 
        3  2903 1 1 50 VAL C    C  -5.982   2.636  -3.274 1.00 . A A . 50 VAL C    1 1 
        3  2904 1 1 50 VAL CA   C  -6.403   3.393  -2.019 1.00 . A A . 50 VAL CA   1 1 
        3  2905 1 1 50 VAL CB   C  -6.051   2.543  -0.781 1.00 . A A . 50 VAL CB   1 1 
        3  2906 1 1 50 VAL CG1  C  -4.615   2.800  -0.350 1.00 . A A . 50 VAL CG1  1 1 
        3  2907 1 1 50 VAL CG2  C  -7.012   2.824   0.366 1.00 . A A . 50 VAL CG2  1 1 
        3  2908 1 1 50 VAL H    H  -8.471   3.029  -2.286 1.00 . A A . 50 VAL H    1 1 
        3  2909 1 1 50 VAL HA   H  -5.844   4.317  -1.966 1.00 . A A . 50 VAL HA   1 1 
        3  2910 1 1 50 VAL HB   H  -6.139   1.501  -1.048 1.00 . A A . 50 VAL HB   1 1 
        3  2911 1 1 50 VAL HG11 H  -4.042   3.148  -1.196 1.00 . A A . 50 VAL HG11 1 1 
        3  2912 1 1 50 VAL HG12 H  -4.184   1.885   0.027 1.00 . A A . 50 VAL HG12 1 1 
        3  2913 1 1 50 VAL HG13 H  -4.602   3.552   0.426 1.00 . A A . 50 VAL HG13 1 1 
        3  2914 1 1 50 VAL HG21 H  -7.820   2.107   0.343 1.00 . A A . 50 VAL HG21 1 1 
        3  2915 1 1 50 VAL HG22 H  -7.414   3.821   0.263 1.00 . A A . 50 VAL HG22 1 1 
        3  2916 1 1 50 VAL HG23 H  -6.486   2.744   1.306 1.00 . A A . 50 VAL HG23 1 1 
        3  2917 1 1 50 VAL N    N  -7.820   3.728  -2.062 1.00 . A A . 50 VAL N    1 1 
        3  2918 1 1 50 VAL O    O  -6.641   1.680  -3.685 1.00 . A A . 50 VAL O    1 1 
        3  2919 1 1 51 TYR C    C  -2.901   2.061  -4.936 1.00 . A A . 51 TYR C    1 1 
        3  2920 1 1 51 TYR CA   C  -4.373   2.430  -5.089 1.00 . A A . 51 TYR CA   1 1 
        3  2921 1 1 51 TYR CB   C  -4.558   3.354  -6.296 1.00 . A A . 51 TYR CB   1 1 
        3  2922 1 1 51 TYR CD1  C  -2.394   4.612  -6.632 1.00 . A A . 51 TYR CD1  1 1 
        3  2923 1 1 51 TYR CD2  C  -4.268   5.807  -5.769 1.00 . A A . 51 TYR CD2  1 1 
        3  2924 1 1 51 TYR CE1  C  -1.629   5.760  -6.573 1.00 . A A . 51 TYR CE1  1 1 
        3  2925 1 1 51 TYR CE2  C  -3.510   6.960  -5.709 1.00 . A A . 51 TYR CE2  1 1 
        3  2926 1 1 51 TYR CG   C  -3.724   4.614  -6.230 1.00 . A A . 51 TYR CG   1 1 
        3  2927 1 1 51 TYR CZ   C  -2.191   6.932  -6.112 1.00 . A A . 51 TYR CZ   1 1 
        3  2928 1 1 51 TYR H    H  -4.398   3.836  -3.506 1.00 . A A . 51 TYR H    1 1 
        3  2929 1 1 51 TYR HA   H  -4.943   1.527  -5.251 1.00 . A A . 51 TYR HA   1 1 
        3  2930 1 1 51 TYR HB2  H  -4.282   2.821  -7.194 1.00 . A A . 51 TYR HB2  1 1 
        3  2931 1 1 51 TYR HB3  H  -5.596   3.645  -6.361 1.00 . A A . 51 TYR HB3  1 1 
        3  2932 1 1 51 TYR HD1  H  -1.956   3.693  -6.993 1.00 . A A . 51 TYR HD1  1 1 
        3  2933 1 1 51 TYR HD2  H  -5.300   5.825  -5.454 1.00 . A A . 51 TYR HD2  1 1 
        3  2934 1 1 51 TYR HE1  H  -0.596   5.739  -6.890 1.00 . A A . 51 TYR HE1  1 1 
        3  2935 1 1 51 TYR HE2  H  -3.950   7.878  -5.346 1.00 . A A . 51 TYR HE2  1 1 
        3  2936 1 1 51 TYR HH   H  -1.572   8.512  -5.207 1.00 . A A . 51 TYR HH   1 1 
        3  2937 1 1 51 TYR N    N  -4.880   3.069  -3.880 1.00 . A A . 51 TYR N    1 1 
        3  2938 1 1 51 TYR O    O  -2.086   2.883  -4.516 1.00 . A A . 51 TYR O    1 1 
        3  2939 1 1 51 TYR OH   O  -1.432   8.078  -6.052 1.00 . A A . 51 TYR OH   1 1 
        3  2940 1 1 52 ALA C    C  -0.396   0.702  -6.427 1.00 . A A . 52 ALA C    1 1 
        3  2941 1 1 52 ALA CA   C  -1.195   0.343  -5.179 1.00 . A A . 52 ALA CA   1 1 
        3  2942 1 1 52 ALA CB   C  -1.175  -1.161  -4.953 1.00 . A A . 52 ALA CB   1 1 
        3  2943 1 1 52 ALA H    H  -3.263   0.212  -5.606 1.00 . A A . 52 ALA H    1 1 
        3  2944 1 1 52 ALA HA   H  -0.738   0.818  -4.322 1.00 . A A . 52 ALA HA   1 1 
        3  2945 1 1 52 ALA HB1  H  -0.265  -1.576  -5.361 1.00 . A A . 52 ALA HB1  1 1 
        3  2946 1 1 52 ALA HB2  H  -2.026  -1.610  -5.443 1.00 . A A . 52 ALA HB2  1 1 
        3  2947 1 1 52 ALA HB3  H  -1.219  -1.367  -3.893 1.00 . A A . 52 ALA HB3  1 1 
        3  2948 1 1 52 ALA N    N  -2.568   0.821  -5.279 1.00 . A A . 52 ALA N    1 1 
        3  2949 1 1 52 ALA O    O  -0.809   0.404  -7.547 1.00 . A A . 52 ALA O    1 1 
        3  2950 1 1 53 GLU C    C   2.961   1.049  -7.257 1.00 . A A . 53 GLU C    1 1 
        3  2951 1 1 53 GLU CA   C   1.607   1.747  -7.336 1.00 . A A . 53 GLU CA   1 1 
        3  2952 1 1 53 GLU CB   C   1.801   3.264  -7.337 1.00 . A A . 53 GLU CB   1 1 
        3  2953 1 1 53 GLU CD   C   3.125   5.162  -6.327 1.00 . A A . 53 GLU CD   1 1 
        3  2954 1 1 53 GLU CG   C   2.529   3.785  -6.109 1.00 . A A . 53 GLU CG   1 1 
        3  2955 1 1 53 GLU H    H   1.025   1.556  -5.309 1.00 . A A . 53 GLU H    1 1 
        3  2956 1 1 53 GLU HA   H   1.118   1.455  -8.254 1.00 . A A . 53 GLU HA   1 1 
        3  2957 1 1 53 GLU HB2  H   2.371   3.542  -8.212 1.00 . A A . 53 GLU HB2  1 1 
        3  2958 1 1 53 GLU HB3  H   0.832   3.739  -7.383 1.00 . A A . 53 GLU HB3  1 1 
        3  2959 1 1 53 GLU HG2  H   1.831   3.837  -5.288 1.00 . A A . 53 GLU HG2  1 1 
        3  2960 1 1 53 GLU HG3  H   3.325   3.100  -5.861 1.00 . A A . 53 GLU HG3  1 1 
        3  2961 1 1 53 GLU N    N   0.750   1.346  -6.226 1.00 . A A . 53 GLU N    1 1 
        3  2962 1 1 53 GLU O    O   3.277   0.395  -6.263 1.00 . A A . 53 GLU O    1 1 
        3  2963 1 1 53 GLU OE1  O   2.373   6.156  -6.232 1.00 . A A . 53 GLU OE1  1 1 
        3  2964 1 1 53 GLU OE2  O   4.341   5.249  -6.593 1.00 . A A . 53 GLU OE2  1 1 
        3  2965 1 1 54 GLU C    C   6.161   1.626  -8.578 1.00 . A A . 54 GLU C    1 1 
        3  2966 1 1 54 GLU CA   C   5.078   0.575  -8.364 1.00 . A A . 54 GLU CA   1 1 
        3  2967 1 1 54 GLU CB   C   5.132  -0.468  -9.482 1.00 . A A . 54 GLU CB   1 1 
        3  2968 1 1 54 GLU CD   C   7.178  -1.861  -9.992 1.00 . A A . 54 GLU CD   1 1 
        3  2969 1 1 54 GLU CG   C   5.945  -1.701  -9.124 1.00 . A A . 54 GLU CG   1 1 
        3  2970 1 1 54 GLU H    H   3.448   1.725  -9.075 1.00 . A A . 54 GLU H    1 1 
        3  2971 1 1 54 GLU HA   H   5.251   0.084  -7.418 1.00 . A A . 54 GLU HA   1 1 
        3  2972 1 1 54 GLU HB2  H   4.125  -0.782  -9.715 1.00 . A A . 54 GLU HB2  1 1 
        3  2973 1 1 54 GLU HB3  H   5.570  -0.016 -10.359 1.00 . A A . 54 GLU HB3  1 1 
        3  2974 1 1 54 GLU HG2  H   6.256  -1.625  -8.093 1.00 . A A . 54 GLU HG2  1 1 
        3  2975 1 1 54 GLU HG3  H   5.322  -2.575  -9.247 1.00 . A A . 54 GLU HG3  1 1 
        3  2976 1 1 54 GLU N    N   3.758   1.192  -8.313 1.00 . A A . 54 GLU N    1 1 
        3  2977 1 1 54 GLU O    O   6.282   2.195  -9.664 1.00 . A A . 54 GLU O    1 1 
        3  2978 1 1 54 GLU OE1  O   7.106  -1.524 -11.193 1.00 . A A . 54 GLU OE1  1 1 
        3  2979 1 1 54 GLU OE2  O   8.215  -2.322  -9.471 1.00 . A A . 54 GLU OE2  1 1 
        3  2980 1 1 55 VAL C    C   9.347   2.199  -7.970 1.00 . A A . 55 VAL C    1 1 
        3  2981 1 1 55 VAL CA   C   8.020   2.863  -7.612 1.00 . A A . 55 VAL CA   1 1 
        3  2982 1 1 55 VAL CB   C   8.175   3.628  -6.282 1.00 . A A . 55 VAL CB   1 1 
        3  2983 1 1 55 VAL CG1  C   8.442   2.663  -5.133 1.00 . A A . 55 VAL CG1  1 1 
        3  2984 1 1 55 VAL CG2  C   9.277   4.672  -6.383 1.00 . A A . 55 VAL CG2  1 1 
        3  2985 1 1 55 VAL H    H   6.801   1.394  -6.699 1.00 . A A . 55 VAL H    1 1 
        3  2986 1 1 55 VAL HA   H   7.767   3.575  -8.385 1.00 . A A . 55 VAL HA   1 1 
        3  2987 1 1 55 VAL HB   H   7.245   4.139  -6.077 1.00 . A A . 55 VAL HB   1 1 
        3  2988 1 1 55 VAL HG11 H   9.321   2.981  -4.592 1.00 . A A . 55 VAL HG11 1 1 
        3  2989 1 1 55 VAL HG12 H   8.602   1.670  -5.527 1.00 . A A . 55 VAL HG12 1 1 
        3  2990 1 1 55 VAL HG13 H   7.593   2.654  -4.467 1.00 . A A . 55 VAL HG13 1 1 
        3  2991 1 1 55 VAL HG21 H   9.195   5.365  -5.560 1.00 . A A . 55 VAL HG21 1 1 
        3  2992 1 1 55 VAL HG22 H   9.180   5.208  -7.317 1.00 . A A . 55 VAL HG22 1 1 
        3  2993 1 1 55 VAL HG23 H  10.240   4.183  -6.348 1.00 . A A . 55 VAL HG23 1 1 
        3  2994 1 1 55 VAL N    N   6.946   1.880  -7.538 1.00 . A A . 55 VAL N    1 1 
        3  2995 1 1 55 VAL O    O  10.177   1.934  -7.100 1.00 . A A . 55 VAL O    1 1 
        3  2996 1 1 56 LYS C    C  11.011   1.630 -11.205 1.00 . A A . 56 LYS C    1 1 
        3  2997 1 1 56 LYS CA   C  10.768   1.303  -9.733 1.00 . A A . 56 LYS CA   1 1 
        3  2998 1 1 56 LYS CB   C  10.692  -0.213  -9.539 1.00 . A A . 56 LYS CB   1 1 
        3  2999 1 1 56 LYS CD   C  12.627  -1.688 -10.181 1.00 . A A . 56 LYS CD   1 1 
        3  3000 1 1 56 LYS CE   C  14.114  -1.408 -10.327 1.00 . A A . 56 LYS CE   1 1 
        3  3001 1 1 56 LYS CG   C  12.003  -0.837  -9.086 1.00 . A A . 56 LYS CG   1 1 
        3  3002 1 1 56 LYS H    H   8.845   2.171  -9.905 1.00 . A A . 56 LYS H    1 1 
        3  3003 1 1 56 LYS HA   H  11.587   1.691  -9.147 1.00 . A A . 56 LYS HA   1 1 
        3  3004 1 1 56 LYS HB2  H   9.939  -0.432  -8.797 1.00 . A A . 56 LYS HB2  1 1 
        3  3005 1 1 56 LYS HB3  H  10.404  -0.669 -10.475 1.00 . A A . 56 LYS HB3  1 1 
        3  3006 1 1 56 LYS HD2  H  12.490  -2.731  -9.936 1.00 . A A . 56 LYS HD2  1 1 
        3  3007 1 1 56 LYS HD3  H  12.136  -1.470 -11.119 1.00 . A A . 56 LYS HD3  1 1 
        3  3008 1 1 56 LYS HE2  H  14.563  -2.206 -10.903 1.00 . A A . 56 LYS HE2  1 1 
        3  3009 1 1 56 LYS HE3  H  14.243  -0.473 -10.851 1.00 . A A . 56 LYS HE3  1 1 
        3  3010 1 1 56 LYS HG2  H  12.691  -0.050  -8.820 1.00 . A A . 56 LYS HG2  1 1 
        3  3011 1 1 56 LYS HG3  H  11.813  -1.459  -8.224 1.00 . A A . 56 LYS HG3  1 1 
        3  3012 1 1 56 LYS HZ1  H  14.752  -0.351  -8.642 1.00 . A A . 56 LYS HZ1  1 1 
        3  3013 1 1 56 LYS HZ2  H  15.796  -1.600  -9.102 1.00 . A A . 56 LYS HZ2  1 1 
        3  3014 1 1 56 LYS HZ3  H  14.337  -1.961  -8.326 1.00 . A A . 56 LYS HZ3  1 1 
        3  3015 1 1 56 LYS N    N   9.542   1.935  -9.258 1.00 . A A . 56 LYS N    1 1 
        3  3016 1 1 56 LYS NZ   N  14.797  -1.324  -9.006 1.00 . A A . 56 LYS NZ   1 1 
        3  3017 1 1 56 LYS O    O  10.096   1.550 -12.024 1.00 . A A . 56 LYS O    1 1 
        3  3018 1 1 57 PRO C    C  12.634   1.117 -13.857 1.00 . A A . 57 PRO C    1 1 
        3  3019 1 1 57 PRO CA   C  12.603   2.343 -12.950 1.00 . A A . 57 PRO CA   1 1 
        3  3020 1 1 57 PRO CB   C  14.002   2.949 -12.824 1.00 . A A . 57 PRO CB   1 1 
        3  3021 1 1 57 PRO CD   C  13.409   2.131 -10.658 1.00 . A A . 57 PRO CD   1 1 
        3  3022 1 1 57 PRO CG   C  14.570   2.336 -11.592 1.00 . A A . 57 PRO CG   1 1 
        3  3023 1 1 57 PRO HA   H  11.925   3.076 -13.361 1.00 . A A . 57 PRO HA   1 1 
        3  3024 1 1 57 PRO HB2  H  14.585   2.698 -13.698 1.00 . A A . 57 PRO HB2  1 1 
        3  3025 1 1 57 PRO HB3  H  13.925   4.021 -12.730 1.00 . A A . 57 PRO HB3  1 1 
        3  3026 1 1 57 PRO HD2  H  13.546   1.229 -10.080 1.00 . A A . 57 PRO HD2  1 1 
        3  3027 1 1 57 PRO HD3  H  13.296   2.984 -10.005 1.00 . A A . 57 PRO HD3  1 1 
        3  3028 1 1 57 PRO HG2  H  15.030   1.387 -11.832 1.00 . A A . 57 PRO HG2  1 1 
        3  3029 1 1 57 PRO HG3  H  15.295   3.003 -11.149 1.00 . A A . 57 PRO HG3  1 1 
        3  3030 1 1 57 PRO N    N  12.253   2.006 -11.565 1.00 . A A . 57 PRO N    1 1 
        3  3031 1 1 57 PRO O    O  13.027   0.030 -13.433 1.00 . A A . 57 PRO O    1 1 
        3  3032 1 1 58 ASP C    C  12.119   0.751 -17.500 1.00 . A A . 58 ASP C    1 1 
        3  3033 1 1 58 ASP CA   C  12.199   0.211 -16.073 1.00 . A A . 58 ASP CA   1 1 
        3  3034 1 1 58 ASP CB   C  11.014  -0.719 -15.800 1.00 . A A . 58 ASP CB   1 1 
        3  3035 1 1 58 ASP CG   C  11.246  -2.121 -16.330 1.00 . A A . 58 ASP CG   1 1 
        3  3036 1 1 58 ASP H    H  11.918   2.191 -15.382 1.00 . A A . 58 ASP H    1 1 
        3  3037 1 1 58 ASP HA   H  13.117  -0.347 -15.959 1.00 . A A . 58 ASP HA   1 1 
        3  3038 1 1 58 ASP HB2  H  10.850  -0.780 -14.734 1.00 . A A . 58 ASP HB2  1 1 
        3  3039 1 1 58 ASP HB3  H  10.130  -0.314 -16.277 1.00 . A A . 58 ASP HB3  1 1 
        3  3040 1 1 58 ASP N    N  12.219   1.301 -15.104 1.00 . A A . 58 ASP N    1 1 
        3  3041 1 1 58 ASP O    O  11.304   1.628 -17.790 1.00 . A A . 58 ASP O    1 1 
        3  3042 1 1 58 ASP OD1  O  12.222  -2.766 -15.894 1.00 . A A . 58 ASP OD1  1 1 
        3  3043 1 1 58 ASP OD2  O  10.452  -2.572 -17.182 1.00 . A A . 58 ASP OD2  1 1 
        3  3044 1 1 59 PRO C    C  11.597   0.565 -20.464 1.00 . A A . 59 PRO C    1 1 
        3  3045 1 1 59 PRO CA   C  12.971   0.683 -19.813 1.00 . A A . 59 PRO CA   1 1 
        3  3046 1 1 59 PRO CB   C  13.963  -0.269 -20.489 1.00 . A A . 59 PRO CB   1 1 
        3  3047 1 1 59 PRO CD   C  13.969  -0.810 -18.163 1.00 . A A . 59 PRO CD   1 1 
        3  3048 1 1 59 PRO CG   C  14.839  -0.754 -19.386 1.00 . A A . 59 PRO CG   1 1 
        3  3049 1 1 59 PRO HA   H  13.324   1.698 -19.903 1.00 . A A . 59 PRO HA   1 1 
        3  3050 1 1 59 PRO HB2  H  13.426  -1.081 -20.955 1.00 . A A . 59 PRO HB2  1 1 
        3  3051 1 1 59 PRO HB3  H  14.530   0.269 -21.234 1.00 . A A . 59 PRO HB3  1 1 
        3  3052 1 1 59 PRO HD2  H  13.502  -1.781 -18.076 1.00 . A A . 59 PRO HD2  1 1 
        3  3053 1 1 59 PRO HD3  H  14.546  -0.586 -17.279 1.00 . A A . 59 PRO HD3  1 1 
        3  3054 1 1 59 PRO HG2  H  15.216  -1.739 -19.623 1.00 . A A . 59 PRO HG2  1 1 
        3  3055 1 1 59 PRO HG3  H  15.655  -0.064 -19.234 1.00 . A A . 59 PRO HG3  1 1 
        3  3056 1 1 59 PRO N    N  12.962   0.238 -18.414 1.00 . A A . 59 PRO N    1 1 
        3  3057 1 1 59 PRO O    O  11.275  -0.451 -21.080 1.00 . A A . 59 PRO O    1 1 
        3  3058 1 1 60 SER C    C   9.401   2.493 -22.152 1.00 . A A . 60 SER C    1 1 
        3  3059 1 1 60 SER CA   C   9.449   1.623 -20.900 1.00 . A A . 60 SER CA   1 1 
        3  3060 1 1 60 SER CB   C   8.436   2.132 -19.871 1.00 . A A . 60 SER CB   1 1 
        3  3061 1 1 60 SER H    H  11.101   2.392 -19.821 1.00 . A A . 60 SER H    1 1 
        3  3062 1 1 60 SER HA   H   9.196   0.611 -21.170 1.00 . A A . 60 SER HA   1 1 
        3  3063 1 1 60 SER HB2  H   7.457   2.175 -20.325 1.00 . A A . 60 SER HB2  1 1 
        3  3064 1 1 60 SER HB3  H   8.413   1.458 -19.028 1.00 . A A . 60 SER HB3  1 1 
        3  3065 1 1 60 SER HG   H   9.461   3.357 -18.736 1.00 . A A . 60 SER HG   1 1 
        3  3066 1 1 60 SER N    N  10.789   1.612 -20.325 1.00 . A A . 60 SER N    1 1 
        3  3067 1 1 60 SER O    O   8.632   2.226 -23.075 1.00 . A A . 60 SER O    1 1 
        3  3068 1 1 60 SER OG   O   8.782   3.427 -19.411 1.00 . A A . 60 SER OG   1 1 
        3  3069 1 1 61 ASN C    C  11.346   4.005 -24.311 1.00 . A A . 61 ASN C    1 1 
        3  3070 1 1 61 ASN CA   C  10.278   4.443 -23.314 1.00 . A A . 61 ASN CA   1 1 
        3  3071 1 1 61 ASN CB   C  10.558   5.872 -22.843 1.00 . A A . 61 ASN CB   1 1 
        3  3072 1 1 61 ASN CG   C  10.205   6.906 -23.895 1.00 . A A . 61 ASN CG   1 1 
        3  3073 1 1 61 ASN H    H  10.815   3.696 -21.407 1.00 . A A . 61 ASN H    1 1 
        3  3074 1 1 61 ASN HA   H   9.316   4.417 -23.802 1.00 . A A . 61 ASN HA   1 1 
        3  3075 1 1 61 ASN HB2  H   9.974   6.073 -21.957 1.00 . A A . 61 ASN HB2  1 1 
        3  3076 1 1 61 ASN HB3  H  11.607   5.967 -22.606 1.00 . A A . 61 ASN HB3  1 1 
        3  3077 1 1 61 ASN HD21 H  11.799   7.989 -23.395 1.00 . A A . 61 ASN HD21 1 1 
        3  3078 1 1 61 ASN HD22 H  10.815   8.633 -24.673 1.00 . A A . 61 ASN HD22 1 1 
        3  3079 1 1 61 ASN N    N  10.227   3.534 -22.175 1.00 . A A . 61 ASN N    1 1 
        3  3080 1 1 61 ASN ND2  N  11.023   7.947 -23.998 1.00 . A A . 61 ASN ND2  1 1 
        3  3081 1 1 61 ASN O    O  12.227   3.210 -23.983 1.00 . A A . 61 ASN O    1 1 
        3  3082 1 1 61 ASN OD1  O   9.209   6.769 -24.605 1.00 . A A . 61 ASN OD1  1 1 
        3  3083 1 1 62 LYS C    C  12.426   5.369 -27.526 1.00 . A A . 62 LYS C    1 1 
        3  3084 1 1 62 LYS CA   C  12.221   4.194 -26.574 1.00 . A A . 62 LYS CA   1 1 
        3  3085 1 1 62 LYS CB   C  11.747   2.965 -27.353 1.00 . A A . 62 LYS CB   1 1 
        3  3086 1 1 62 LYS CD   C  11.665   0.459 -27.516 1.00 . A A . 62 LYS CD   1 1 
        3  3087 1 1 62 LYS CE   C  12.152   0.379 -28.953 1.00 . A A . 62 LYS CE   1 1 
        3  3088 1 1 62 LYS CG   C  12.266   1.651 -26.789 1.00 . A A . 62 LYS CG   1 1 
        3  3089 1 1 62 LYS H    H  10.537   5.159 -25.730 1.00 . A A . 62 LYS H    1 1 
        3  3090 1 1 62 LYS HA   H  13.163   3.965 -26.097 1.00 . A A . 62 LYS HA   1 1 
        3  3091 1 1 62 LYS HB2  H  10.667   2.937 -27.338 1.00 . A A . 62 LYS HB2  1 1 
        3  3092 1 1 62 LYS HB3  H  12.081   3.049 -28.375 1.00 . A A . 62 LYS HB3  1 1 
        3  3093 1 1 62 LYS HD2  H  11.950  -0.446 -26.999 1.00 . A A . 62 LYS HD2  1 1 
        3  3094 1 1 62 LYS HD3  H  10.588   0.552 -27.514 1.00 . A A . 62 LYS HD3  1 1 
        3  3095 1 1 62 LYS HE2  H  11.584   1.076 -29.552 1.00 . A A . 62 LYS HE2  1 1 
        3  3096 1 1 62 LYS HE3  H  13.198   0.651 -28.981 1.00 . A A . 62 LYS HE3  1 1 
        3  3097 1 1 62 LYS HG2  H  13.339   1.623 -26.897 1.00 . A A . 62 LYS HG2  1 1 
        3  3098 1 1 62 LYS HG3  H  12.005   1.592 -25.742 1.00 . A A . 62 LYS HG3  1 1 
        3  3099 1 1 62 LYS HZ1  H  12.163  -1.703 -28.784 1.00 . A A . 62 LYS HZ1  1 1 
        3  3100 1 1 62 LYS HZ2  H  12.668  -1.136 -30.295 1.00 . A A . 62 LYS HZ2  1 1 
        3  3101 1 1 62 LYS HZ3  H  11.026  -1.111 -29.890 1.00 . A A . 62 LYS HZ3  1 1 
        3  3102 1 1 62 LYS N    N  11.262   4.530 -25.528 1.00 . A A . 62 LYS N    1 1 
        3  3103 1 1 62 LYS NZ   N  11.991  -0.989 -29.520 1.00 . A A . 62 LYS NZ   1 1 
        3  3104 1 1 62 LYS O    O  12.143   5.273 -28.721 1.00 . A A . 62 LYS O    1 1 
        3  3105 1 1 63 LYS C    C  14.645   8.033 -27.789 1.00 . A A . 63 LYS C    1 1 
        3  3106 1 1 63 LYS CA   C  13.163   7.675 -27.787 1.00 . A A . 63 LYS CA   1 1 
        3  3107 1 1 63 LYS CB   C  12.345   8.850 -27.249 1.00 . A A . 63 LYS CB   1 1 
        3  3108 1 1 63 LYS CD   C  10.081   9.921 -27.016 1.00 . A A . 63 LYS CD   1 1 
        3  3109 1 1 63 LYS CE   C   9.432  10.538 -28.245 1.00 . A A . 63 LYS CE   1 1 
        3  3110 1 1 63 LYS CG   C  10.841   8.650 -27.363 1.00 . A A . 63 LYS CG   1 1 
        3  3111 1 1 63 LYS H    H  13.126   6.495 -26.030 1.00 . A A . 63 LYS H    1 1 
        3  3112 1 1 63 LYS HA   H  12.854   7.465 -28.800 1.00 . A A . 63 LYS HA   1 1 
        3  3113 1 1 63 LYS HB2  H  12.589   8.996 -26.207 1.00 . A A . 63 LYS HB2  1 1 
        3  3114 1 1 63 LYS HB3  H  12.610   9.741 -27.800 1.00 . A A . 63 LYS HB3  1 1 
        3  3115 1 1 63 LYS HD2  H   9.312   9.684 -26.296 1.00 . A A . 63 LYS HD2  1 1 
        3  3116 1 1 63 LYS HD3  H  10.769  10.636 -26.586 1.00 . A A . 63 LYS HD3  1 1 
        3  3117 1 1 63 LYS HE2  H   9.455  11.612 -28.148 1.00 . A A . 63 LYS HE2  1 1 
        3  3118 1 1 63 LYS HE3  H   9.994  10.244 -29.120 1.00 . A A . 63 LYS HE3  1 1 
        3  3119 1 1 63 LYS HG2  H  10.603   8.364 -28.376 1.00 . A A . 63 LYS HG2  1 1 
        3  3120 1 1 63 LYS HG3  H  10.541   7.865 -26.684 1.00 . A A . 63 LYS HG3  1 1 
        3  3121 1 1 63 LYS HZ1  H   7.557  10.647 -29.158 1.00 . A A . 63 LYS HZ1  1 1 
        3  3122 1 1 63 LYS HZ2  H   7.497  10.235 -27.519 1.00 . A A . 63 LYS HZ2  1 1 
        3  3123 1 1 63 LYS HZ3  H   7.986   9.088 -28.660 1.00 . A A . 63 LYS HZ3  1 1 
        3  3124 1 1 63 LYS N    N  12.919   6.480 -26.987 1.00 . A A . 63 LYS N    1 1 
        3  3125 1 1 63 LYS NZ   N   8.019  10.096 -28.406 1.00 . A A . 63 LYS NZ   1 1 
        3  3126 1 1 63 LYS O    O  15.444   7.413 -27.087 1.00 . A A . 63 LYS O    1 1 
        3  3127 1 1 64 THR C    C  16.502  10.979 -28.414 1.00 . A A . 64 THR C    1 1 
        3  3128 1 1 64 THR CA   C  16.391   9.481 -28.672 1.00 . A A . 64 THR CA   1 1 
        3  3129 1 1 64 THR CB   C  16.966   9.145 -30.049 1.00 . A A . 64 THR CB   1 1 
        3  3130 1 1 64 THR CG2  C  18.437   8.789 -30.010 1.00 . A A . 64 THR CG2  1 1 
        3  3131 1 1 64 THR H    H  14.321   9.493 -29.115 1.00 . A A . 64 THR H    1 1 
        3  3132 1 1 64 THR HA   H  16.957   8.955 -27.918 1.00 . A A . 64 THR HA   1 1 
        3  3133 1 1 64 THR HB   H  16.851  10.002 -30.695 1.00 . A A . 64 THR HB   1 1 
        3  3134 1 1 64 THR HG1  H  16.388   8.072 -31.582 1.00 . A A . 64 THR HG1  1 1 
        3  3135 1 1 64 THR HG21 H  18.791   8.830 -28.991 1.00 . A A . 64 THR HG21 1 1 
        3  3136 1 1 64 THR HG22 H  18.994   9.491 -30.613 1.00 . A A . 64 THR HG22 1 1 
        3  3137 1 1 64 THR HG23 H  18.577   7.790 -30.399 1.00 . A A . 64 THR HG23 1 1 
        3  3138 1 1 64 THR N    N  15.004   9.037 -28.581 1.00 . A A . 64 THR N    1 1 
        3  3139 1 1 64 THR O    O  15.500  11.655 -28.180 1.00 . A A . 64 THR O    1 1 
        3  3140 1 1 64 THR OG1  O  16.275   8.053 -30.630 1.00 . A A . 64 THR OG1  1 1 
        3  3141 1 1 65 THR C    C  19.162  13.397 -29.049 1.00 . A A . 65 THR C    1 1 
        3  3142 1 1 65 THR CA   C  17.970  12.911 -28.230 1.00 . A A . 65 THR CA   1 1 
        3  3143 1 1 65 THR CB   C  18.216  13.172 -26.744 1.00 . A A . 65 THR CB   1 1 
        3  3144 1 1 65 THR CG2  C  16.983  12.972 -25.890 1.00 . A A . 65 THR CG2  1 1 
        3  3145 1 1 65 THR H    H  18.486  10.902 -28.652 1.00 . A A . 65 THR H    1 1 
        3  3146 1 1 65 THR HA   H  17.090  13.453 -28.543 1.00 . A A . 65 THR HA   1 1 
        3  3147 1 1 65 THR HB   H  18.542  14.196 -26.617 1.00 . A A . 65 THR HB   1 1 
        3  3148 1 1 65 THR HG1  H  18.992  11.403 -26.422 1.00 . A A . 65 THR HG1  1 1 
        3  3149 1 1 65 THR HG21 H  16.771  11.915 -25.806 1.00 . A A . 65 THR HG21 1 1 
        3  3150 1 1 65 THR HG22 H  16.142  13.471 -26.348 1.00 . A A . 65 THR HG22 1 1 
        3  3151 1 1 65 THR HG23 H  17.154  13.383 -24.906 1.00 . A A . 65 THR HG23 1 1 
        3  3152 1 1 65 THR N    N  17.727  11.492 -28.460 1.00 . A A . 65 THR N    1 1 
        3  3153 1 1 65 THR O    O  19.901  14.284 -28.621 1.00 . A A . 65 THR O    1 1 
        3  3154 1 1 65 THR OG1  O  19.229  12.317 -26.245 1.00 . A A . 65 THR OG1  1 1 
        3  3155 1 1 66 ALA C    C  20.044  14.319 -32.037 1.00 . A A . 66 ALA C    1 1 
        3  3156 1 1 66 ALA CA   C  20.445  13.183 -31.105 1.00 . A A . 66 ALA CA   1 1 
        3  3157 1 1 66 ALA CB   C  20.910  11.977 -31.909 1.00 . A A . 66 ALA CB   1 1 
        3  3158 1 1 66 ALA H    H  18.722  12.108 -30.512 1.00 . A A . 66 ALA H    1 1 
        3  3159 1 1 66 ALA HA   H  21.268  13.511 -30.485 1.00 . A A . 66 ALA HA   1 1 
        3  3160 1 1 66 ALA HB1  H  21.986  11.996 -31.997 1.00 . A A . 66 ALA HB1  1 1 
        3  3161 1 1 66 ALA HB2  H  20.468  12.009 -32.893 1.00 . A A . 66 ALA HB2  1 1 
        3  3162 1 1 66 ALA HB3  H  20.606  11.071 -31.406 1.00 . A A . 66 ALA HB3  1 1 
        3  3163 1 1 66 ALA N    N  19.344  12.809 -30.227 1.00 . A A . 66 ALA N    1 1 
        3  3164 1 1 66 ALA O    O  20.946  14.928 -32.652 1.00 . A A . 66 ALA O    1 1 
        3  3165 1 1 66 ALA OXT  O  18.830  14.593 -32.147 1.00 . A A . 66 ALA OXT  1 1 
        4  3166 1 1  1 MET C    C   4.127  12.498   4.088 1.00 . A A .  1 MET C    1 1 
        4  3167 1 1  1 MET CA   C   4.454  13.741   4.909 1.00 . A A .  1 MET CA   1 1 
        4  3168 1 1  1 MET CB   C   3.212  14.213   5.670 1.00 . A A .  1 MET CB   1 1 
        4  3169 1 1  1 MET CE   C   0.698  11.637   7.200 1.00 . A A .  1 MET CE   1 1 
        4  3170 1 1  1 MET CG   C   2.858  13.336   6.860 1.00 . A A .  1 MET CG   1 1 
        4  3171 1 1  1 MET H1   H   5.579  14.446   3.339 1.00 . A A .  1 MET H1   1 1 
        4  3172 1 1  1 MET H2   H   5.408  15.545   4.648 1.00 . A A .  1 MET H2   1 1 
        4  3173 1 1  1 MET H3   H   4.094  15.269   3.580 1.00 . A A .  1 MET H3   1 1 
        4  3174 1 1  1 MET HA   H   5.233  13.502   5.617 1.00 . A A .  1 MET HA   1 1 
        4  3175 1 1  1 MET HB2  H   3.385  15.217   6.029 1.00 . A A .  1 MET HB2  1 1 
        4  3176 1 1  1 MET HB3  H   2.372  14.221   4.993 1.00 . A A .  1 MET HB3  1 1 
        4  3177 1 1  1 MET HE1  H  -0.374  11.515   7.156 1.00 . A A .  1 MET HE1  1 1 
        4  3178 1 1  1 MET HE2  H   1.078  11.151   8.087 1.00 . A A .  1 MET HE2  1 1 
        4  3179 1 1  1 MET HE3  H   1.148  11.190   6.326 1.00 . A A .  1 MET HE3  1 1 
        4  3180 1 1  1 MET HG2  H   3.136  12.318   6.634 1.00 . A A .  1 MET HG2  1 1 
        4  3181 1 1  1 MET HG3  H   3.416  13.679   7.720 1.00 . A A .  1 MET HG3  1 1 
        4  3182 1 1  1 MET N    N   4.927  14.850   4.040 1.00 . A A .  1 MET N    1 1 
        4  3183 1 1  1 MET O    O   4.297  11.372   4.556 1.00 . A A .  1 MET O    1 1 
        4  3184 1 1  1 MET SD   S   1.100  13.380   7.255 1.00 . A A .  1 MET SD   1 1 
        4  3185 1 1  2 GLU C    C   2.194  10.757   2.568 1.00 . A A .  2 GLU C    1 1 
        4  3186 1 1  2 GLU CA   C   3.314  11.608   1.974 1.00 . A A .  2 GLU CA   1 1 
        4  3187 1 1  2 GLU CB   C   4.542  10.737   1.703 1.00 . A A .  2 GLU CB   1 1 
        4  3188 1 1  2 GLU CD   C   5.935  12.479   0.515 1.00 . A A .  2 GLU CD   1 1 
        4  3189 1 1  2 GLU CG   C   5.285  11.112   0.431 1.00 . A A .  2 GLU CG   1 1 
        4  3190 1 1  2 GLU H    H   3.550  13.632   2.548 1.00 . A A .  2 GLU H    1 1 
        4  3191 1 1  2 GLU HA   H   2.972  12.031   1.041 1.00 . A A .  2 GLU HA   1 1 
        4  3192 1 1  2 GLU HB2  H   5.227  10.831   2.535 1.00 . A A .  2 GLU HB2  1 1 
        4  3193 1 1  2 GLU HB3  H   4.230   9.707   1.622 1.00 . A A .  2 GLU HB3  1 1 
        4  3194 1 1  2 GLU HG2  H   6.053  10.376   0.249 1.00 . A A .  2 GLU HG2  1 1 
        4  3195 1 1  2 GLU HG3  H   4.585  11.111  -0.392 1.00 . A A .  2 GLU HG3  1 1 
        4  3196 1 1  2 GLU N    N   3.662  12.710   2.863 1.00 . A A .  2 GLU N    1 1 
        4  3197 1 1  2 GLU O    O   1.836  10.910   3.735 1.00 . A A .  2 GLU O    1 1 
        4  3198 1 1  2 GLU OE1  O   6.862  12.646   1.335 1.00 . A A .  2 GLU OE1  1 1 
        4  3199 1 1  2 GLU OE2  O   5.518  13.382  -0.240 1.00 . A A .  2 GLU OE2  1 1 
        4  3200 1 1  3 GLN C    C   0.644   7.638   1.477 1.00 . A A .  3 GLN C    1 1 
        4  3201 1 1  3 GLN CA   C   0.567   8.984   2.191 1.00 . A A .  3 GLN CA   1 1 
        4  3202 1 1  3 GLN CB   C  -0.788   9.639   1.925 1.00 . A A .  3 GLN CB   1 1 
        4  3203 1 1  3 GLN CD   C  -2.784  10.421   3.260 1.00 . A A .  3 GLN CD   1 1 
        4  3204 1 1  3 GLN CG   C  -1.853   9.267   2.943 1.00 . A A .  3 GLN CG   1 1 
        4  3205 1 1  3 GLN H    H   1.976   9.789   0.833 1.00 . A A .  3 GLN H    1 1 
        4  3206 1 1  3 GLN HA   H   0.678   8.823   3.253 1.00 . A A .  3 GLN HA   1 1 
        4  3207 1 1  3 GLN HB2  H  -0.665  10.710   1.939 1.00 . A A .  3 GLN HB2  1 1 
        4  3208 1 1  3 GLN HB3  H  -1.136   9.337   0.947 1.00 . A A .  3 GLN HB3  1 1 
        4  3209 1 1  3 GLN HE21 H  -3.740  10.154   1.534 1.00 . A A .  3 GLN HE21 1 1 
        4  3210 1 1  3 GLN HE22 H  -4.327  11.448   2.532 1.00 . A A .  3 GLN HE22 1 1 
        4  3211 1 1  3 GLN HG2  H  -2.440   8.451   2.551 1.00 . A A .  3 GLN HG2  1 1 
        4  3212 1 1  3 GLN HG3  H  -1.368   8.954   3.855 1.00 . A A .  3 GLN HG3  1 1 
        4  3213 1 1  3 GLN N    N   1.645   9.862   1.753 1.00 . A A .  3 GLN N    1 1 
        4  3214 1 1  3 GLN NE2  N  -3.710  10.702   2.351 1.00 . A A .  3 GLN NE2  1 1 
        4  3215 1 1  3 GLN O    O  -0.376   7.070   1.088 1.00 . A A .  3 GLN O    1 1 
        4  3216 1 1  3 GLN OE1  O  -2.673  11.054   4.311 1.00 . A A .  3 GLN OE1  1 1 
        4  3217 1 1  4 ARG C    C   2.747   4.856   1.559 1.00 . A A .  4 ARG C    1 1 
        4  3218 1 1  4 ARG CA   C   2.079   5.865   0.630 1.00 . A A .  4 ARG CA   1 1 
        4  3219 1 1  4 ARG CB   C   2.935   6.067  -0.621 1.00 . A A .  4 ARG CB   1 1 
        4  3220 1 1  4 ARG CD   C   3.017   7.105  -2.909 1.00 . A A .  4 ARG CD   1 1 
        4  3221 1 1  4 ARG CG   C   2.460   7.213  -1.500 1.00 . A A .  4 ARG CG   1 1 
        4  3222 1 1  4 ARG CZ   C   3.539   9.424  -3.559 1.00 . A A .  4 ARG CZ   1 1 
        4  3223 1 1  4 ARG H    H   2.636   7.645   1.631 1.00 . A A .  4 ARG H    1 1 
        4  3224 1 1  4 ARG HA   H   1.117   5.477   0.334 1.00 . A A .  4 ARG HA   1 1 
        4  3225 1 1  4 ARG HB2  H   3.952   6.273  -0.319 1.00 . A A .  4 ARG HB2  1 1 
        4  3226 1 1  4 ARG HB3  H   2.919   5.162  -1.208 1.00 . A A .  4 ARG HB3  1 1 
        4  3227 1 1  4 ARG HD2  H   4.078   6.915  -2.849 1.00 . A A .  4 ARG HD2  1 1 
        4  3228 1 1  4 ARG HD3  H   2.533   6.281  -3.413 1.00 . A A .  4 ARG HD3  1 1 
        4  3229 1 1  4 ARG HE   H   2.056   8.329  -4.323 1.00 . A A .  4 ARG HE   1 1 
        4  3230 1 1  4 ARG HG2  H   1.380   7.192  -1.547 1.00 . A A .  4 ARG HG2  1 1 
        4  3231 1 1  4 ARG HG3  H   2.784   8.147  -1.064 1.00 . A A .  4 ARG HG3  1 1 
        4  3232 1 1  4 ARG HH11 H   4.756   8.660  -2.138 1.00 . A A .  4 ARG HH11 1 1 
        4  3233 1 1  4 ARG HH12 H   5.102  10.289  -2.613 1.00 . A A .  4 ARG HH12 1 1 
        4  3234 1 1  4 ARG HH21 H   2.511  10.469  -4.951 1.00 . A A .  4 ARG HH21 1 1 
        4  3235 1 1  4 ARG HH22 H   3.828  11.315  -4.210 1.00 . A A .  4 ARG HH22 1 1 
        4  3236 1 1  4 ARG N    N   1.863   7.140   1.303 1.00 . A A .  4 ARG N    1 1 
        4  3237 1 1  4 ARG NE   N   2.796   8.326  -3.681 1.00 . A A .  4 ARG NE   1 1 
        4  3238 1 1  4 ARG NH1  N   4.549   9.460  -2.699 1.00 . A A .  4 ARG NH1  1 1 
        4  3239 1 1  4 ARG NH2  N   3.270  10.491  -4.302 1.00 . A A .  4 ARG NH2  1 1 
        4  3240 1 1  4 ARG O    O   3.970   4.711   1.556 1.00 . A A .  4 ARG O    1 1 
        4  3241 1 1  5 ILE C    C   2.763   1.867   2.562 1.00 . A A .  5 ILE C    1 1 
        4  3242 1 1  5 ILE CA   C   2.451   3.167   3.284 1.00 . A A .  5 ILE CA   1 1 
        4  3243 1 1  5 ILE CB   C   1.445   2.873   4.416 1.00 . A A .  5 ILE CB   1 1 
        4  3244 1 1  5 ILE CD1  C  -0.777   4.012   4.886 1.00 . A A .  5 ILE CD1  1 1 
        4  3245 1 1  5 ILE CG1  C   0.728   4.152   4.831 1.00 . A A .  5 ILE CG1  1 1 
        4  3246 1 1  5 ILE CG2  C   2.150   2.247   5.612 1.00 . A A .  5 ILE CG2  1 1 
        4  3247 1 1  5 ILE H    H   0.972   4.322   2.314 1.00 . A A .  5 ILE H    1 1 
        4  3248 1 1  5 ILE HA   H   3.359   3.554   3.723 1.00 . A A .  5 ILE HA   1 1 
        4  3249 1 1  5 ILE HB   H   0.719   2.164   4.048 1.00 . A A .  5 ILE HB   1 1 
        4  3250 1 1  5 ILE HD11 H  -1.161   4.577   5.724 1.00 . A A .  5 ILE HD11 1 1 
        4  3251 1 1  5 ILE HD12 H  -1.037   2.970   5.007 1.00 . A A .  5 ILE HD12 1 1 
        4  3252 1 1  5 ILE HD13 H  -1.209   4.388   3.971 1.00 . A A .  5 ILE HD13 1 1 
        4  3253 1 1  5 ILE HG12 H   1.070   4.449   5.804 1.00 . A A .  5 ILE HG12 1 1 
        4  3254 1 1  5 ILE HG13 H   0.965   4.926   4.125 1.00 . A A .  5 ILE HG13 1 1 
        4  3255 1 1  5 ILE HG21 H   1.656   2.555   6.522 1.00 . A A .  5 ILE HG21 1 1 
        4  3256 1 1  5 ILE HG22 H   3.180   2.571   5.633 1.00 . A A .  5 ILE HG22 1 1 
        4  3257 1 1  5 ILE HG23 H   2.113   1.171   5.529 1.00 . A A .  5 ILE HG23 1 1 
        4  3258 1 1  5 ILE N    N   1.938   4.161   2.352 1.00 . A A .  5 ILE N    1 1 
        4  3259 1 1  5 ILE O    O   2.397   1.683   1.403 1.00 . A A .  5 ILE O    1 1 
        4  3260 1 1  6 THR C    C   2.615  -1.254   2.628 1.00 . A A .  6 THR C    1 1 
        4  3261 1 1  6 THR CA   C   3.817  -0.317   2.693 1.00 . A A .  6 THR CA   1 1 
        4  3262 1 1  6 THR CB   C   4.935  -0.956   3.519 1.00 . A A .  6 THR CB   1 1 
        4  3263 1 1  6 THR CG2  C   6.312  -0.738   2.930 1.00 . A A .  6 THR CG2  1 1 
        4  3264 1 1  6 THR H    H   3.702   1.191   4.178 1.00 . A A .  6 THR H    1 1 
        4  3265 1 1  6 THR HA   H   4.176  -0.145   1.688 1.00 . A A .  6 THR HA   1 1 
        4  3266 1 1  6 THR HB   H   4.764  -2.020   3.576 1.00 . A A .  6 THR HB   1 1 
        4  3267 1 1  6 THR HG1  H   4.717  -1.130   5.457 1.00 . A A .  6 THR HG1  1 1 
        4  3268 1 1  6 THR HG21 H   6.987  -0.409   3.706 1.00 . A A .  6 THR HG21 1 1 
        4  3269 1 1  6 THR HG22 H   6.257   0.013   2.157 1.00 . A A .  6 THR HG22 1 1 
        4  3270 1 1  6 THR HG23 H   6.673  -1.665   2.508 1.00 . A A .  6 THR HG23 1 1 
        4  3271 1 1  6 THR N    N   3.443   0.974   3.259 1.00 . A A .  6 THR N    1 1 
        4  3272 1 1  6 THR O    O   1.704  -1.169   3.450 1.00 . A A .  6 THR O    1 1 
        4  3273 1 1  6 THR OG1  O   4.944  -0.435   4.836 1.00 . A A .  6 THR OG1  1 1 
        4  3274 1 1  7 LEU C    C   1.397  -4.003   2.690 1.00 . A A .  7 LEU C    1 1 
        4  3275 1 1  7 LEU CA   C   1.533  -3.100   1.468 1.00 . A A .  7 LEU CA   1 1 
        4  3276 1 1  7 LEU CB   C   1.765  -3.949   0.216 1.00 . A A .  7 LEU CB   1 1 
        4  3277 1 1  7 LEU CD1  C  -0.565  -4.415  -0.587 1.00 . A A .  7 LEU CD1  1 1 
        4  3278 1 1  7 LEU CD2  C   1.253  -6.084  -0.993 1.00 . A A .  7 LEU CD2  1 1 
        4  3279 1 1  7 LEU CG   C   0.712  -5.031  -0.038 1.00 . A A .  7 LEU CG   1 1 
        4  3280 1 1  7 LEU H    H   3.376  -2.164   1.018 1.00 . A A .  7 LEU H    1 1 
        4  3281 1 1  7 LEU HA   H   0.616  -2.540   1.347 1.00 . A A .  7 LEU HA   1 1 
        4  3282 1 1  7 LEU HB2  H   1.788  -3.291  -0.641 1.00 . A A .  7 LEU HB2  1 1 
        4  3283 1 1  7 LEU HB3  H   2.726  -4.429   0.306 1.00 . A A .  7 LEU HB3  1 1 
        4  3284 1 1  7 LEU HD11 H  -1.211  -4.135   0.230 1.00 . A A .  7 LEU HD11 1 1 
        4  3285 1 1  7 LEU HD12 H  -1.070  -5.135  -1.215 1.00 . A A .  7 LEU HD12 1 1 
        4  3286 1 1  7 LEU HD13 H  -0.321  -3.541  -1.171 1.00 . A A .  7 LEU HD13 1 1 
        4  3287 1 1  7 LEU HD21 H   0.681  -6.995  -0.885 1.00 . A A .  7 LEU HD21 1 1 
        4  3288 1 1  7 LEU HD22 H   2.289  -6.282  -0.763 1.00 . A A .  7 LEU HD22 1 1 
        4  3289 1 1  7 LEU HD23 H   1.171  -5.727  -2.008 1.00 . A A .  7 LEU HD23 1 1 
        4  3290 1 1  7 LEU HG   H   0.472  -5.516   0.897 1.00 . A A .  7 LEU HG   1 1 
        4  3291 1 1  7 LEU N    N   2.621  -2.146   1.643 1.00 . A A .  7 LEU N    1 1 
        4  3292 1 1  7 LEU O    O   0.289  -4.289   3.143 1.00 . A A .  7 LEU O    1 1 
        4  3293 1 1  8 LYS C    C   1.830  -4.648   5.565 1.00 . A A .  8 LYS C    1 1 
        4  3294 1 1  8 LYS CA   C   2.541  -5.316   4.392 1.00 . A A .  8 LYS CA   1 1 
        4  3295 1 1  8 LYS CB   C   3.977  -5.671   4.781 1.00 . A A .  8 LYS CB   1 1 
        4  3296 1 1  8 LYS CD   C   5.034  -7.233   6.445 1.00 . A A .  8 LYS CD   1 1 
        4  3297 1 1  8 LYS CE   C   6.507  -7.145   6.081 1.00 . A A .  8 LYS CE   1 1 
        4  3298 1 1  8 LYS CG   C   4.149  -7.118   5.215 1.00 . A A .  8 LYS CG   1 1 
        4  3299 1 1  8 LYS H    H   3.386  -4.184   2.814 1.00 . A A .  8 LYS H    1 1 
        4  3300 1 1  8 LYS HA   H   2.012  -6.221   4.135 1.00 . A A .  8 LYS HA   1 1 
        4  3301 1 1  8 LYS HB2  H   4.622  -5.492   3.933 1.00 . A A .  8 LYS HB2  1 1 
        4  3302 1 1  8 LYS HB3  H   4.285  -5.034   5.596 1.00 . A A .  8 LYS HB3  1 1 
        4  3303 1 1  8 LYS HD2  H   4.794  -6.429   7.126 1.00 . A A .  8 LYS HD2  1 1 
        4  3304 1 1  8 LYS HD3  H   4.847  -8.181   6.925 1.00 . A A .  8 LYS HD3  1 1 
        4  3305 1 1  8 LYS HE2  H   6.635  -7.482   5.063 1.00 . A A .  8 LYS HE2  1 1 
        4  3306 1 1  8 LYS HE3  H   6.824  -6.115   6.158 1.00 . A A .  8 LYS HE3  1 1 
        4  3307 1 1  8 LYS HG2  H   3.179  -7.534   5.443 1.00 . A A .  8 LYS HG2  1 1 
        4  3308 1 1  8 LYS HG3  H   4.600  -7.674   4.405 1.00 . A A .  8 LYS HG3  1 1 
        4  3309 1 1  8 LYS HZ1  H   8.246  -7.491   7.186 1.00 . A A .  8 LYS HZ1  1 1 
        4  3310 1 1  8 LYS HZ2  H   7.568  -8.890   6.520 1.00 . A A .  8 LYS HZ2  1 1 
        4  3311 1 1  8 LYS HZ3  H   6.854  -8.165   7.871 1.00 . A A .  8 LYS HZ3  1 1 
        4  3312 1 1  8 LYS N    N   2.533  -4.447   3.220 1.00 . A A .  8 LYS N    1 1 
        4  3313 1 1  8 LYS NZ   N   7.352  -7.981   6.977 1.00 . A A .  8 LYS NZ   1 1 
        4  3314 1 1  8 LYS O    O   0.916  -5.220   6.158 1.00 . A A .  8 LYS O    1 1 
        4  3315 1 1  9 ASP C    C   0.176  -2.432   6.726 1.00 . A A .  9 ASP C    1 1 
        4  3316 1 1  9 ASP CA   C   1.657  -2.680   6.986 1.00 . A A .  9 ASP CA   1 1 
        4  3317 1 1  9 ASP CB   C   2.381  -1.344   7.173 1.00 . A A .  9 ASP CB   1 1 
        4  3318 1 1  9 ASP CG   C   3.737  -1.508   7.829 1.00 . A A .  9 ASP CG   1 1 
        4  3319 1 1  9 ASP H    H   2.985  -3.025   5.375 1.00 . A A .  9 ASP H    1 1 
        4  3320 1 1  9 ASP HA   H   1.761  -3.266   7.888 1.00 . A A .  9 ASP HA   1 1 
        4  3321 1 1  9 ASP HB2  H   2.521  -0.881   6.207 1.00 . A A .  9 ASP HB2  1 1 
        4  3322 1 1  9 ASP HB3  H   1.776  -0.698   7.792 1.00 . A A .  9 ASP HB3  1 1 
        4  3323 1 1  9 ASP N    N   2.255  -3.431   5.890 1.00 . A A .  9 ASP N    1 1 
        4  3324 1 1  9 ASP O    O  -0.627  -2.371   7.655 1.00 . A A .  9 ASP O    1 1 
        4  3325 1 1  9 ASP OD1  O   3.778  -1.768   9.050 1.00 . A A .  9 ASP OD1  1 1 
        4  3326 1 1  9 ASP OD2  O   4.759  -1.377   7.123 1.00 . A A .  9 ASP OD2  1 1 
        4  3327 1 1 10 TYR C    C  -2.463  -3.188   5.480 1.00 . A A . 10 TYR C    1 1 
        4  3328 1 1 10 TYR CA   C  -1.554  -2.037   5.058 1.00 . A A . 10 TYR CA   1 1 
        4  3329 1 1 10 TYR CB   C  -1.640  -1.834   3.547 1.00 . A A . 10 TYR CB   1 1 
        4  3330 1 1 10 TYR CD1  C  -4.137  -1.651   3.231 1.00 . A A . 10 TYR CD1  1 1 
        4  3331 1 1 10 TYR CD2  C  -2.779   0.185   2.549 1.00 . A A . 10 TYR CD2  1 1 
        4  3332 1 1 10 TYR CE1  C  -5.268  -0.971   2.822 1.00 . A A . 10 TYR CE1  1 1 
        4  3333 1 1 10 TYR CE2  C  -3.905   0.873   2.138 1.00 . A A . 10 TYR CE2  1 1 
        4  3334 1 1 10 TYR CG   C  -2.875  -1.086   3.101 1.00 . A A . 10 TYR CG   1 1 
        4  3335 1 1 10 TYR CZ   C  -5.147   0.289   2.277 1.00 . A A . 10 TYR CZ   1 1 
        4  3336 1 1 10 TYR H    H   0.517  -2.341   4.760 1.00 . A A . 10 TYR H    1 1 
        4  3337 1 1 10 TYR HA   H  -1.882  -1.136   5.552 1.00 . A A . 10 TYR HA   1 1 
        4  3338 1 1 10 TYR HB2  H  -0.777  -1.274   3.216 1.00 . A A . 10 TYR HB2  1 1 
        4  3339 1 1 10 TYR HB3  H  -1.642  -2.799   3.061 1.00 . A A . 10 TYR HB3  1 1 
        4  3340 1 1 10 TYR HD1  H  -4.229  -2.638   3.660 1.00 . A A . 10 TYR HD1  1 1 
        4  3341 1 1 10 TYR HD2  H  -1.804   0.639   2.442 1.00 . A A . 10 TYR HD2  1 1 
        4  3342 1 1 10 TYR HE1  H  -6.241  -1.427   2.930 1.00 . A A . 10 TYR HE1  1 1 
        4  3343 1 1 10 TYR HE2  H  -3.810   1.858   1.708 1.00 . A A . 10 TYR HE2  1 1 
        4  3344 1 1 10 TYR HH   H  -6.938   0.929   2.559 1.00 . A A . 10 TYR HH   1 1 
        4  3345 1 1 10 TYR N    N  -0.173  -2.285   5.454 1.00 . A A . 10 TYR N    1 1 
        4  3346 1 1 10 TYR O    O  -3.557  -2.969   6.001 1.00 . A A . 10 TYR O    1 1 
        4  3347 1 1 10 TYR OH   O  -6.271   0.970   1.869 1.00 . A A . 10 TYR OH   1 1 
        4  3348 1 1 11 ALA C    C  -2.841  -5.799   7.109 1.00 . A A . 11 ALA C    1 1 
        4  3349 1 1 11 ALA CA   C  -2.783  -5.598   5.598 1.00 . A A . 11 ALA CA   1 1 
        4  3350 1 1 11 ALA CB   C  -2.196  -6.829   4.924 1.00 . A A . 11 ALA CB   1 1 
        4  3351 1 1 11 ALA H    H  -1.129  -4.526   4.826 1.00 . A A . 11 ALA H    1 1 
        4  3352 1 1 11 ALA HA   H  -3.787  -5.458   5.225 1.00 . A A . 11 ALA HA   1 1 
        4  3353 1 1 11 ALA HB1  H  -2.520  -6.864   3.894 1.00 . A A . 11 ALA HB1  1 1 
        4  3354 1 1 11 ALA HB2  H  -2.536  -7.716   5.438 1.00 . A A . 11 ALA HB2  1 1 
        4  3355 1 1 11 ALA HB3  H  -1.119  -6.782   4.962 1.00 . A A . 11 ALA HB3  1 1 
        4  3356 1 1 11 ALA N    N  -2.006  -4.414   5.249 1.00 . A A . 11 ALA N    1 1 
        4  3357 1 1 11 ALA O    O  -3.881  -6.161   7.656 1.00 . A A . 11 ALA O    1 1 
        4  3358 1 1 12 MET C    C  -2.299  -4.563   9.950 1.00 . A A . 12 MET C    1 1 
        4  3359 1 1 12 MET CA   C  -1.645  -5.733   9.223 1.00 . A A . 12 MET CA   1 1 
        4  3360 1 1 12 MET CB   C  -0.186  -5.877   9.665 1.00 . A A . 12 MET CB   1 1 
        4  3361 1 1 12 MET CE   C   2.488  -7.117   8.554 1.00 . A A . 12 MET CE   1 1 
        4  3362 1 1 12 MET CG   C   0.186  -7.288  10.088 1.00 . A A . 12 MET CG   1 1 
        4  3363 1 1 12 MET H    H  -0.920  -5.290   7.291 1.00 . A A . 12 MET H    1 1 
        4  3364 1 1 12 MET HA   H  -2.174  -6.633   9.472 1.00 . A A . 12 MET HA   1 1 
        4  3365 1 1 12 MET HB2  H   0.456  -5.590   8.844 1.00 . A A . 12 MET HB2  1 1 
        4  3366 1 1 12 MET HB3  H  -0.005  -5.215  10.499 1.00 . A A . 12 MET HB3  1 1 
        4  3367 1 1 12 MET HE1  H   2.552  -6.044   8.452 1.00 . A A . 12 MET HE1  1 1 
        4  3368 1 1 12 MET HE2  H   1.769  -7.503   7.845 1.00 . A A . 12 MET HE2  1 1 
        4  3369 1 1 12 MET HE3  H   3.456  -7.555   8.359 1.00 . A A . 12 MET HE3  1 1 
        4  3370 1 1 12 MET HG2  H  -0.261  -7.490  11.050 1.00 . A A . 12 MET HG2  1 1 
        4  3371 1 1 12 MET HG3  H  -0.207  -7.982   9.359 1.00 . A A . 12 MET HG3  1 1 
        4  3372 1 1 12 MET N    N  -1.718  -5.570   7.778 1.00 . A A . 12 MET N    1 1 
        4  3373 1 1 12 MET O    O  -2.758  -4.702  11.085 1.00 . A A . 12 MET O    1 1 
        4  3374 1 1 12 MET SD   S   1.968  -7.531  10.216 1.00 . A A . 12 MET SD   1 1 
        4  3375 1 1 13 ARG C    C  -4.409  -2.103   9.547 1.00 . A A . 13 ARG C    1 1 
        4  3376 1 1 13 ARG CA   C  -2.924  -2.213   9.879 1.00 . A A . 13 ARG CA   1 1 
        4  3377 1 1 13 ARG CB   C  -2.192  -0.965   9.382 1.00 . A A . 13 ARG CB   1 1 
        4  3378 1 1 13 ARG CD   C  -1.561   1.136  10.614 1.00 . A A . 13 ARG CD   1 1 
        4  3379 1 1 13 ARG CG   C  -2.697   0.326  10.010 1.00 . A A . 13 ARG CG   1 1 
        4  3380 1 1 13 ARG CZ   C  -1.328   3.164  11.994 1.00 . A A . 13 ARG CZ   1 1 
        4  3381 1 1 13 ARG H    H  -1.946  -3.366   8.396 1.00 . A A . 13 ARG H    1 1 
        4  3382 1 1 13 ARG HA   H  -2.813  -2.277  10.949 1.00 . A A . 13 ARG HA   1 1 
        4  3383 1 1 13 ARG HB2  H  -1.139  -1.065   9.611 1.00 . A A . 13 ARG HB2  1 1 
        4  3384 1 1 13 ARG HB3  H  -2.317  -0.890   8.309 1.00 . A A . 13 ARG HB3  1 1 
        4  3385 1 1 13 ARG HD2  H  -1.123   0.570  11.422 1.00 . A A . 13 ARG HD2  1 1 
        4  3386 1 1 13 ARG HD3  H  -0.814   1.310   9.852 1.00 . A A . 13 ARG HD3  1 1 
        4  3387 1 1 13 ARG HE   H  -2.888   2.753  10.818 1.00 . A A . 13 ARG HE   1 1 
        4  3388 1 1 13 ARG HG2  H  -3.183   0.918   9.247 1.00 . A A . 13 ARG HG2  1 1 
        4  3389 1 1 13 ARG HG3  H  -3.407   0.081  10.789 1.00 . A A . 13 ARG HG3  1 1 
        4  3390 1 1 13 ARG HH11 H   0.226   1.875  12.129 1.00 . A A . 13 ARG HH11 1 1 
        4  3391 1 1 13 ARG HH12 H   0.367   3.311  13.087 1.00 . A A . 13 ARG HH12 1 1 
        4  3392 1 1 13 ARG HH21 H  -2.705   4.641  12.080 1.00 . A A . 13 ARG HH21 1 1 
        4  3393 1 1 13 ARG HH22 H  -1.298   4.879  13.062 1.00 . A A . 13 ARG HH22 1 1 
        4  3394 1 1 13 ARG N    N  -2.333  -3.411   9.295 1.00 . A A . 13 ARG N    1 1 
        4  3395 1 1 13 ARG NE   N  -2.020   2.423  11.131 1.00 . A A . 13 ARG NE   1 1 
        4  3396 1 1 13 ARG NH1  N  -0.149   2.749  12.439 1.00 . A A . 13 ARG NH1  1 1 
        4  3397 1 1 13 ARG NH2  N  -1.816   4.323  12.413 1.00 . A A . 13 ARG NH2  1 1 
        4  3398 1 1 13 ARG O    O  -5.263  -2.227  10.426 1.00 . A A . 13 ARG O    1 1 
        4  3399 1 1 14 PHE C    C  -6.756  -3.051   7.618 1.00 . A A . 14 PHE C    1 1 
        4  3400 1 1 14 PHE CA   C  -6.072  -1.701   7.821 1.00 . A A . 14 PHE CA   1 1 
        4  3401 1 1 14 PHE CB   C  -6.062  -0.911   6.521 1.00 . A A . 14 PHE CB   1 1 
        4  3402 1 1 14 PHE CD1  C  -6.191   1.524   7.098 1.00 . A A . 14 PHE CD1  1 1 
        4  3403 1 1 14 PHE CD2  C  -4.098   0.643   6.393 1.00 . A A . 14 PHE CD2  1 1 
        4  3404 1 1 14 PHE CE1  C  -5.621   2.763   7.242 1.00 . A A . 14 PHE CE1  1 1 
        4  3405 1 1 14 PHE CE2  C  -3.525   1.880   6.536 1.00 . A A . 14 PHE CE2  1 1 
        4  3406 1 1 14 PHE CG   C  -5.438   0.445   6.669 1.00 . A A . 14 PHE CG   1 1 
        4  3407 1 1 14 PHE CZ   C  -4.289   2.938   6.960 1.00 . A A . 14 PHE CZ   1 1 
        4  3408 1 1 14 PHE H    H  -3.985  -1.748   7.628 1.00 . A A . 14 PHE H    1 1 
        4  3409 1 1 14 PHE HA   H  -6.615  -1.139   8.565 1.00 . A A . 14 PHE HA   1 1 
        4  3410 1 1 14 PHE HB2  H  -5.503  -1.457   5.777 1.00 . A A . 14 PHE HB2  1 1 
        4  3411 1 1 14 PHE HB3  H  -7.070  -0.782   6.183 1.00 . A A . 14 PHE HB3  1 1 
        4  3412 1 1 14 PHE HD1  H  -7.228   1.389   7.320 1.00 . A A . 14 PHE HD1  1 1 
        4  3413 1 1 14 PHE HD2  H  -3.497  -0.178   6.059 1.00 . A A . 14 PHE HD2  1 1 
        4  3414 1 1 14 PHE HE1  H  -6.219   3.598   7.577 1.00 . A A . 14 PHE HE1  1 1 
        4  3415 1 1 14 PHE HE2  H  -2.477   2.020   6.319 1.00 . A A . 14 PHE HE2  1 1 
        4  3416 1 1 14 PHE HZ   H  -3.849   3.895   7.072 1.00 . A A . 14 PHE HZ   1 1 
        4  3417 1 1 14 PHE N    N  -4.707  -1.853   8.279 1.00 . A A . 14 PHE N    1 1 
        4  3418 1 1 14 PHE O    O  -7.920  -3.225   7.976 1.00 . A A . 14 PHE O    1 1 
        4  3419 1 1 15 GLY C    C  -6.532  -5.721   5.341 1.00 . A A . 15 GLY C    1 1 
        4  3420 1 1 15 GLY CA   C  -6.594  -5.319   6.801 1.00 . A A . 15 GLY CA   1 1 
        4  3421 1 1 15 GLY H    H  -5.107  -3.809   6.771 1.00 . A A . 15 GLY H    1 1 
        4  3422 1 1 15 GLY HA2  H  -6.049  -6.044   7.386 1.00 . A A . 15 GLY HA2  1 1 
        4  3423 1 1 15 GLY HA3  H  -7.626  -5.320   7.119 1.00 . A A . 15 GLY HA3  1 1 
        4  3424 1 1 15 GLY N    N  -6.031  -4.001   7.040 1.00 . A A . 15 GLY N    1 1 
        4  3425 1 1 15 GLY O    O  -6.683  -4.882   4.452 1.00 . A A . 15 GLY O    1 1 
        4  3426 1 1 16 GLN C    C  -7.534  -7.282   2.976 1.00 . A A . 16 GLN C    1 1 
        4  3427 1 1 16 GLN CA   C  -6.227  -7.520   3.728 1.00 . A A . 16 GLN CA   1 1 
        4  3428 1 1 16 GLN CB   C  -5.897  -9.014   3.743 1.00 . A A . 16 GLN CB   1 1 
        4  3429 1 1 16 GLN CD   C  -4.172 -10.800   3.275 1.00 . A A . 16 GLN CD   1 1 
        4  3430 1 1 16 GLN CG   C  -4.435  -9.318   3.453 1.00 . A A . 16 GLN CG   1 1 
        4  3431 1 1 16 GLN H    H  -6.198  -7.626   5.841 1.00 . A A . 16 GLN H    1 1 
        4  3432 1 1 16 GLN HA   H  -5.433  -6.990   3.222 1.00 . A A . 16 GLN HA   1 1 
        4  3433 1 1 16 GLN HB2  H  -6.138  -9.414   4.717 1.00 . A A . 16 GLN HB2  1 1 
        4  3434 1 1 16 GLN HB3  H  -6.499  -9.514   2.999 1.00 . A A . 16 GLN HB3  1 1 
        4  3435 1 1 16 GLN HE21 H  -2.293 -10.562   3.888 1.00 . A A . 16 GLN HE21 1 1 
        4  3436 1 1 16 GLN HE22 H  -2.753 -12.183   3.467 1.00 . A A . 16 GLN HE22 1 1 
        4  3437 1 1 16 GLN HG2  H  -4.148  -8.806   2.547 1.00 . A A . 16 GLN HG2  1 1 
        4  3438 1 1 16 GLN HG3  H  -3.836  -8.956   4.277 1.00 . A A . 16 GLN HG3  1 1 
        4  3439 1 1 16 GLN N    N  -6.309  -7.007   5.091 1.00 . A A . 16 GLN N    1 1 
        4  3440 1 1 16 GLN NE2  N  -2.950 -11.225   3.574 1.00 . A A . 16 GLN NE2  1 1 
        4  3441 1 1 16 GLN O    O  -7.527  -6.918   1.801 1.00 . A A . 16 GLN O    1 1 
        4  3442 1 1 16 GLN OE1  O  -5.058 -11.555   2.874 1.00 . A A . 16 GLN OE1  1 1 
        4  3443 1 1 17 THR C    C -10.130  -5.871   2.565 1.00 . A A . 17 THR C    1 1 
        4  3444 1 1 17 THR CA   C  -9.967  -7.303   3.062 1.00 . A A . 17 THR CA   1 1 
        4  3445 1 1 17 THR CB   C -11.060  -7.640   4.072 1.00 . A A . 17 THR CB   1 1 
        4  3446 1 1 17 THR CG2  C -12.460  -7.526   3.499 1.00 . A A . 17 THR CG2  1 1 
        4  3447 1 1 17 THR H    H  -8.592  -7.782   4.597 1.00 . A A . 17 THR H    1 1 
        4  3448 1 1 17 THR HA   H -10.040  -7.974   2.221 1.00 . A A . 17 THR HA   1 1 
        4  3449 1 1 17 THR HB   H -10.990  -6.959   4.907 1.00 . A A . 17 THR HB   1 1 
        4  3450 1 1 17 THR HG1  H -11.490  -9.096   5.311 1.00 . A A . 17 THR HG1  1 1 
        4  3451 1 1 17 THR HG21 H -12.610  -6.528   3.117 1.00 . A A . 17 THR HG21 1 1 
        4  3452 1 1 17 THR HG22 H -13.180  -7.729   4.273 1.00 . A A . 17 THR HG22 1 1 
        4  3453 1 1 17 THR HG23 H -12.580  -8.240   2.697 1.00 . A A . 17 THR HG23 1 1 
        4  3454 1 1 17 THR N    N  -8.652  -7.492   3.664 1.00 . A A . 17 THR N    1 1 
        4  3455 1 1 17 THR O    O -10.480  -5.643   1.407 1.00 . A A . 17 THR O    1 1 
        4  3456 1 1 17 THR OG1  O -10.900  -8.960   4.561 1.00 . A A . 17 THR OG1  1 1 
        4  3457 1 1 18 LYS C    C  -9.035  -3.112   2.006 1.00 . A A . 18 LYS C    1 1 
        4  3458 1 1 18 LYS CA   C -10.020  -3.499   3.103 1.00 . A A . 18 LYS CA   1 1 
        4  3459 1 1 18 LYS CB   C  -9.803  -2.626   4.339 1.00 . A A . 18 LYS CB   1 1 
        4  3460 1 1 18 LYS CD   C  -9.087  -0.227   4.084 1.00 . A A . 18 LYS CD   1 1 
        4  3461 1 1 18 LYS CE   C  -9.408   1.098   4.757 1.00 . A A . 18 LYS CE   1 1 
        4  3462 1 1 18 LYS CG   C -10.260  -1.188   4.159 1.00 . A A . 18 LYS CG   1 1 
        4  3463 1 1 18 LYS H    H  -9.622  -5.154   4.359 1.00 . A A . 18 LYS H    1 1 
        4  3464 1 1 18 LYS HA   H -11.020  -3.339   2.736 1.00 . A A . 18 LYS HA   1 1 
        4  3465 1 1 18 LYS HB2  H -10.340  -3.055   5.169 1.00 . A A . 18 LYS HB2  1 1 
        4  3466 1 1 18 LYS HB3  H  -8.749  -2.618   4.575 1.00 . A A . 18 LYS HB3  1 1 
        4  3467 1 1 18 LYS HD2  H  -8.238  -0.674   4.579 1.00 . A A . 18 LYS HD2  1 1 
        4  3468 1 1 18 LYS HD3  H  -8.848  -0.047   3.047 1.00 . A A . 18 LYS HD3  1 1 
        4  3469 1 1 18 LYS HE2  H  -9.715   0.907   5.774 1.00 . A A . 18 LYS HE2  1 1 
        4  3470 1 1 18 LYS HE3  H  -8.516   1.710   4.760 1.00 . A A . 18 LYS HE3  1 1 
        4  3471 1 1 18 LYS HG2  H -10.830  -1.114   3.245 1.00 . A A . 18 LYS HG2  1 1 
        4  3472 1 1 18 LYS HG3  H -10.880  -0.914   4.997 1.00 . A A . 18 LYS HG3  1 1 
        4  3473 1 1 18 LYS HZ1  H -11.400   1.643   4.513 1.00 . A A . 18 LYS HZ1  1 1 
        4  3474 1 1 18 LYS HZ2  H -10.550   1.521   3.061 1.00 . A A . 18 LYS HZ2  1 1 
        4  3475 1 1 18 LYS HZ3  H -10.310   2.854   4.075 1.00 . A A . 18 LYS HZ3  1 1 
        4  3476 1 1 18 LYS N    N  -9.895  -4.910   3.449 1.00 . A A . 18 LYS N    1 1 
        4  3477 1 1 18 LYS NZ   N -10.490   1.831   4.051 1.00 . A A . 18 LYS NZ   1 1 
        4  3478 1 1 18 LYS O    O  -9.303  -2.218   1.206 1.00 . A A . 18 LYS O    1 1 
        4  3479 1 1 19 THR C    C  -7.399  -3.721  -0.431 1.00 . A A . 19 THR C    1 1 
        4  3480 1 1 19 THR CA   C  -6.863  -3.512   0.984 1.00 . A A . 19 THR CA   1 1 
        4  3481 1 1 19 THR CB   C  -5.645  -4.409   1.214 1.00 . A A . 19 THR CB   1 1 
        4  3482 1 1 19 THR CG2  C  -4.472  -4.063   0.324 1.00 . A A . 19 THR CG2  1 1 
        4  3483 1 1 19 THR H    H  -7.735  -4.491   2.646 1.00 . A A . 19 THR H    1 1 
        4  3484 1 1 19 THR HA   H  -6.566  -2.481   1.093 1.00 . A A . 19 THR HA   1 1 
        4  3485 1 1 19 THR HB   H  -5.921  -5.434   1.016 1.00 . A A . 19 THR HB   1 1 
        4  3486 1 1 19 THR HG1  H  -5.637  -4.997   3.083 1.00 . A A . 19 THR HG1  1 1 
        4  3487 1 1 19 THR HG21 H  -3.550  -4.213   0.867 1.00 . A A . 19 THR HG21 1 1 
        4  3488 1 1 19 THR HG22 H  -4.544  -3.031   0.017 1.00 . A A . 19 THR HG22 1 1 
        4  3489 1 1 19 THR HG23 H  -4.481  -4.700  -0.549 1.00 . A A . 19 THR HG23 1 1 
        4  3490 1 1 19 THR N    N  -7.892  -3.790   1.980 1.00 . A A . 19 THR N    1 1 
        4  3491 1 1 19 THR O    O  -7.181  -2.893  -1.315 1.00 . A A . 19 THR O    1 1 
        4  3492 1 1 19 THR OG1  O  -5.204  -4.319   2.557 1.00 . A A . 19 THR OG1  1 1 
        4  3493 1 1 20 ALA C    C -10.000  -4.459  -2.152 1.00 . A A . 20 ALA C    1 1 
        4  3494 1 1 20 ALA CA   C  -8.657  -5.153  -1.943 1.00 . A A . 20 ALA CA   1 1 
        4  3495 1 1 20 ALA CB   C  -8.811  -6.659  -2.097 1.00 . A A . 20 ALA CB   1 1 
        4  3496 1 1 20 ALA H    H  -8.232  -5.457   0.107 1.00 . A A . 20 ALA H    1 1 
        4  3497 1 1 20 ALA HA   H  -7.964  -4.808  -2.697 1.00 . A A . 20 ALA HA   1 1 
        4  3498 1 1 20 ALA HB1  H  -8.557  -6.946  -3.106 1.00 . A A . 20 ALA HB1  1 1 
        4  3499 1 1 20 ALA HB2  H  -9.832  -6.939  -1.888 1.00 . A A . 20 ALA HB2  1 1 
        4  3500 1 1 20 ALA HB3  H  -8.151  -7.160  -1.402 1.00 . A A . 20 ALA HB3  1 1 
        4  3501 1 1 20 ALA N    N  -8.095  -4.835  -0.636 1.00 . A A . 20 ALA N    1 1 
        4  3502 1 1 20 ALA O    O -10.330  -4.058  -3.267 1.00 . A A . 20 ALA O    1 1 
        4  3503 1 1 21 LYS C    C -11.940  -2.215  -1.558 1.00 . A A . 21 LYS C    1 1 
        4  3504 1 1 21 LYS CA   C -12.070  -3.678  -1.142 1.00 . A A . 21 LYS CA   1 1 
        4  3505 1 1 21 LYS CB   C -12.770  -3.773   0.212 1.00 . A A . 21 LYS CB   1 1 
        4  3506 1 1 21 LYS CD   C -14.780  -5.044   1.048 1.00 . A A . 21 LYS CD   1 1 
        4  3507 1 1 21 LYS CE   C -15.200  -4.458   2.385 1.00 . A A . 21 LYS CE   1 1 
        4  3508 1 1 21 LYS CG   C -14.280  -3.964   0.101 1.00 . A A . 21 LYS CG   1 1 
        4  3509 1 1 21 LYS H    H -10.440  -4.663  -0.215 1.00 . A A . 21 LYS H    1 1 
        4  3510 1 1 21 LYS HA   H -12.650  -4.200  -1.881 1.00 . A A . 21 LYS HA   1 1 
        4  3511 1 1 21 LYS HB2  H -12.360  -4.608   0.761 1.00 . A A . 21 LYS HB2  1 1 
        4  3512 1 1 21 LYS HB3  H -12.590  -2.864   0.767 1.00 . A A . 21 LYS HB3  1 1 
        4  3513 1 1 21 LYS HD2  H -15.620  -5.541   0.599 1.00 . A A . 21 LYS HD2  1 1 
        4  3514 1 1 21 LYS HD3  H -13.980  -5.757   1.214 1.00 . A A . 21 LYS HD3  1 1 
        4  3515 1 1 21 LYS HE2  H -16.010  -3.756   2.216 1.00 . A A . 21 LYS HE2  1 1 
        4  3516 1 1 21 LYS HE3  H -15.560  -5.259   3.019 1.00 . A A . 21 LYS HE3  1 1 
        4  3517 1 1 21 LYS HG2  H -14.770  -3.033   0.342 1.00 . A A . 21 LYS HG2  1 1 
        4  3518 1 1 21 LYS HG3  H -14.520  -4.247  -0.913 1.00 . A A . 21 LYS HG3  1 1 
        4  3519 1 1 21 LYS HZ1  H -14.360  -3.486   4.032 1.00 . A A . 21 LYS HZ1  1 1 
        4  3520 1 1 21 LYS HZ2  H -13.830  -2.896   2.541 1.00 . A A . 21 LYS HZ2  1 1 
        4  3521 1 1 21 LYS HZ3  H -13.250  -4.377   3.121 1.00 . A A . 21 LYS HZ3  1 1 
        4  3522 1 1 21 LYS N    N -10.760  -4.322  -1.074 1.00 . A A . 21 LYS N    1 1 
        4  3523 1 1 21 LYS NZ   N -14.080  -3.755   3.068 1.00 . A A . 21 LYS NZ   1 1 
        4  3524 1 1 21 LYS O    O -12.840  -1.655  -2.175 1.00 . A A . 21 LYS O    1 1 
        4  3525 1 1 22 ASP C    C  -9.914  -0.076  -2.921 1.00 . A A . 22 ASP C    1 1 
        4  3526 1 1 22 ASP CA   C -10.570  -0.204  -1.551 1.00 . A A . 22 ASP CA   1 1 
        4  3527 1 1 22 ASP CB   C  -9.693   0.452  -0.485 1.00 . A A . 22 ASP CB   1 1 
        4  3528 1 1 22 ASP CG   C -10.490   1.275   0.501 1.00 . A A . 22 ASP CG   1 1 
        4  3529 1 1 22 ASP H    H -10.130  -2.098  -0.720 1.00 . A A . 22 ASP H    1 1 
        4  3530 1 1 22 ASP HA   H -11.520   0.301  -1.577 1.00 . A A . 22 ASP HA   1 1 
        4  3531 1 1 22 ASP HB2  H  -9.168  -0.318   0.063 1.00 . A A . 22 ASP HB2  1 1 
        4  3532 1 1 22 ASP HB3  H  -8.975   1.101  -0.969 1.00 . A A . 22 ASP HB3  1 1 
        4  3533 1 1 22 ASP N    N -10.810  -1.601  -1.214 1.00 . A A . 22 ASP N    1 1 
        4  3534 1 1 22 ASP O    O -10.140   0.892  -3.645 1.00 . A A . 22 ASP O    1 1 
        4  3535 1 1 22 ASP OD1  O -11.530   0.773   0.990 1.00 . A A . 22 ASP OD1  1 1 
        4  3536 1 1 22 ASP OD2  O -10.090   2.423   0.785 1.00 . A A . 22 ASP OD2  1 1 
        4  3537 1 1 23 LEU C    C  -9.313  -1.525  -5.674 1.00 . A A . 23 LEU C    1 1 
        4  3538 1 1 23 LEU CA   C  -8.393  -1.051  -4.552 1.00 . A A . 23 LEU CA   1 1 
        4  3539 1 1 23 LEU CB   C  -7.147  -1.937  -4.485 1.00 . A A . 23 LEU CB   1 1 
        4  3540 1 1 23 LEU CD1  C  -4.863  -1.551  -3.523 1.00 . A A . 23 LEU CD1  1 1 
        4  3541 1 1 23 LEU CD2  C  -5.195  -1.505  -6.001 1.00 . A A . 23 LEU CD2  1 1 
        4  3542 1 1 23 LEU CG   C  -5.819  -1.193  -4.649 1.00 . A A . 23 LEU CG   1 1 
        4  3543 1 1 23 LEU H    H  -8.941  -1.802  -2.651 1.00 . A A . 23 LEU H    1 1 
        4  3544 1 1 23 LEU HA   H  -8.089  -0.035  -4.757 1.00 . A A . 23 LEU HA   1 1 
        4  3545 1 1 23 LEU HB2  H  -7.142  -2.438  -3.527 1.00 . A A . 23 LEU HB2  1 1 
        4  3546 1 1 23 LEU HB3  H  -7.216  -2.682  -5.262 1.00 . A A . 23 LEU HB3  1 1 
        4  3547 1 1 23 LEU HD11 H  -3.957  -0.972  -3.621 1.00 . A A . 23 LEU HD11 1 1 
        4  3548 1 1 23 LEU HD12 H  -4.625  -2.603  -3.573 1.00 . A A . 23 LEU HD12 1 1 
        4  3549 1 1 23 LEU HD13 H  -5.329  -1.332  -2.574 1.00 . A A . 23 LEU HD13 1 1 
        4  3550 1 1 23 LEU HD21 H  -5.448  -2.514  -6.291 1.00 . A A . 23 LEU HD21 1 1 
        4  3551 1 1 23 LEU HD22 H  -4.119  -1.409  -5.931 1.00 . A A . 23 LEU HD22 1 1 
        4  3552 1 1 23 LEU HD23 H  -5.569  -0.812  -6.739 1.00 . A A . 23 LEU HD23 1 1 
        4  3553 1 1 23 LEU HG   H  -6.002  -0.128  -4.601 1.00 . A A . 23 LEU HG   1 1 
        4  3554 1 1 23 LEU N    N  -9.089  -1.058  -3.270 1.00 . A A . 23 LEU N    1 1 
        4  3555 1 1 23 LEU O    O  -9.264  -1.008  -6.791 1.00 . A A . 23 LEU O    1 1 
        4  3556 1 1 24 GLY C    C -10.670  -4.432  -6.821 1.00 . A A . 24 GLY C    1 1 
        4  3557 1 1 24 GLY CA   C -11.060  -3.040  -6.362 1.00 . A A . 24 GLY CA   1 1 
        4  3558 1 1 24 GLY H    H -10.140  -2.884  -4.463 1.00 . A A . 24 GLY H    1 1 
        4  3559 1 1 24 GLY HA2  H -12.050  -3.075  -5.938 1.00 . A A . 24 GLY HA2  1 1 
        4  3560 1 1 24 GLY HA3  H -11.070  -2.381  -7.218 1.00 . A A . 24 GLY HA3  1 1 
        4  3561 1 1 24 GLY N    N -10.140  -2.511  -5.370 1.00 . A A . 24 GLY N    1 1 
        4  3562 1 1 24 GLY O    O -10.940  -4.814  -7.960 1.00 . A A . 24 GLY O    1 1 
        4  3563 1 1 25 VAL C    C  -9.982  -7.510  -5.116 1.00 . A A . 25 VAL C    1 1 
        4  3564 1 1 25 VAL CA   C  -9.623  -6.548  -6.244 1.00 . A A . 25 VAL CA   1 1 
        4  3565 1 1 25 VAL CB   C  -8.105  -6.614  -6.497 1.00 . A A . 25 VAL CB   1 1 
        4  3566 1 1 25 VAL CG1  C  -7.754  -5.940  -7.814 1.00 . A A . 25 VAL CG1  1 1 
        4  3567 1 1 25 VAL CG2  C  -7.343  -5.978  -5.344 1.00 . A A . 25 VAL CG2  1 1 
        4  3568 1 1 25 VAL H    H  -9.868  -4.828  -5.037 1.00 . A A . 25 VAL H    1 1 
        4  3569 1 1 25 VAL HA   H -10.130  -6.858  -7.146 1.00 . A A . 25 VAL HA   1 1 
        4  3570 1 1 25 VAL HB   H  -7.815  -7.652  -6.562 1.00 . A A . 25 VAL HB   1 1 
        4  3571 1 1 25 VAL HG11 H  -8.194  -6.494  -8.630 1.00 . A A . 25 VAL HG11 1 1 
        4  3572 1 1 25 VAL HG12 H  -6.680  -5.917  -7.932 1.00 . A A . 25 VAL HG12 1 1 
        4  3573 1 1 25 VAL HG13 H  -8.137  -4.930  -7.816 1.00 . A A . 25 VAL HG13 1 1 
        4  3574 1 1 25 VAL HG21 H  -7.213  -6.704  -4.556 1.00 . A A . 25 VAL HG21 1 1 
        4  3575 1 1 25 VAL HG22 H  -7.899  -5.134  -4.967 1.00 . A A . 25 VAL HG22 1 1 
        4  3576 1 1 25 VAL HG23 H  -6.375  -5.647  -5.691 1.00 . A A . 25 VAL HG23 1 1 
        4  3577 1 1 25 VAL N    N -10.050  -5.191  -5.930 1.00 . A A . 25 VAL N    1 1 
        4  3578 1 1 25 VAL O    O -10.590  -7.117  -4.123 1.00 . A A . 25 VAL O    1 1 
        4  3579 1 1 26 GLN C    C  -8.649 -10.065  -3.422 1.00 . A A . 26 GLN C    1 1 
        4  3580 1 1 26 GLN CA   C  -9.883  -9.789  -4.274 1.00 . A A . 26 GLN CA   1 1 
        4  3581 1 1 26 GLN CB   C -10.350 -11.081  -4.943 1.00 . A A . 26 GLN CB   1 1 
        4  3582 1 1 26 GLN CD   C -12.800 -11.605  -5.323 1.00 . A A . 26 GLN CD   1 1 
        4  3583 1 1 26 GLN CG   C -11.560 -10.892  -5.844 1.00 . A A . 26 GLN CG   1 1 
        4  3584 1 1 26 GLN H    H  -9.119  -9.029  -6.089 1.00 . A A . 26 GLN H    1 1 
        4  3585 1 1 26 GLN HA   H -10.660  -9.416  -3.635 1.00 . A A . 26 GLN HA   1 1 
        4  3586 1 1 26 GLN HB2  H  -9.549 -11.479  -5.540 1.00 . A A . 26 GLN HB2  1 1 
        4  3587 1 1 26 GLN HB3  H -10.610 -11.798  -4.176 1.00 . A A . 26 GLN HB3  1 1 
        4  3588 1 1 26 GLN HE21 H -13.960 -10.462  -6.457 1.00 . A A . 26 GLN HE21 1 1 
        4  3589 1 1 26 GLN HE22 H -14.780 -11.636  -5.483 1.00 . A A . 26 GLN HE22 1 1 
        4  3590 1 1 26 GLN HG2  H -11.780  -9.837  -5.916 1.00 . A A . 26 GLN HG2  1 1 
        4  3591 1 1 26 GLN HG3  H -11.330 -11.277  -6.825 1.00 . A A . 26 GLN HG3  1 1 
        4  3592 1 1 26 GLN N    N  -9.601  -8.773  -5.278 1.00 . A A . 26 GLN N    1 1 
        4  3593 1 1 26 GLN NE2  N -13.960 -11.192  -5.803 1.00 . A A . 26 GLN NE2  1 1 
        4  3594 1 1 26 GLN O    O  -7.521  -9.795  -3.837 1.00 . A A . 26 GLN O    1 1 
        4  3595 1 1 26 GLN OE1  O -12.700 -12.515  -4.500 1.00 . A A . 26 GLN OE1  1 1 
        4  3596 1 1 27 GLN C    C  -6.844 -11.965  -1.910 1.00 . A A . 27 GLN C    1 1 
        4  3597 1 1 27 GLN CA   C  -7.784 -10.919  -1.313 1.00 . A A . 27 GLN CA   1 1 
        4  3598 1 1 27 GLN CB   C  -8.342 -11.424   0.019 1.00 . A A . 27 GLN CB   1 1 
        4  3599 1 1 27 GLN CD   C -10.600 -11.343   1.145 1.00 . A A . 27 GLN CD   1 1 
        4  3600 1 1 27 GLN CG   C  -9.440 -10.542   0.592 1.00 . A A . 27 GLN CG   1 1 
        4  3601 1 1 27 GLN H    H  -9.797 -10.794  -1.964 1.00 . A A . 27 GLN H    1 1 
        4  3602 1 1 27 GLN HA   H  -7.228 -10.014  -1.138 1.00 . A A . 27 GLN HA   1 1 
        4  3603 1 1 27 GLN HB2  H  -8.748 -12.416  -0.125 1.00 . A A . 27 GLN HB2  1 1 
        4  3604 1 1 27 GLN HB3  H  -7.539 -11.475   0.737 1.00 . A A . 27 GLN HB3  1 1 
        4  3605 1 1 27 GLN HE21 H -11.780  -9.745   1.050 1.00 . A A . 27 GLN HE21 1 1 
        4  3606 1 1 27 GLN HE22 H -12.510 -11.186   1.654 1.00 . A A . 27 GLN HE22 1 1 
        4  3607 1 1 27 GLN HG2  H  -9.024  -9.944   1.390 1.00 . A A . 27 GLN HG2  1 1 
        4  3608 1 1 27 GLN HG3  H  -9.807  -9.893  -0.189 1.00 . A A . 27 GLN HG3  1 1 
        4  3609 1 1 27 GLN N    N  -8.874 -10.604  -2.231 1.00 . A A . 27 GLN N    1 1 
        4  3610 1 1 27 GLN NE2  N -11.750 -10.692   1.299 1.00 . A A . 27 GLN NE2  1 1 
        4  3611 1 1 27 GLN O    O  -5.709 -12.120  -1.459 1.00 . A A . 27 GLN O    1 1 
        4  3612 1 1 27 GLN OE1  O -10.470 -12.533   1.431 1.00 . A A . 27 GLN OE1  1 1 
        4  3613 1 1 28 SER C    C  -5.311 -13.113  -4.286 1.00 . A A . 28 SER C    1 1 
        4  3614 1 1 28 SER CA   C  -6.527 -13.711  -3.576 1.00 . A A . 28 SER CA   1 1 
        4  3615 1 1 28 SER CB   C  -7.383 -14.485  -4.580 1.00 . A A . 28 SER CB   1 1 
        4  3616 1 1 28 SER H    H  -8.235 -12.515  -3.237 1.00 . A A . 28 SER H    1 1 
        4  3617 1 1 28 SER HA   H  -6.182 -14.393  -2.814 1.00 . A A . 28 SER HA   1 1 
        4  3618 1 1 28 SER HB2  H  -6.757 -15.168  -5.134 1.00 . A A . 28 SER HB2  1 1 
        4  3619 1 1 28 SER HB3  H  -8.141 -15.042  -4.047 1.00 . A A . 28 SER HB3  1 1 
        4  3620 1 1 28 SER HG   H  -8.861 -13.982  -5.763 1.00 . A A . 28 SER HG   1 1 
        4  3621 1 1 28 SER N    N  -7.323 -12.681  -2.922 1.00 . A A . 28 SER N    1 1 
        4  3622 1 1 28 SER O    O  -4.393 -13.837  -4.668 1.00 . A A . 28 SER O    1 1 
        4  3623 1 1 28 SER OG   O  -8.019 -13.607  -5.493 1.00 . A A . 28 SER OG   1 1 
        4  3624 1 1 29 ALA C    C  -3.256 -10.483  -4.120 1.00 . A A . 29 ALA C    1 1 
        4  3625 1 1 29 ALA CA   C  -4.204 -11.118  -5.131 1.00 . A A . 29 ALA CA   1 1 
        4  3626 1 1 29 ALA CB   C  -4.733 -10.066  -6.093 1.00 . A A . 29 ALA CB   1 1 
        4  3627 1 1 29 ALA H    H  -6.070 -11.266  -4.144 1.00 . A A . 29 ALA H    1 1 
        4  3628 1 1 29 ALA HA   H  -3.659 -11.855  -5.702 1.00 . A A . 29 ALA HA   1 1 
        4  3629 1 1 29 ALA HB1  H  -4.908 -10.519  -7.059 1.00 . A A . 29 ALA HB1  1 1 
        4  3630 1 1 29 ALA HB2  H  -4.009  -9.272  -6.192 1.00 . A A . 29 ALA HB2  1 1 
        4  3631 1 1 29 ALA HB3  H  -5.661  -9.664  -5.712 1.00 . A A . 29 ALA HB3  1 1 
        4  3632 1 1 29 ALA N    N  -5.310 -11.795  -4.464 1.00 . A A . 29 ALA N    1 1 
        4  3633 1 1 29 ALA O    O  -2.040 -10.467  -4.321 1.00 . A A . 29 ALA O    1 1 
        4  3634 1 1 30 ILE C    C  -2.105 -10.364  -1.319 1.00 . A A . 30 ILE C    1 1 
        4  3635 1 1 30 ILE CA   C  -3.008  -9.335  -1.993 1.00 . A A . 30 ILE CA   1 1 
        4  3636 1 1 30 ILE CB   C  -3.897  -8.643  -0.930 1.00 . A A . 30 ILE CB   1 1 
        4  3637 1 1 30 ILE CD1  C  -5.408  -7.639  -2.722 1.00 . A A . 30 ILE CD1  1 1 
        4  3638 1 1 30 ILE CG1  C  -4.535  -7.380  -1.513 1.00 . A A . 30 ILE CG1  1 1 
        4  3639 1 1 30 ILE CG2  C  -3.089  -8.298   0.315 1.00 . A A . 30 ILE CG2  1 1 
        4  3640 1 1 30 ILE H    H  -4.785 -10.011  -2.925 1.00 . A A . 30 ILE H    1 1 
        4  3641 1 1 30 ILE HA   H  -2.391  -8.582  -2.461 1.00 . A A . 30 ILE HA   1 1 
        4  3642 1 1 30 ILE HB   H  -4.678  -9.332  -0.644 1.00 . A A . 30 ILE HB   1 1 
        4  3643 1 1 30 ILE HD11 H  -6.033  -6.779  -2.907 1.00 . A A . 30 ILE HD11 1 1 
        4  3644 1 1 30 ILE HD12 H  -6.030  -8.503  -2.539 1.00 . A A . 30 ILE HD12 1 1 
        4  3645 1 1 30 ILE HD13 H  -4.783  -7.822  -3.584 1.00 . A A . 30 ILE HD13 1 1 
        4  3646 1 1 30 ILE HG12 H  -5.151  -6.914  -0.758 1.00 . A A . 30 ILE HG12 1 1 
        4  3647 1 1 30 ILE HG13 H  -3.755  -6.693  -1.809 1.00 . A A . 30 ILE HG13 1 1 
        4  3648 1 1 30 ILE HG21 H  -2.850  -9.205   0.851 1.00 . A A . 30 ILE HG21 1 1 
        4  3649 1 1 30 ILE HG22 H  -3.670  -7.646   0.950 1.00 . A A . 30 ILE HG22 1 1 
        4  3650 1 1 30 ILE HG23 H  -2.177  -7.799   0.025 1.00 . A A . 30 ILE HG23 1 1 
        4  3651 1 1 30 ILE N    N  -3.813  -9.965  -3.032 1.00 . A A . 30 ILE N    1 1 
        4  3652 1 1 30 ILE O    O  -1.011 -10.037  -0.856 1.00 . A A . 30 ILE O    1 1 
        4  3653 1 1 31 ASN C    C  -0.558 -13.001  -1.486 1.00 . A A . 31 ASN C    1 1 
        4  3654 1 1 31 ASN CA   C  -1.800 -12.685  -0.661 1.00 . A A . 31 ASN CA   1 1 
        4  3655 1 1 31 ASN CB   C  -2.665 -13.940  -0.517 1.00 . A A . 31 ASN CB   1 1 
        4  3656 1 1 31 ASN CG   C  -2.146 -14.879   0.555 1.00 . A A . 31 ASN CG   1 1 
        4  3657 1 1 31 ASN H    H  -3.443 -11.809  -1.658 1.00 . A A . 31 ASN H    1 1 
        4  3658 1 1 31 ASN HA   H  -1.495 -12.356   0.319 1.00 . A A . 31 ASN HA   1 1 
        4  3659 1 1 31 ASN HB2  H  -3.671 -13.648  -0.258 1.00 . A A . 31 ASN HB2  1 1 
        4  3660 1 1 31 ASN HB3  H  -2.678 -14.469  -1.458 1.00 . A A . 31 ASN HB3  1 1 
        4  3661 1 1 31 ASN HD21 H  -2.216 -13.414   1.902 1.00 . A A . 31 ASN HD21 1 1 
        4  3662 1 1 31 ASN HD22 H  -1.654 -14.952   2.482 1.00 . A A . 31 ASN HD22 1 1 
        4  3663 1 1 31 ASN N    N  -2.567 -11.609  -1.272 1.00 . A A . 31 ASN N    1 1 
        4  3664 1 1 31 ASN ND2  N  -1.990 -14.363   1.768 1.00 . A A . 31 ASN ND2  1 1 
        4  3665 1 1 31 ASN O    O   0.534 -13.170  -0.943 1.00 . A A . 31 ASN O    1 1 
        4  3666 1 1 31 ASN OD1  O  -1.889 -16.054   0.294 1.00 . A A . 31 ASN OD1  1 1 
        4  3667 1 1 32 LYS C    C   1.378 -12.236  -3.741 1.00 . A A . 32 LYS C    1 1 
        4  3668 1 1 32 LYS CA   C   0.372 -13.378  -3.703 1.00 . A A . 32 LYS CA   1 1 
        4  3669 1 1 32 LYS CB   C  -0.157 -13.651  -5.112 1.00 . A A . 32 LYS CB   1 1 
        4  3670 1 1 32 LYS CD   C  -1.985 -15.322  -4.667 1.00 . A A . 32 LYS CD   1 1 
        4  3671 1 1 32 LYS CE   C  -1.907 -16.401  -3.600 1.00 . A A . 32 LYS CE   1 1 
        4  3672 1 1 32 LYS CG   C  -0.630 -15.079  -5.317 1.00 . A A . 32 LYS CG   1 1 
        4  3673 1 1 32 LYS H    H  -1.625 -12.939  -3.177 1.00 . A A . 32 LYS H    1 1 
        4  3674 1 1 32 LYS HA   H   0.864 -14.259  -3.337 1.00 . A A . 32 LYS HA   1 1 
        4  3675 1 1 32 LYS HB2  H  -0.987 -12.989  -5.306 1.00 . A A . 32 LYS HB2  1 1 
        4  3676 1 1 32 LYS HB3  H   0.629 -13.448  -5.824 1.00 . A A . 32 LYS HB3  1 1 
        4  3677 1 1 32 LYS HD2  H  -2.324 -14.405  -4.212 1.00 . A A . 32 LYS HD2  1 1 
        4  3678 1 1 32 LYS HD3  H  -2.686 -15.631  -5.428 1.00 . A A . 32 LYS HD3  1 1 
        4  3679 1 1 32 LYS HE2  H  -1.498 -17.298  -4.039 1.00 . A A . 32 LYS HE2  1 1 
        4  3680 1 1 32 LYS HE3  H  -1.255 -16.060  -2.807 1.00 . A A . 32 LYS HE3  1 1 
        4  3681 1 1 32 LYS HG2  H  -0.712 -15.270  -6.375 1.00 . A A . 32 LYS HG2  1 1 
        4  3682 1 1 32 LYS HG3  H   0.095 -15.750  -4.882 1.00 . A A . 32 LYS HG3  1 1 
        4  3683 1 1 32 LYS HZ1  H  -3.172 -17.507  -2.359 1.00 . A A . 32 LYS HZ1  1 1 
        4  3684 1 1 32 LYS HZ2  H  -3.908 -16.970  -3.784 1.00 . A A . 32 LYS HZ2  1 1 
        4  3685 1 1 32 LYS HZ3  H  -3.619 -15.884  -2.521 1.00 . A A . 32 LYS HZ3  1 1 
        4  3686 1 1 32 LYS N    N  -0.733 -13.080  -2.802 1.00 . A A . 32 LYS N    1 1 
        4  3687 1 1 32 LYS NZ   N  -3.245 -16.712  -3.025 1.00 . A A . 32 LYS NZ   1 1 
        4  3688 1 1 32 LYS O    O   2.561 -12.444  -4.012 1.00 . A A . 32 LYS O    1 1 
        4  3689 1 1 33 TRP C    C   2.719  -9.862  -2.317 1.00 . A A . 33 TRP C    1 1 
        4  3690 1 1 33 TRP CA   C   1.739  -9.852  -3.485 1.00 . A A . 33 TRP CA   1 1 
        4  3691 1 1 33 TRP CB   C   0.839  -8.629  -3.424 1.00 . A A . 33 TRP CB   1 1 
        4  3692 1 1 33 TRP CD1  C   0.219  -9.096  -5.826 1.00 . A A . 33 TRP CD1  1 1 
        4  3693 1 1 33 TRP CD2  C  -1.100  -7.602  -4.837 1.00 . A A . 33 TRP CD2  1 1 
        4  3694 1 1 33 TRP CE2  C  -1.537  -7.771  -6.162 1.00 . A A . 33 TRP CE2  1 1 
        4  3695 1 1 33 TRP CE3  C  -1.778  -6.712  -4.009 1.00 . A A . 33 TRP CE3  1 1 
        4  3696 1 1 33 TRP CG   C   0.030  -8.452  -4.656 1.00 . A A . 33 TRP CG   1 1 
        4  3697 1 1 33 TRP CH2  C  -3.278  -6.210  -5.845 1.00 . A A . 33 TRP CH2  1 1 
        4  3698 1 1 33 TRP CZ2  C  -2.627  -7.079  -6.679 1.00 . A A . 33 TRP CZ2  1 1 
        4  3699 1 1 33 TRP CZ3  C  -2.863  -6.024  -4.519 1.00 . A A . 33 TRP CZ3  1 1 
        4  3700 1 1 33 TRP H    H  -0.053 -10.923  -3.273 1.00 . A A . 33 TRP H    1 1 
        4  3701 1 1 33 TRP HA   H   2.287  -9.837  -4.414 1.00 . A A . 33 TRP HA   1 1 
        4  3702 1 1 33 TRP HB2  H   0.155  -8.750  -2.611 1.00 . A A . 33 TRP HB2  1 1 
        4  3703 1 1 33 TRP HB3  H   1.436  -7.748  -3.275 1.00 . A A . 33 TRP HB3  1 1 
        4  3704 1 1 33 TRP HD1  H   1.000  -9.812  -5.981 1.00 . A A . 33 TRP HD1  1 1 
        4  3705 1 1 33 TRP HE1  H  -0.774  -9.012  -7.670 1.00 . A A . 33 TRP HE1  1 1 
        4  3706 1 1 33 TRP HE3  H  -1.469  -6.567  -2.986 1.00 . A A . 33 TRP HE3  1 1 
        4  3707 1 1 33 TRP HH2  H  -4.130  -5.650  -6.204 1.00 . A A . 33 TRP HH2  1 1 
        4  3708 1 1 33 TRP HZ2  H  -2.955  -7.214  -7.699 1.00 . A A . 33 TRP HZ2  1 1 
        4  3709 1 1 33 TRP HZ3  H  -3.401  -5.328  -3.892 1.00 . A A . 33 TRP HZ3  1 1 
        4  3710 1 1 33 TRP N    N   0.899 -11.030  -3.476 1.00 . A A . 33 TRP N    1 1 
        4  3711 1 1 33 TRP NE1  N  -0.711  -8.693  -6.748 1.00 . A A . 33 TRP NE1  1 1 
        4  3712 1 1 33 TRP O    O   3.922  -9.680  -2.501 1.00 . A A . 33 TRP O    1 1 
        4  3713 1 1 34 ILE C    C   3.755 -11.459   0.202 1.00 . A A . 34 ILE C    1 1 
        4  3714 1 1 34 ILE CA   C   3.029 -10.122   0.083 1.00 . A A . 34 ILE CA   1 1 
        4  3715 1 1 34 ILE CB   C   2.194  -9.888   1.356 1.00 . A A . 34 ILE CB   1 1 
        4  3716 1 1 34 ILE CD1  C   0.177  -8.584   2.199 1.00 . A A . 34 ILE CD1  1 1 
        4  3717 1 1 34 ILE CG1  C   1.304  -8.655   1.191 1.00 . A A . 34 ILE CG1  1 1 
        4  3718 1 1 34 ILE CG2  C   3.103  -9.735   2.566 1.00 . A A . 34 ILE CG2  1 1 
        4  3719 1 1 34 ILE H    H   1.232 -10.223  -1.030 1.00 . A A . 34 ILE H    1 1 
        4  3720 1 1 34 ILE HA   H   3.761  -9.331   0.007 1.00 . A A . 34 ILE HA   1 1 
        4  3721 1 1 34 ILE HB   H   1.569 -10.756   1.514 1.00 . A A . 34 ILE HB   1 1 
        4  3722 1 1 34 ILE HD11 H   0.588  -8.481   3.192 1.00 . A A . 34 ILE HD11 1 1 
        4  3723 1 1 34 ILE HD12 H  -0.412  -9.488   2.144 1.00 . A A . 34 ILE HD12 1 1 
        4  3724 1 1 34 ILE HD13 H  -0.450  -7.732   1.979 1.00 . A A . 34 ILE HD13 1 1 
        4  3725 1 1 34 ILE HG12 H   1.907  -7.767   1.306 1.00 . A A . 34 ILE HG12 1 1 
        4  3726 1 1 34 ILE HG13 H   0.867  -8.663   0.204 1.00 . A A . 34 ILE HG13 1 1 
        4  3727 1 1 34 ILE HG21 H   3.843  -8.973   2.367 1.00 . A A . 34 ILE HG21 1 1 
        4  3728 1 1 34 ILE HG22 H   3.597 -10.674   2.766 1.00 . A A . 34 ILE HG22 1 1 
        4  3729 1 1 34 ILE HG23 H   2.514  -9.449   3.425 1.00 . A A . 34 ILE HG23 1 1 
        4  3730 1 1 34 ILE N    N   2.198 -10.081  -1.114 1.00 . A A . 34 ILE N    1 1 
        4  3731 1 1 34 ILE O    O   4.784 -11.559   0.871 1.00 . A A . 34 ILE O    1 1 
        4  3732 1 1 35 HIS C    C   5.207 -13.801  -1.031 1.00 . A A . 35 HIS C    1 1 
        4  3733 1 1 35 HIS CA   C   3.813 -13.813  -0.419 1.00 . A A . 35 HIS CA   1 1 
        4  3734 1 1 35 HIS CB   C   2.924 -14.805  -1.171 1.00 . A A . 35 HIS CB   1 1 
        4  3735 1 1 35 HIS CD2  C   1.408 -16.804  -0.526 1.00 . A A . 35 HIS CD2  1 1 
        4  3736 1 1 35 HIS CE1  C   1.073 -16.291   1.580 1.00 . A A . 35 HIS CE1  1 1 
        4  3737 1 1 35 HIS CG   C   2.081 -15.657  -0.274 1.00 . A A . 35 HIS CG   1 1 
        4  3738 1 1 35 HIS H    H   2.395 -12.345  -0.968 1.00 . A A . 35 HIS H    1 1 
        4  3739 1 1 35 HIS HA   H   3.889 -14.117   0.609 1.00 . A A . 35 HIS HA   1 1 
        4  3740 1 1 35 HIS HB2  H   2.263 -14.260  -1.826 1.00 . A A . 35 HIS HB2  1 1 
        4  3741 1 1 35 HIS HB3  H   3.547 -15.458  -1.762 1.00 . A A . 35 HIS HB3  1 1 
        4  3742 1 1 35 HIS HD1  H   2.204 -14.585   1.535 1.00 . A A . 35 HIS HD1  1 1 
        4  3743 1 1 35 HIS HD2  H   1.364 -17.326  -1.471 1.00 . A A . 35 HIS HD2  1 1 
        4  3744 1 1 35 HIS HE1  H   0.728 -16.321   2.602 1.00 . A A . 35 HIS HE1  1 1 
        4  3745 1 1 35 HIS HE2  H   0.154 -17.916   0.738 1.00 . A A . 35 HIS HE2  1 1 
        4  3746 1 1 35 HIS N    N   3.215 -12.484  -0.451 1.00 . A A . 35 HIS N    1 1 
        4  3747 1 1 35 HIS ND1  N   1.851 -15.362   1.052 1.00 . A A . 35 HIS ND1  1 1 
        4  3748 1 1 35 HIS NE2  N   0.791 -17.177   0.642 1.00 . A A . 35 HIS NE2  1 1 
        4  3749 1 1 35 HIS O    O   6.067 -14.601  -0.664 1.00 . A A . 35 HIS O    1 1 
        4  3750 1 1 36 ALA C    C   7.445 -11.499  -2.224 1.00 . A A . 36 ALA C    1 1 
        4  3751 1 1 36 ALA CA   C   6.706 -12.769  -2.644 1.00 . A A . 36 ALA CA   1 1 
        4  3752 1 1 36 ALA CB   C   6.507 -12.796  -4.150 1.00 . A A . 36 ALA CB   1 1 
        4  3753 1 1 36 ALA H    H   4.690 -12.286  -2.216 1.00 . A A . 36 ALA H    1 1 
        4  3754 1 1 36 ALA HA   H   7.305 -13.626  -2.371 1.00 . A A . 36 ALA HA   1 1 
        4  3755 1 1 36 ALA HB1  H   7.412 -13.144  -4.627 1.00 . A A . 36 ALA HB1  1 1 
        4  3756 1 1 36 ALA HB2  H   6.274 -11.801  -4.500 1.00 . A A . 36 ALA HB2  1 1 
        4  3757 1 1 36 ALA HB3  H   5.692 -13.463  -4.394 1.00 . A A . 36 ALA HB3  1 1 
        4  3758 1 1 36 ALA N    N   5.419 -12.890  -1.969 1.00 . A A . 36 ALA N    1 1 
        4  3759 1 1 36 ALA O    O   8.494 -11.173  -2.779 1.00 . A A . 36 ALA O    1 1 
        4  3760 1 1 37 GLY C    C   7.584  -8.489  -1.840 1.00 . A A . 37 GLY C    1 1 
        4  3761 1 1 37 GLY CA   C   7.526  -9.567  -0.775 1.00 . A A . 37 GLY CA   1 1 
        4  3762 1 1 37 GLY H    H   6.062 -11.092  -0.834 1.00 . A A . 37 GLY H    1 1 
        4  3763 1 1 37 GLY HA2  H   6.970  -9.190   0.071 1.00 . A A . 37 GLY HA2  1 1 
        4  3764 1 1 37 GLY HA3  H   8.532  -9.795  -0.455 1.00 . A A . 37 GLY HA3  1 1 
        4  3765 1 1 37 GLY N    N   6.896 -10.786  -1.244 1.00 . A A . 37 GLY N    1 1 
        4  3766 1 1 37 GLY O    O   8.646  -7.926  -2.104 1.00 . A A . 37 GLY O    1 1 
        4  3767 1 1 38 ARG C    C   6.376  -5.783  -2.878 1.00 . A A . 38 ARG C    1 1 
        4  3768 1 1 38 ARG CA   C   6.369  -7.179  -3.491 1.00 . A A . 38 ARG CA   1 1 
        4  3769 1 1 38 ARG CB   C   5.114  -7.374  -4.344 1.00 . A A . 38 ARG CB   1 1 
        4  3770 1 1 38 ARG CD   C   5.300  -5.909  -6.377 1.00 . A A . 38 ARG CD   1 1 
        4  3771 1 1 38 ARG CG   C   5.381  -7.329  -5.840 1.00 . A A . 38 ARG CG   1 1 
        4  3772 1 1 38 ARG CZ   C   7.695  -5.452  -6.742 1.00 . A A . 38 ARG CZ   1 1 
        4  3773 1 1 38 ARG H    H   5.626  -8.682  -2.197 1.00 . A A . 38 ARG H    1 1 
        4  3774 1 1 38 ARG HA   H   7.241  -7.287  -4.120 1.00 . A A . 38 ARG HA   1 1 
        4  3775 1 1 38 ARG HB2  H   4.677  -8.333  -4.107 1.00 . A A . 38 ARG HB2  1 1 
        4  3776 1 1 38 ARG HB3  H   4.403  -6.596  -4.103 1.00 . A A . 38 ARG HB3  1 1 
        4  3777 1 1 38 ARG HD2  H   5.108  -5.951  -7.440 1.00 . A A . 38 ARG HD2  1 1 
        4  3778 1 1 38 ARG HD3  H   4.487  -5.398  -5.885 1.00 . A A . 38 ARG HD3  1 1 
        4  3779 1 1 38 ARG HE   H   6.504  -4.414  -5.523 1.00 . A A . 38 ARG HE   1 1 
        4  3780 1 1 38 ARG HG2  H   6.369  -7.719  -6.031 1.00 . A A . 38 ARG HG2  1 1 
        4  3781 1 1 38 ARG HG3  H   4.646  -7.939  -6.345 1.00 . A A . 38 ARG HG3  1 1 
        4  3782 1 1 38 ARG HH11 H   6.971  -7.018  -7.798 1.00 . A A . 38 ARG HH11 1 1 
        4  3783 1 1 38 ARG HH12 H   8.652  -6.675  -8.037 1.00 . A A . 38 ARG HH12 1 1 
        4  3784 1 1 38 ARG HH21 H   8.714  -3.960  -5.837 1.00 . A A . 38 ARG HH21 1 1 
        4  3785 1 1 38 ARG HH22 H   9.641  -4.940  -6.924 1.00 . A A . 38 ARG HH22 1 1 
        4  3786 1 1 38 ARG N    N   6.440  -8.200  -2.452 1.00 . A A . 38 ARG N    1 1 
        4  3787 1 1 38 ARG NE   N   6.537  -5.166  -6.150 1.00 . A A . 38 ARG NE   1 1 
        4  3788 1 1 38 ARG NH1  N   7.779  -6.465  -7.595 1.00 . A A . 38 ARG NH1  1 1 
        4  3789 1 1 38 ARG NH2  N   8.771  -4.725  -6.479 1.00 . A A . 38 ARG NH2  1 1 
        4  3790 1 1 38 ARG O    O   5.432  -5.392  -2.190 1.00 . A A . 38 ARG O    1 1 
        4  3791 1 1 39 LYS C    C   6.535  -2.753  -3.201 1.00 . A A . 39 LYS C    1 1 
        4  3792 1 1 39 LYS CA   C   7.579  -3.686  -2.594 1.00 . A A . 39 LYS CA   1 1 
        4  3793 1 1 39 LYS CB   C   8.987  -3.146  -2.860 1.00 . A A . 39 LYS CB   1 1 
        4  3794 1 1 39 LYS CD   C  11.011  -1.959  -1.955 1.00 . A A . 39 LYS CD   1 1 
        4  3795 1 1 39 LYS CE   C  12.167  -2.890  -1.627 1.00 . A A . 39 LYS CE   1 1 
        4  3796 1 1 39 LYS CG   C   9.669  -2.593  -1.620 1.00 . A A . 39 LYS CG   1 1 
        4  3797 1 1 39 LYS H    H   8.168  -5.405  -3.678 1.00 . A A . 39 LYS H    1 1 
        4  3798 1 1 39 LYS HA   H   7.420  -3.736  -1.528 1.00 . A A . 39 LYS HA   1 1 
        4  3799 1 1 39 LYS HB2  H   9.597  -3.944  -3.256 1.00 . A A . 39 LYS HB2  1 1 
        4  3800 1 1 39 LYS HB3  H   8.926  -2.355  -3.593 1.00 . A A . 39 LYS HB3  1 1 
        4  3801 1 1 39 LYS HD2  H  11.034  -1.730  -3.011 1.00 . A A . 39 LYS HD2  1 1 
        4  3802 1 1 39 LYS HD3  H  11.120  -1.049  -1.385 1.00 . A A . 39 LYS HD3  1 1 
        4  3803 1 1 39 LYS HE2  H  12.890  -2.349  -1.035 1.00 . A A . 39 LYS HE2  1 1 
        4  3804 1 1 39 LYS HE3  H  11.791  -3.726  -1.056 1.00 . A A . 39 LYS HE3  1 1 
        4  3805 1 1 39 LYS HG2  H   9.031  -1.847  -1.172 1.00 . A A . 39 LYS HG2  1 1 
        4  3806 1 1 39 LYS HG3  H   9.827  -3.400  -0.919 1.00 . A A . 39 LYS HG3  1 1 
        4  3807 1 1 39 LYS HZ1  H  12.177  -3.364  -3.662 1.00 . A A . 39 LYS HZ1  1 1 
        4  3808 1 1 39 LYS HZ2  H  13.135  -4.389  -2.716 1.00 . A A . 39 LYS HZ2  1 1 
        4  3809 1 1 39 LYS HZ3  H  13.670  -2.824  -3.077 1.00 . A A . 39 LYS HZ3  1 1 
        4  3810 1 1 39 LYS N    N   7.448  -5.038  -3.127 1.00 . A A . 39 LYS N    1 1 
        4  3811 1 1 39 LYS NZ   N  12.834  -3.403  -2.856 1.00 . A A . 39 LYS NZ   1 1 
        4  3812 1 1 39 LYS O    O   6.789  -2.090  -4.207 1.00 . A A . 39 LYS O    1 1 
        4  3813 1 1 40 ILE C    C   3.924  -0.795  -2.007 1.00 . A A . 40 ILE C    1 1 
        4  3814 1 1 40 ILE CA   C   4.279  -1.847  -3.051 1.00 . A A . 40 ILE CA   1 1 
        4  3815 1 1 40 ILE CB   C   3.015  -2.664  -3.383 1.00 . A A . 40 ILE CB   1 1 
        4  3816 1 1 40 ILE CD1  C   2.172  -4.712  -4.631 1.00 . A A . 40 ILE CD1  1 1 
        4  3817 1 1 40 ILE CG1  C   3.370  -3.866  -4.257 1.00 . A A . 40 ILE CG1  1 1 
        4  3818 1 1 40 ILE CG2  C   1.983  -1.785  -4.073 1.00 . A A . 40 ILE CG2  1 1 
        4  3819 1 1 40 ILE H    H   5.221  -3.252  -1.780 1.00 . A A . 40 ILE H    1 1 
        4  3820 1 1 40 ILE HA   H   4.611  -1.351  -3.952 1.00 . A A . 40 ILE HA   1 1 
        4  3821 1 1 40 ILE HB   H   2.588  -3.015  -2.455 1.00 . A A . 40 ILE HB   1 1 
        4  3822 1 1 40 ILE HD11 H   2.264  -5.686  -4.176 1.00 . A A . 40 ILE HD11 1 1 
        4  3823 1 1 40 ILE HD12 H   2.127  -4.818  -5.705 1.00 . A A . 40 ILE HD12 1 1 
        4  3824 1 1 40 ILE HD13 H   1.271  -4.233  -4.278 1.00 . A A . 40 ILE HD13 1 1 
        4  3825 1 1 40 ILE HG12 H   3.827  -3.516  -5.171 1.00 . A A . 40 ILE HG12 1 1 
        4  3826 1 1 40 ILE HG13 H   4.070  -4.496  -3.728 1.00 . A A . 40 ILE HG13 1 1 
        4  3827 1 1 40 ILE HG21 H   1.238  -2.406  -4.545 1.00 . A A . 40 ILE HG21 1 1 
        4  3828 1 1 40 ILE HG22 H   2.470  -1.176  -4.821 1.00 . A A . 40 ILE HG22 1 1 
        4  3829 1 1 40 ILE HG23 H   1.508  -1.146  -3.342 1.00 . A A . 40 ILE HG23 1 1 
        4  3830 1 1 40 ILE N    N   5.362  -2.703  -2.578 1.00 . A A . 40 ILE N    1 1 
        4  3831 1 1 40 ILE O    O   4.254  -0.940  -0.830 1.00 . A A . 40 ILE O    1 1 
        4  3832 1 1 41 PHE C    C   1.467   1.874  -1.896 1.00 . A A . 41 PHE C    1 1 
        4  3833 1 1 41 PHE CA   C   2.847   1.332  -1.535 1.00 . A A . 41 PHE CA   1 1 
        4  3834 1 1 41 PHE CB   C   3.867   2.470  -1.559 1.00 . A A . 41 PHE CB   1 1 
        4  3835 1 1 41 PHE CD1  C   6.137   1.463  -1.922 1.00 . A A . 41 PHE CD1  1 1 
        4  3836 1 1 41 PHE CD2  C   5.603   2.303   0.246 1.00 . A A . 41 PHE CD2  1 1 
        4  3837 1 1 41 PHE CE1  C   7.392   1.097  -1.473 1.00 . A A . 41 PHE CE1  1 1 
        4  3838 1 1 41 PHE CE2  C   6.855   1.938   0.700 1.00 . A A . 41 PHE CE2  1 1 
        4  3839 1 1 41 PHE CG   C   5.230   2.070  -1.069 1.00 . A A . 41 PHE CG   1 1 
        4  3840 1 1 41 PHE CZ   C   7.752   1.335  -0.161 1.00 . A A . 41 PHE CZ   1 1 
        4  3841 1 1 41 PHE H    H   3.009   0.323  -3.391 1.00 . A A . 41 PHE H    1 1 
        4  3842 1 1 41 PHE HA   H   2.809   0.918  -0.540 1.00 . A A . 41 PHE HA   1 1 
        4  3843 1 1 41 PHE HB2  H   3.971   2.829  -2.572 1.00 . A A . 41 PHE HB2  1 1 
        4  3844 1 1 41 PHE HB3  H   3.509   3.273  -0.932 1.00 . A A . 41 PHE HB3  1 1 
        4  3845 1 1 41 PHE HD1  H   5.858   1.278  -2.948 1.00 . A A . 41 PHE HD1  1 1 
        4  3846 1 1 41 PHE HD2  H   4.903   2.775   0.919 1.00 . A A . 41 PHE HD2  1 1 
        4  3847 1 1 41 PHE HE1  H   8.092   0.624  -2.148 1.00 . A A . 41 PHE HE1  1 1 
        4  3848 1 1 41 PHE HE2  H   7.134   2.124   1.726 1.00 . A A . 41 PHE HE2  1 1 
        4  3849 1 1 41 PHE HZ   H   8.732   1.048   0.192 1.00 . A A . 41 PHE HZ   1 1 
        4  3850 1 1 41 PHE N    N   3.247   0.263  -2.442 1.00 . A A . 41 PHE N    1 1 
        4  3851 1 1 41 PHE O    O   1.285   2.485  -2.949 1.00 . A A . 41 PHE O    1 1 
        4  3852 1 1 42 LEU C    C  -1.005   3.582  -0.879 1.00 . A A . 42 LEU C    1 1 
        4  3853 1 1 42 LEU CA   C  -0.860   2.106  -1.231 1.00 . A A . 42 LEU CA   1 1 
        4  3854 1 1 42 LEU CB   C  -1.833   1.278  -0.393 1.00 . A A . 42 LEU CB   1 1 
        4  3855 1 1 42 LEU CD1  C  -1.122  -1.121  -0.321 1.00 . A A . 42 LEU CD1  1 1 
        4  3856 1 1 42 LEU CD2  C  -3.533  -0.545  -0.655 1.00 . A A . 42 LEU CD2  1 1 
        4  3857 1 1 42 LEU CG   C  -2.097  -0.125  -0.929 1.00 . A A . 42 LEU CG   1 1 
        4  3858 1 1 42 LEU H    H   0.713   1.149  -0.198 1.00 . A A . 42 LEU H    1 1 
        4  3859 1 1 42 LEU HA   H  -1.096   1.971  -2.277 1.00 . A A . 42 LEU HA   1 1 
        4  3860 1 1 42 LEU HB2  H  -1.432   1.192   0.607 1.00 . A A . 42 LEU HB2  1 1 
        4  3861 1 1 42 LEU HB3  H  -2.773   1.805  -0.344 1.00 . A A . 42 LEU HB3  1 1 
        4  3862 1 1 42 LEU HD11 H  -0.790  -0.758   0.641 1.00 . A A . 42 LEU HD11 1 1 
        4  3863 1 1 42 LEU HD12 H  -0.271  -1.236  -0.974 1.00 . A A . 42 LEU HD12 1 1 
        4  3864 1 1 42 LEU HD13 H  -1.613  -2.075  -0.196 1.00 . A A . 42 LEU HD13 1 1 
        4  3865 1 1 42 LEU HD21 H  -3.633  -0.834   0.380 1.00 . A A . 42 LEU HD21 1 1 
        4  3866 1 1 42 LEU HD22 H  -3.790  -1.382  -1.287 1.00 . A A . 42 LEU HD22 1 1 
        4  3867 1 1 42 LEU HD23 H  -4.195   0.281  -0.863 1.00 . A A . 42 LEU HD23 1 1 
        4  3868 1 1 42 LEU HG   H  -1.947  -0.120  -1.995 1.00 . A A . 42 LEU HG   1 1 
        4  3869 1 1 42 LEU N    N   0.503   1.644  -1.016 1.00 . A A . 42 LEU N    1 1 
        4  3870 1 1 42 LEU O    O  -0.573   4.021   0.186 1.00 . A A . 42 LEU O    1 1 
        4  3871 1 1 43 THR C    C  -3.301   6.041  -1.249 1.00 . A A . 43 THR C    1 1 
        4  3872 1 1 43 THR CA   C  -1.836   5.762  -1.560 1.00 . A A . 43 THR CA   1 1 
        4  3873 1 1 43 THR CB   C  -1.400   6.562  -2.787 1.00 . A A . 43 THR CB   1 1 
        4  3874 1 1 43 THR CG2  C  -0.865   7.935  -2.446 1.00 . A A . 43 THR CG2  1 1 
        4  3875 1 1 43 THR H    H  -1.950   3.927  -2.605 1.00 . A A . 43 THR H    1 1 
        4  3876 1 1 43 THR HA   H  -1.236   6.061  -0.713 1.00 . A A . 43 THR HA   1 1 
        4  3877 1 1 43 THR HB   H  -2.250   6.691  -3.441 1.00 . A A . 43 THR HB   1 1 
        4  3878 1 1 43 THR HG1  H   0.367   5.730  -2.929 1.00 . A A . 43 THR HG1  1 1 
        4  3879 1 1 43 THR HG21 H  -0.834   8.053  -1.371 1.00 . A A . 43 THR HG21 1 1 
        4  3880 1 1 43 THR HG22 H  -1.511   8.689  -2.870 1.00 . A A . 43 THR HG22 1 1 
        4  3881 1 1 43 THR HG23 H   0.131   8.045  -2.848 1.00 . A A . 43 THR HG23 1 1 
        4  3882 1 1 43 THR N    N  -1.623   4.338  -1.777 1.00 . A A . 43 THR N    1 1 
        4  3883 1 1 43 THR O    O  -4.186   5.724  -2.047 1.00 . A A . 43 THR O    1 1 
        4  3884 1 1 43 THR OG1  O  -0.389   5.874  -3.503 1.00 . A A . 43 THR OG1  1 1 
        4  3885 1 1 44 ILE C    C  -5.328   8.329  -0.158 1.00 . A A . 44 ILE C    1 1 
        4  3886 1 1 44 ILE CA   C  -4.912   6.947   0.333 1.00 . A A . 44 ILE CA   1 1 
        4  3887 1 1 44 ILE CB   C  -5.057   6.895   1.867 1.00 . A A . 44 ILE CB   1 1 
        4  3888 1 1 44 ILE CD1  C  -3.712   5.744   3.697 1.00 . A A . 44 ILE CD1  1 1 
        4  3889 1 1 44 ILE CG1  C  -4.495   5.580   2.413 1.00 . A A . 44 ILE CG1  1 1 
        4  3890 1 1 44 ILE CG2  C  -6.516   7.060   2.268 1.00 . A A . 44 ILE CG2  1 1 
        4  3891 1 1 44 ILE H    H  -2.803   6.854   0.507 1.00 . A A . 44 ILE H    1 1 
        4  3892 1 1 44 ILE HA   H  -5.572   6.209  -0.095 1.00 . A A . 44 ILE HA   1 1 
        4  3893 1 1 44 ILE HB   H  -4.500   7.718   2.288 1.00 . A A . 44 ILE HB   1 1 
        4  3894 1 1 44 ILE HD11 H  -3.763   4.830   4.268 1.00 . A A . 44 ILE HD11 1 1 
        4  3895 1 1 44 ILE HD12 H  -4.134   6.554   4.275 1.00 . A A . 44 ILE HD12 1 1 
        4  3896 1 1 44 ILE HD13 H  -2.681   5.965   3.464 1.00 . A A . 44 ILE HD13 1 1 
        4  3897 1 1 44 ILE HG12 H  -5.311   4.901   2.607 1.00 . A A . 44 ILE HG12 1 1 
        4  3898 1 1 44 ILE HG13 H  -3.838   5.143   1.676 1.00 . A A . 44 ILE HG13 1 1 
        4  3899 1 1 44 ILE HG21 H  -6.577   7.642   3.176 1.00 . A A . 44 ILE HG21 1 1 
        4  3900 1 1 44 ILE HG22 H  -6.955   6.086   2.435 1.00 . A A . 44 ILE HG22 1 1 
        4  3901 1 1 44 ILE HG23 H  -7.051   7.565   1.478 1.00 . A A . 44 ILE HG23 1 1 
        4  3902 1 1 44 ILE N    N  -3.551   6.630  -0.085 1.00 . A A . 44 ILE N    1 1 
        4  3903 1 1 44 ILE O    O  -4.753   9.342   0.241 1.00 . A A . 44 ILE O    1 1 
        4  3904 1 1 45 ASN C    C  -7.759  10.313  -0.584 1.00 . A A . 45 ASN C    1 1 
        4  3905 1 1 45 ASN CA   C  -6.829   9.618  -1.575 1.00 . A A . 45 ASN CA   1 1 
        4  3906 1 1 45 ASN CB   C  -7.560   9.369  -2.894 1.00 . A A . 45 ASN CB   1 1 
        4  3907 1 1 45 ASN CG   C  -6.657   8.762  -3.951 1.00 . A A . 45 ASN CG   1 1 
        4  3908 1 1 45 ASN H    H  -6.749   7.519  -1.308 1.00 . A A . 45 ASN H    1 1 
        4  3909 1 1 45 ASN HA   H  -5.978  10.258  -1.760 1.00 . A A . 45 ASN HA   1 1 
        4  3910 1 1 45 ASN HB2  H  -8.382   8.692  -2.720 1.00 . A A . 45 ASN HB2  1 1 
        4  3911 1 1 45 ASN HB3  H  -7.946  10.306  -3.269 1.00 . A A . 45 ASN HB3  1 1 
        4  3912 1 1 45 ASN HD21 H  -7.583   7.009  -3.768 1.00 . A A . 45 ASN HD21 1 1 
        4  3913 1 1 45 ASN HD22 H  -6.291   7.067  -4.928 1.00 . A A . 45 ASN HD22 1 1 
        4  3914 1 1 45 ASN N    N  -6.333   8.361  -1.028 1.00 . A A . 45 ASN N    1 1 
        4  3915 1 1 45 ASN ND2  N  -6.865   7.484  -4.245 1.00 . A A . 45 ASN ND2  1 1 
        4  3916 1 1 45 ASN O    O  -8.092   9.759   0.463 1.00 . A A . 45 ASN O    1 1 
        4  3917 1 1 45 ASN OD1  O  -5.782   9.436  -4.496 1.00 . A A . 45 ASN OD1  1 1 
        4  3918 1 1 46 ALA C    C -10.530  11.968  -0.332 1.00 . A A . 46 ALA C    1 1 
        4  3919 1 1 46 ALA CA   C  -9.068  12.301  -0.062 1.00 . A A . 46 ALA CA   1 1 
        4  3920 1 1 46 ALA CB   C  -8.820  13.789  -0.250 1.00 . A A . 46 ALA CB   1 1 
        4  3921 1 1 46 ALA H    H  -7.875  11.919  -1.770 1.00 . A A . 46 ALA H    1 1 
        4  3922 1 1 46 ALA HA   H  -8.836  12.051   0.963 1.00 . A A . 46 ALA HA   1 1 
        4  3923 1 1 46 ALA HB1  H  -9.537  14.350   0.332 1.00 . A A . 46 ALA HB1  1 1 
        4  3924 1 1 46 ALA HB2  H  -8.927  14.043  -1.296 1.00 . A A . 46 ALA HB2  1 1 
        4  3925 1 1 46 ALA HB3  H  -7.821  14.033   0.078 1.00 . A A . 46 ALA HB3  1 1 
        4  3926 1 1 46 ALA N    N  -8.175  11.530  -0.922 1.00 . A A . 46 ALA N    1 1 
        4  3927 1 1 46 ALA O    O -11.430  12.615   0.208 1.00 . A A . 46 ALA O    1 1 
        4  3928 1 1 47 ASP C    C -12.470   9.219  -0.841 1.00 . A A . 47 ASP C    1 1 
        4  3929 1 1 47 ASP CA   C -12.130  10.549  -1.503 1.00 . A A . 47 ASP CA   1 1 
        4  3930 1 1 47 ASP CB   C -12.290  10.429  -3.024 1.00 . A A . 47 ASP CB   1 1 
        4  3931 1 1 47 ASP CG   C -10.970  10.273  -3.761 1.00 . A A . 47 ASP CG   1 1 
        4  3932 1 1 47 ASP H    H -10.020  10.482  -1.569 1.00 . A A . 47 ASP H    1 1 
        4  3933 1 1 47 ASP HA   H -12.800  11.306  -1.137 1.00 . A A . 47 ASP HA   1 1 
        4  3934 1 1 47 ASP HB2  H -12.900   9.565  -3.241 1.00 . A A . 47 ASP HB2  1 1 
        4  3935 1 1 47 ASP HB3  H -12.790  11.316  -3.392 1.00 . A A . 47 ASP HB3  1 1 
        4  3936 1 1 47 ASP N    N -10.770  10.962  -1.168 1.00 . A A . 47 ASP N    1 1 
        4  3937 1 1 47 ASP O    O -13.640   8.856  -0.729 1.00 . A A . 47 ASP O    1 1 
        4  3938 1 1 47 ASP OD1  O -10.340  11.305  -4.068 1.00 . A A . 47 ASP OD1  1 1 
        4  3939 1 1 47 ASP OD2  O -10.580   9.120  -4.029 1.00 . A A . 47 ASP OD2  1 1 
        4  3940 1 1 48 GLY C    C -11.180   6.050  -0.624 1.00 . A A . 48 GLY C    1 1 
        4  3941 1 1 48 GLY CA   C -11.660   7.208   0.230 1.00 . A A . 48 GLY CA   1 1 
        4  3942 1 1 48 GLY H    H -10.540   8.828  -0.527 1.00 . A A . 48 GLY H    1 1 
        4  3943 1 1 48 GLY HA2  H -11.130   7.192   1.172 1.00 . A A . 48 GLY HA2  1 1 
        4  3944 1 1 48 GLY HA3  H -12.720   7.086   0.421 1.00 . A A . 48 GLY HA3  1 1 
        4  3945 1 1 48 GLY N    N -11.450   8.492  -0.408 1.00 . A A . 48 GLY N    1 1 
        4  3946 1 1 48 GLY O    O -11.500   4.893  -0.346 1.00 . A A . 48 GLY O    1 1 
        4  3947 1 1 49 SER C    C  -8.454   5.005  -2.221 1.00 . A A . 49 SER C    1 1 
        4  3948 1 1 49 SER CA   C  -9.902   5.338  -2.564 1.00 . A A . 49 SER CA   1 1 
        4  3949 1 1 49 SER CB   C -10.000   5.801  -4.016 1.00 . A A . 49 SER CB   1 1 
        4  3950 1 1 49 SER H    H -10.200   7.301  -1.842 1.00 . A A . 49 SER H    1 1 
        4  3951 1 1 49 SER HA   H -10.500   4.453  -2.441 1.00 . A A . 49 SER HA   1 1 
        4  3952 1 1 49 SER HB2  H -10.420   6.793  -4.043 1.00 . A A . 49 SER HB2  1 1 
        4  3953 1 1 49 SER HB3  H  -9.022   5.808  -4.459 1.00 . A A . 49 SER HB3  1 1 
        4  3954 1 1 49 SER HG   H -11.630   4.741  -4.268 1.00 . A A . 49 SER HG   1 1 
        4  3955 1 1 49 SER N    N -10.420   6.361  -1.670 1.00 . A A . 49 SER N    1 1 
        4  3956 1 1 49 SER O    O  -7.808   5.718  -1.453 1.00 . A A . 49 SER O    1 1 
        4  3957 1 1 49 SER OG   O -10.830   4.936  -4.769 1.00 . A A . 49 SER OG   1 1 
        4  3958 1 1 50 VAL C    C  -6.014   2.754  -3.756 1.00 . A A . 50 VAL C    1 1 
        4  3959 1 1 50 VAL CA   C  -6.579   3.488  -2.546 1.00 . A A . 50 VAL CA   1 1 
        4  3960 1 1 50 VAL CB   C  -6.480   2.569  -1.312 1.00 . A A . 50 VAL CB   1 1 
        4  3961 1 1 50 VAL CG1  C  -5.075   2.606  -0.736 1.00 . A A . 50 VAL CG1  1 1 
        4  3962 1 1 50 VAL CG2  C  -7.503   2.965  -0.255 1.00 . A A . 50 VAL CG2  1 1 
        4  3963 1 1 50 VAL H    H  -8.516   3.390  -3.396 1.00 . A A . 50 VAL H    1 1 
        4  3964 1 1 50 VAL HA   H  -5.979   4.366  -2.364 1.00 . A A . 50 VAL HA   1 1 
        4  3965 1 1 50 VAL HB   H  -6.691   1.556  -1.625 1.00 . A A . 50 VAL HB   1 1 
        4  3966 1 1 50 VAL HG11 H  -5.005   1.914   0.089 1.00 . A A . 50 VAL HG11 1 1 
        4  3967 1 1 50 VAL HG12 H  -4.857   3.604  -0.389 1.00 . A A . 50 VAL HG12 1 1 
        4  3968 1 1 50 VAL HG13 H  -4.366   2.328  -1.501 1.00 . A A . 50 VAL HG13 1 1 
        4  3969 1 1 50 VAL HG21 H  -8.482   3.023  -0.704 1.00 . A A . 50 VAL HG21 1 1 
        4  3970 1 1 50 VAL HG22 H  -7.238   3.929   0.158 1.00 . A A . 50 VAL HG22 1 1 
        4  3971 1 1 50 VAL HG23 H  -7.510   2.226   0.532 1.00 . A A . 50 VAL HG23 1 1 
        4  3972 1 1 50 VAL N    N  -7.951   3.917  -2.794 1.00 . A A . 50 VAL N    1 1 
        4  3973 1 1 50 VAL O    O  -6.699   1.940  -4.376 1.00 . A A . 50 VAL O    1 1 
        4  3974 1 1 51 TYR C    C  -2.677   2.023  -4.890 1.00 . A A . 51 TYR C    1 1 
        4  3975 1 1 51 TYR CA   C  -4.111   2.415  -5.230 1.00 . A A . 51 TYR CA   1 1 
        4  3976 1 1 51 TYR CB   C  -4.128   3.348  -6.444 1.00 . A A . 51 TYR CB   1 1 
        4  3977 1 1 51 TYR CD1  C  -1.911   4.559  -6.469 1.00 . A A . 51 TYR CD1  1 1 
        4  3978 1 1 51 TYR CD2  C  -3.867   5.804  -5.919 1.00 . A A . 51 TYR CD2  1 1 
        4  3979 1 1 51 TYR CE1  C  -1.138   5.695  -6.315 1.00 . A A . 51 TYR CE1  1 1 
        4  3980 1 1 51 TYR CE2  C  -3.102   6.946  -5.764 1.00 . A A . 51 TYR CE2  1 1 
        4  3981 1 1 51 TYR CG   C  -3.286   4.594  -6.272 1.00 . A A . 51 TYR CG   1 1 
        4  3982 1 1 51 TYR CZ   C  -1.740   6.886  -5.963 1.00 . A A . 51 TYR CZ   1 1 
        4  3983 1 1 51 TYR H    H  -4.268   3.711  -3.560 1.00 . A A . 51 TYR H    1 1 
        4  3984 1 1 51 TYR HA   H  -4.666   1.521  -5.471 1.00 . A A . 51 TYR HA   1 1 
        4  3985 1 1 51 TYR HB2  H  -3.753   2.814  -7.305 1.00 . A A . 51 TYR HB2  1 1 
        4  3986 1 1 51 TYR HB3  H  -5.144   3.659  -6.635 1.00 . A A . 51 TYR HB3  1 1 
        4  3987 1 1 51 TYR HD1  H  -1.443   3.625  -6.744 1.00 . A A . 51 TYR HD1  1 1 
        4  3988 1 1 51 TYR HD2  H  -4.935   5.849  -5.762 1.00 . A A . 51 TYR HD2  1 1 
        4  3989 1 1 51 TYR HE1  H  -0.072   5.647  -6.471 1.00 . A A . 51 TYR HE1  1 1 
        4  3990 1 1 51 TYR HE2  H  -3.573   7.878  -5.488 1.00 . A A . 51 TYR HE2  1 1 
        4  3991 1 1 51 TYR HH   H  -0.296   8.042  -6.491 1.00 . A A . 51 TYR HH   1 1 
        4  3992 1 1 51 TYR N    N  -4.763   3.050  -4.092 1.00 . A A . 51 TYR N    1 1 
        4  3993 1 1 51 TYR O    O  -1.914   2.824  -4.352 1.00 . A A . 51 TYR O    1 1 
        4  3994 1 1 51 TYR OH   O  -0.974   8.019  -5.811 1.00 . A A . 51 TYR OH   1 1 
        4  3995 1 1 52 ALA C    C  -0.106   0.357  -6.186 1.00 . A A . 52 ALA C    1 1 
        4  3996 1 1 52 ALA CA   C  -0.978   0.281  -4.938 1.00 . A A . 52 ALA CA   1 1 
        4  3997 1 1 52 ALA CB   C  -1.044  -1.149  -4.422 1.00 . A A . 52 ALA CB   1 1 
        4  3998 1 1 52 ALA H    H  -2.974   0.192  -5.636 1.00 . A A . 52 ALA H    1 1 
        4  3999 1 1 52 ALA HA   H  -0.540   0.897  -4.166 1.00 . A A . 52 ALA HA   1 1 
        4  4000 1 1 52 ALA HB1  H  -2.074  -1.419  -4.240 1.00 . A A . 52 ALA HB1  1 1 
        4  4001 1 1 52 ALA HB2  H  -0.485  -1.225  -3.501 1.00 . A A . 52 ALA HB2  1 1 
        4  4002 1 1 52 ALA HB3  H  -0.620  -1.820  -5.156 1.00 . A A . 52 ALA HB3  1 1 
        4  4003 1 1 52 ALA N    N  -2.319   0.783  -5.209 1.00 . A A . 52 ALA N    1 1 
        4  4004 1 1 52 ALA O    O  -0.473  -0.152  -7.244 1.00 . A A . 52 ALA O    1 1 
        4  4005 1 1 53 GLU C    C   3.371   0.676  -6.795 1.00 . A A . 53 GLU C    1 1 
        4  4006 1 1 53 GLU CA   C   1.972   1.147  -7.176 1.00 . A A . 53 GLU CA   1 1 
        4  4007 1 1 53 GLU CB   C   2.017   2.605  -7.639 1.00 . A A . 53 GLU CB   1 1 
        4  4008 1 1 53 GLU CD   C   1.706   3.824  -5.446 1.00 . A A . 53 GLU CD   1 1 
        4  4009 1 1 53 GLU CG   C   2.631   3.552  -6.619 1.00 . A A . 53 GLU CG   1 1 
        4  4010 1 1 53 GLU H    H   1.286   1.389  -5.187 1.00 . A A . 53 GLU H    1 1 
        4  4011 1 1 53 GLU HA   H   1.608   0.534  -7.986 1.00 . A A . 53 GLU HA   1 1 
        4  4012 1 1 53 GLU HB2  H   2.600   2.664  -8.547 1.00 . A A . 53 GLU HB2  1 1 
        4  4013 1 1 53 GLU HB3  H   1.011   2.936  -7.846 1.00 . A A . 53 GLU HB3  1 1 
        4  4014 1 1 53 GLU HG2  H   3.542   3.113  -6.244 1.00 . A A . 53 GLU HG2  1 1 
        4  4015 1 1 53 GLU HG3  H   2.855   4.489  -7.105 1.00 . A A . 53 GLU HG3  1 1 
        4  4016 1 1 53 GLU N    N   1.049   1.002  -6.055 1.00 . A A . 53 GLU N    1 1 
        4  4017 1 1 53 GLU O    O   3.689   0.526  -5.615 1.00 . A A . 53 GLU O    1 1 
        4  4018 1 1 53 GLU OE1  O   0.490   3.571  -5.577 1.00 . A A . 53 GLU OE1  1 1 
        4  4019 1 1 53 GLU OE2  O   2.201   4.289  -4.398 1.00 . A A . 53 GLU OE2  1 1 
        4  4020 1 1 54 GLU C    C   6.552   1.157  -7.675 1.00 . A A . 54 GLU C    1 1 
        4  4021 1 1 54 GLU CA   C   5.572  -0.009  -7.578 1.00 . A A . 54 GLU CA   1 1 
        4  4022 1 1 54 GLU CB   C   5.946  -1.093  -8.590 1.00 . A A . 54 GLU CB   1 1 
        4  4023 1 1 54 GLU CD   C   7.242  -3.213  -9.047 1.00 . A A . 54 GLU CD   1 1 
        4  4024 1 1 54 GLU CG   C   6.809  -2.200  -8.005 1.00 . A A . 54 GLU CG   1 1 
        4  4025 1 1 54 GLU H    H   3.893   0.583  -8.722 1.00 . A A . 54 GLU H    1 1 
        4  4026 1 1 54 GLU HA   H   5.622  -0.425  -6.582 1.00 . A A . 54 GLU HA   1 1 
        4  4027 1 1 54 GLU HB2  H   5.040  -1.537  -8.975 1.00 . A A . 54 GLU HB2  1 1 
        4  4028 1 1 54 GLU HB3  H   6.487  -0.637  -9.406 1.00 . A A . 54 GLU HB3  1 1 
        4  4029 1 1 54 GLU HG2  H   7.692  -1.757  -7.568 1.00 . A A . 54 GLU HG2  1 1 
        4  4030 1 1 54 GLU HG3  H   6.245  -2.711  -7.239 1.00 . A A . 54 GLU HG3  1 1 
        4  4031 1 1 54 GLU N    N   4.204   0.445  -7.804 1.00 . A A . 54 GLU N    1 1 
        4  4032 1 1 54 GLU O    O   6.481   1.963  -8.603 1.00 . A A . 54 GLU O    1 1 
        4  4033 1 1 54 GLU OE1  O   8.140  -2.887  -9.855 1.00 . A A . 54 GLU OE1  1 1 
        4  4034 1 1 54 GLU OE2  O   6.685  -4.329  -9.058 1.00 . A A . 54 GLU OE2  1 1 
        4  4035 1 1 55 VAL C    C   9.740   1.879  -7.391 1.00 . A A . 55 VAL C    1 1 
        4  4036 1 1 55 VAL CA   C   8.455   2.305  -6.689 1.00 . A A . 55 VAL CA   1 1 
        4  4037 1 1 55 VAL CB   C   8.789   2.733  -5.248 1.00 . A A . 55 VAL CB   1 1 
        4  4038 1 1 55 VAL CG1  C   9.669   3.973  -5.249 1.00 . A A . 55 VAL CG1  1 1 
        4  4039 1 1 55 VAL CG2  C   7.513   2.974  -4.456 1.00 . A A . 55 VAL CG2  1 1 
        4  4040 1 1 55 VAL H    H   7.468   0.566  -6.000 1.00 . A A . 55 VAL H    1 1 
        4  4041 1 1 55 VAL HA   H   8.040   3.158  -7.208 1.00 . A A . 55 VAL HA   1 1 
        4  4042 1 1 55 VAL HB   H   9.335   1.930  -4.774 1.00 . A A . 55 VAL HB   1 1 
        4  4043 1 1 55 VAL HG11 H  10.699   3.683  -5.398 1.00 . A A . 55 VAL HG11 1 1 
        4  4044 1 1 55 VAL HG12 H   9.574   4.482  -4.300 1.00 . A A . 55 VAL HG12 1 1 
        4  4045 1 1 55 VAL HG13 H   9.361   4.634  -6.044 1.00 . A A . 55 VAL HG13 1 1 
        4  4046 1 1 55 VAL HG21 H   6.861   2.119  -4.553 1.00 . A A . 55 VAL HG21 1 1 
        4  4047 1 1 55 VAL HG22 H   7.014   3.854  -4.835 1.00 . A A . 55 VAL HG22 1 1 
        4  4048 1 1 55 VAL HG23 H   7.759   3.122  -3.414 1.00 . A A . 55 VAL HG23 1 1 
        4  4049 1 1 55 VAL N    N   7.462   1.239  -6.713 1.00 . A A . 55 VAL N    1 1 
        4  4050 1 1 55 VAL O    O  10.266   0.795  -7.139 1.00 . A A . 55 VAL O    1 1 
        4  4051 1 1 56 LYS C    C  12.469   3.593  -8.858 1.00 . A A . 56 LYS C    1 1 
        4  4052 1 1 56 LYS CA   C  11.464   2.453  -9.012 1.00 . A A . 56 LYS CA   1 1 
        4  4053 1 1 56 LYS CB   C  11.149   2.228 -10.492 1.00 . A A . 56 LYS CB   1 1 
        4  4054 1 1 56 LYS CD   C   9.991   3.102 -12.545 1.00 . A A . 56 LYS CD   1 1 
        4  4055 1 1 56 LYS CE   C   8.479   2.958 -12.479 1.00 . A A . 56 LYS CE   1 1 
        4  4056 1 1 56 LYS CG   C  10.576   3.453 -11.186 1.00 . A A . 56 LYS CG   1 1 
        4  4057 1 1 56 LYS H    H   9.774   3.587  -8.430 1.00 . A A . 56 LYS H    1 1 
        4  4058 1 1 56 LYS HA   H  11.894   1.551  -8.603 1.00 . A A . 56 LYS HA   1 1 
        4  4059 1 1 56 LYS HB2  H  12.057   1.944 -11.004 1.00 . A A . 56 LYS HB2  1 1 
        4  4060 1 1 56 LYS HB3  H  10.432   1.425 -10.578 1.00 . A A . 56 LYS HB3  1 1 
        4  4061 1 1 56 LYS HD2  H  10.238   3.885 -13.246 1.00 . A A . 56 LYS HD2  1 1 
        4  4062 1 1 56 LYS HD3  H  10.419   2.167 -12.878 1.00 . A A . 56 LYS HD3  1 1 
        4  4063 1 1 56 LYS HE2  H   8.140   2.448 -13.368 1.00 . A A . 56 LYS HE2  1 1 
        4  4064 1 1 56 LYS HE3  H   8.224   2.371 -11.609 1.00 . A A . 56 LYS HE3  1 1 
        4  4065 1 1 56 LYS HG2  H   9.799   3.875 -10.568 1.00 . A A . 56 LYS HG2  1 1 
        4  4066 1 1 56 LYS HG3  H  11.366   4.180 -11.321 1.00 . A A . 56 LYS HG3  1 1 
        4  4067 1 1 56 LYS HZ1  H   7.442   4.562 -13.325 1.00 . A A . 56 LYS HZ1  1 1 
        4  4068 1 1 56 LYS HZ2  H   8.463   5.004 -12.051 1.00 . A A . 56 LYS HZ2  1 1 
        4  4069 1 1 56 LYS HZ3  H   6.998   4.225 -11.728 1.00 . A A . 56 LYS HZ3  1 1 
        4  4070 1 1 56 LYS N    N  10.240   2.739  -8.272 1.00 . A A . 56 LYS N    1 1 
        4  4071 1 1 56 LYS NZ   N   7.798   4.280 -12.389 1.00 . A A . 56 LYS NZ   1 1 
        4  4072 1 1 56 LYS O    O  12.088   4.735  -8.602 1.00 . A A . 56 LYS O    1 1 
        4  4073 1 1 57 PRO C    C  14.647   5.456  -9.869 1.00 . A A . 57 PRO C    1 1 
        4  4074 1 1 57 PRO CA   C  14.830   4.302  -8.889 1.00 . A A . 57 PRO CA   1 1 
        4  4075 1 1 57 PRO CB   C  16.117   3.526  -9.206 1.00 . A A . 57 PRO CB   1 1 
        4  4076 1 1 57 PRO CD   C  14.314   1.964  -9.318 1.00 . A A . 57 PRO CD   1 1 
        4  4077 1 1 57 PRO CG   C  15.667   2.278  -9.887 1.00 . A A . 57 PRO CG   1 1 
        4  4078 1 1 57 PRO HA   H  14.884   4.695  -7.884 1.00 . A A . 57 PRO HA   1 1 
        4  4079 1 1 57 PRO HB2  H  16.748   4.121  -9.851 1.00 . A A . 57 PRO HB2  1 1 
        4  4080 1 1 57 PRO HB3  H  16.641   3.306  -8.288 1.00 . A A . 57 PRO HB3  1 1 
        4  4081 1 1 57 PRO HD2  H  13.705   1.456 -10.050 1.00 . A A . 57 PRO HD2  1 1 
        4  4082 1 1 57 PRO HD3  H  14.409   1.370  -8.421 1.00 . A A . 57 PRO HD3  1 1 
        4  4083 1 1 57 PRO HG2  H  15.597   2.445 -10.952 1.00 . A A . 57 PRO HG2  1 1 
        4  4084 1 1 57 PRO HG3  H  16.357   1.475  -9.676 1.00 . A A . 57 PRO HG3  1 1 
        4  4085 1 1 57 PRO N    N  13.771   3.296  -9.011 1.00 . A A . 57 PRO N    1 1 
        4  4086 1 1 57 PRO O    O  14.376   5.243 -11.051 1.00 . A A . 57 PRO O    1 1 
        4  4087 1 1 58 ASP C    C  15.658   7.864 -11.348 1.00 . A A . 58 ASP C    1 1 
        4  4088 1 1 58 ASP CA   C  14.647   7.869 -10.200 1.00 . A A . 58 ASP CA   1 1 
        4  4089 1 1 58 ASP CB   C  14.827   9.130  -9.353 1.00 . A A . 58 ASP CB   1 1 
        4  4090 1 1 58 ASP CG   C  13.845  10.223  -9.728 1.00 . A A . 58 ASP CG   1 1 
        4  4091 1 1 58 ASP H    H  15.011   6.783  -8.420 1.00 . A A . 58 ASP H    1 1 
        4  4092 1 1 58 ASP HA   H  13.649   7.863 -10.608 1.00 . A A . 58 ASP HA   1 1 
        4  4093 1 1 58 ASP HB2  H  14.679   8.881  -8.310 1.00 . A A . 58 ASP HB2  1 1 
        4  4094 1 1 58 ASP HB3  H  15.832   9.510  -9.492 1.00 . A A . 58 ASP HB3  1 1 
        4  4095 1 1 58 ASP N    N  14.796   6.679  -9.370 1.00 . A A . 58 ASP N    1 1 
        4  4096 1 1 58 ASP O    O  16.864   7.922 -11.114 1.00 . A A . 58 ASP O    1 1 
        4  4097 1 1 58 ASP OD1  O  13.373  10.226 -10.884 1.00 . A A . 58 ASP OD1  1 1 
        4  4098 1 1 58 ASP OD2  O  13.545  11.074  -8.863 1.00 . A A . 58 ASP OD2  1 1 
        4  4099 1 1 59 PRO C    C  16.823   9.088 -13.956 1.00 . A A . 59 PRO C    1 1 
        4  4100 1 1 59 PRO CA   C  16.057   7.778 -13.786 1.00 . A A . 59 PRO CA   1 1 
        4  4101 1 1 59 PRO CB   C  15.090   7.569 -14.963 1.00 . A A . 59 PRO CB   1 1 
        4  4102 1 1 59 PRO CD   C  13.760   7.711 -12.983 1.00 . A A . 59 PRO CD   1 1 
        4  4103 1 1 59 PRO CG   C  13.815   7.094 -14.350 1.00 . A A . 59 PRO CG   1 1 
        4  4104 1 1 59 PRO HA   H  16.757   6.958 -13.744 1.00 . A A . 59 PRO HA   1 1 
        4  4105 1 1 59 PRO HB2  H  14.950   8.502 -15.487 1.00 . A A . 59 PRO HB2  1 1 
        4  4106 1 1 59 PRO HB3  H  15.498   6.831 -15.638 1.00 . A A . 59 PRO HB3  1 1 
        4  4107 1 1 59 PRO HD2  H  13.313   8.694 -13.027 1.00 . A A . 59 PRO HD2  1 1 
        4  4108 1 1 59 PRO HD3  H  13.216   7.073 -12.303 1.00 . A A . 59 PRO HD3  1 1 
        4  4109 1 1 59 PRO HG2  H  12.977   7.426 -14.944 1.00 . A A . 59 PRO HG2  1 1 
        4  4110 1 1 59 PRO HG3  H  13.821   6.017 -14.275 1.00 . A A . 59 PRO HG3  1 1 
        4  4111 1 1 59 PRO N    N  15.181   7.791 -12.607 1.00 . A A . 59 PRO N    1 1 
        4  4112 1 1 59 PRO O    O  16.621   9.818 -14.926 1.00 . A A . 59 PRO O    1 1 
        4  4113 1 1 60 SER C    C  17.613  11.836 -13.143 1.00 . A A . 60 SER C    1 1 
        4  4114 1 1 60 SER CA   C  18.504  10.600 -13.047 1.00 . A A . 60 SER CA   1 1 
        4  4115 1 1 60 SER CB   C  19.469  10.561 -14.233 1.00 . A A . 60 SER CB   1 1 
        4  4116 1 1 60 SER H    H  17.822   8.759 -12.256 1.00 . A A . 60 SER H    1 1 
        4  4117 1 1 60 SER HA   H  19.075  10.654 -12.133 1.00 . A A . 60 SER HA   1 1 
        4  4118 1 1 60 SER HB2  H  19.028   9.990 -15.037 1.00 . A A . 60 SER HB2  1 1 
        4  4119 1 1 60 SER HB3  H  19.662  11.569 -14.572 1.00 . A A . 60 SER HB3  1 1 
        4  4120 1 1 60 SER HG   H  20.623   9.005 -13.938 1.00 . A A . 60 SER HG   1 1 
        4  4121 1 1 60 SER N    N  17.705   9.380 -13.005 1.00 . A A . 60 SER N    1 1 
        4  4122 1 1 60 SER O    O  17.286  12.293 -14.237 1.00 . A A . 60 SER O    1 1 
        4  4123 1 1 60 SER OG   O  20.701   9.960 -13.870 1.00 . A A . 60 SER OG   1 1 
        4  4124 1 1 61 ASN C    C  17.211  14.812 -11.713 1.00 . A A . 61 ASN C    1 1 
        4  4125 1 1 61 ASN CA   C  16.377  13.555 -11.943 1.00 . A A . 61 ASN CA   1 1 
        4  4126 1 1 61 ASN CB   C  15.326  13.412 -10.838 1.00 . A A . 61 ASN CB   1 1 
        4  4127 1 1 61 ASN CG   C  13.912  13.549 -11.366 1.00 . A A . 61 ASN CG   1 1 
        4  4128 1 1 61 ASN H    H  17.524  11.961 -11.149 1.00 . A A . 61 ASN H    1 1 
        4  4129 1 1 61 ASN HA   H  15.876  13.640 -12.896 1.00 . A A . 61 ASN HA   1 1 
        4  4130 1 1 61 ASN HB2  H  15.426  12.439 -10.381 1.00 . A A . 61 ASN HB2  1 1 
        4  4131 1 1 61 ASN HB3  H  15.489  14.175 -10.091 1.00 . A A . 61 ASN HB3  1 1 
        4  4132 1 1 61 ASN HD21 H  13.285  14.182  -9.584 1.00 . A A . 61 ASN HD21 1 1 
        4  4133 1 1 61 ASN HD22 H  12.071  14.078 -10.821 1.00 . A A . 61 ASN HD22 1 1 
        4  4134 1 1 61 ASN N    N  17.229  12.372 -11.989 1.00 . A A . 61 ASN N    1 1 
        4  4135 1 1 61 ASN ND2  N  12.997  13.980 -10.503 1.00 . A A . 61 ASN ND2  1 1 
        4  4136 1 1 61 ASN O    O  18.290  14.755 -11.125 1.00 . A A . 61 ASN O    1 1 
        4  4137 1 1 61 ASN OD1  O  13.642  13.273 -12.534 1.00 . A A . 61 ASN OD1  1 1 
        4  4138 1 1 62 LYS C    C  16.491  18.270 -11.399 1.00 . A A . 62 LYS C    1 1 
        4  4139 1 1 62 LYS CA   C  17.403  17.218 -12.028 1.00 . A A . 62 LYS CA   1 1 
        4  4140 1 1 62 LYS CB   C  17.911  17.713 -13.383 1.00 . A A . 62 LYS CB   1 1 
        4  4141 1 1 62 LYS CD   C  17.166  16.439 -15.419 1.00 . A A . 62 LYS CD   1 1 
        4  4142 1 1 62 LYS CE   C  15.955  16.090 -16.270 1.00 . A A . 62 LYS CE   1 1 
        4  4143 1 1 62 LYS CG   C  16.878  17.611 -14.495 1.00 . A A . 62 LYS CG   1 1 
        4  4144 1 1 62 LYS H    H  15.839  15.931 -12.643 1.00 . A A . 62 LYS H    1 1 
        4  4145 1 1 62 LYS HA   H  18.246  17.055 -11.374 1.00 . A A . 62 LYS HA   1 1 
        4  4146 1 1 62 LYS HB2  H  18.204  18.749 -13.289 1.00 . A A . 62 LYS HB2  1 1 
        4  4147 1 1 62 LYS HB3  H  18.773  17.128 -13.666 1.00 . A A . 62 LYS HB3  1 1 
        4  4148 1 1 62 LYS HD2  H  17.987  16.700 -16.070 1.00 . A A . 62 LYS HD2  1 1 
        4  4149 1 1 62 LYS HD3  H  17.436  15.580 -14.823 1.00 . A A . 62 LYS HD3  1 1 
        4  4150 1 1 62 LYS HE2  H  15.146  15.798 -15.618 1.00 . A A . 62 LYS HE2  1 1 
        4  4151 1 1 62 LYS HE3  H  15.664  16.964 -16.833 1.00 . A A . 62 LYS HE3  1 1 
        4  4152 1 1 62 LYS HG2  H  15.901  17.476 -14.054 1.00 . A A . 62 LYS HG2  1 1 
        4  4153 1 1 62 LYS HG3  H  16.891  18.525 -15.070 1.00 . A A . 62 LYS HG3  1 1 
        4  4154 1 1 62 LYS HZ1  H  15.428  14.822 -17.844 1.00 . A A . 62 LYS HZ1  1 1 
        4  4155 1 1 62 LYS HZ2  H  16.431  14.100 -16.689 1.00 . A A . 62 LYS HZ2  1 1 
        4  4156 1 1 62 LYS HZ3  H  17.076  15.206 -17.795 1.00 . A A . 62 LYS HZ3  1 1 
        4  4157 1 1 62 LYS N    N  16.703  15.948 -12.182 1.00 . A A . 62 LYS N    1 1 
        4  4158 1 1 62 LYS NZ   N  16.243  14.977 -17.216 1.00 . A A . 62 LYS NZ   1 1 
        4  4159 1 1 62 LYS O    O  15.441  18.602 -11.948 1.00 . A A . 62 LYS O    1 1 
        4  4160 1 1 63 LYS C    C  16.657  21.200  -9.844 1.00 . A A . 63 LYS C    1 1 
        4  4161 1 1 63 LYS CA   C  16.126  19.801  -9.544 1.00 . A A . 63 LYS CA   1 1 
        4  4162 1 1 63 LYS CB   C  16.157  19.545  -8.037 1.00 . A A . 63 LYS CB   1 1 
        4  4163 1 1 63 LYS CD   C  14.168  18.012  -7.941 1.00 . A A . 63 LYS CD   1 1 
        4  4164 1 1 63 LYS CE   C  13.315  18.751  -6.925 1.00 . A A . 63 LYS CE   1 1 
        4  4165 1 1 63 LYS CG   C  15.651  18.166  -7.643 1.00 . A A . 63 LYS CG   1 1 
        4  4166 1 1 63 LYS H    H  17.750  18.483  -9.861 1.00 . A A . 63 LYS H    1 1 
        4  4167 1 1 63 LYS HA   H  15.105  19.736  -9.890 1.00 . A A . 63 LYS HA   1 1 
        4  4168 1 1 63 LYS HB2  H  17.174  19.643  -7.688 1.00 . A A . 63 LYS HB2  1 1 
        4  4169 1 1 63 LYS HB3  H  15.543  20.284  -7.545 1.00 . A A . 63 LYS HB3  1 1 
        4  4170 1 1 63 LYS HD2  H  13.965  18.409  -8.925 1.00 . A A . 63 LYS HD2  1 1 
        4  4171 1 1 63 LYS HD3  H  13.914  16.962  -7.915 1.00 . A A . 63 LYS HD3  1 1 
        4  4172 1 1 63 LYS HE2  H  13.686  18.531  -5.934 1.00 . A A . 63 LYS HE2  1 1 
        4  4173 1 1 63 LYS HE3  H  13.396  19.813  -7.110 1.00 . A A . 63 LYS HE3  1 1 
        4  4174 1 1 63 LYS HG2  H  16.199  17.420  -8.199 1.00 . A A . 63 LYS HG2  1 1 
        4  4175 1 1 63 LYS HG3  H  15.814  18.023  -6.585 1.00 . A A . 63 LYS HG3  1 1 
        4  4176 1 1 63 LYS HZ1  H  11.806  17.358  -7.294 1.00 . A A . 63 LYS HZ1  1 1 
        4  4177 1 1 63 LYS HZ2  H  11.386  18.944  -7.703 1.00 . A A . 63 LYS HZ2  1 1 
        4  4178 1 1 63 LYS HZ3  H  11.425  18.472  -6.078 1.00 . A A . 63 LYS HZ3  1 1 
        4  4179 1 1 63 LYS N    N  16.903  18.788 -10.247 1.00 . A A . 63 LYS N    1 1 
        4  4180 1 1 63 LYS NZ   N  11.883  18.354  -7.006 1.00 . A A . 63 LYS NZ   1 1 
        4  4181 1 1 63 LYS O    O  15.900  22.171  -9.869 1.00 . A A . 63 LYS O    1 1 
        4  4182 1 1 64 THR C    C  18.919  22.692 -11.852 1.00 . A A . 64 THR C    1 1 
        4  4183 1 1 64 THR CA   C  18.596  22.575 -10.367 1.00 . A A . 64 THR CA   1 1 
        4  4184 1 1 64 THR CB   C  19.872  22.742  -9.540 1.00 . A A . 64 THR CB   1 1 
        4  4185 1 1 64 THR CG2  C  20.084  24.155  -9.041 1.00 . A A . 64 THR CG2  1 1 
        4  4186 1 1 64 THR H    H  18.516  20.487 -10.034 1.00 . A A . 64 THR H    1 1 
        4  4187 1 1 64 THR HA   H  17.901  23.359 -10.099 1.00 . A A . 64 THR HA   1 1 
        4  4188 1 1 64 THR HB   H  20.723  22.477 -10.152 1.00 . A A . 64 THR HB   1 1 
        4  4189 1 1 64 THR HG1  H  20.080  20.994  -8.683 1.00 . A A . 64 THR HG1  1 1 
        4  4190 1 1 64 THR HG21 H  20.692  24.700  -9.748 1.00 . A A . 64 THR HG21 1 1 
        4  4191 1 1 64 THR HG22 H  20.583  24.128  -8.084 1.00 . A A . 64 THR HG22 1 1 
        4  4192 1 1 64 THR HG23 H  19.128  24.647  -8.936 1.00 . A A . 64 THR HG23 1 1 
        4  4193 1 1 64 THR N    N  17.963  21.296 -10.068 1.00 . A A . 64 THR N    1 1 
        4  4194 1 1 64 THR O    O  18.552  21.827 -12.648 1.00 . A A . 64 THR O    1 1 
        4  4195 1 1 64 THR OG1  O  19.855  21.886  -8.411 1.00 . A A . 64 THR OG1  1 1 
        4  4196 1 1 65 THR C    C  21.499  24.094 -13.756 1.00 . A A . 65 THR C    1 1 
        4  4197 1 1 65 THR CA   C  19.983  23.998 -13.610 1.00 . A A . 65 THR CA   1 1 
        4  4198 1 1 65 THR CB   C  19.330  25.280 -14.129 1.00 . A A . 65 THR CB   1 1 
        4  4199 1 1 65 THR CG2  C  17.985  25.043 -14.783 1.00 . A A . 65 THR CG2  1 1 
        4  4200 1 1 65 THR H    H  19.874  24.421 -11.540 1.00 . A A . 65 THR H    1 1 
        4  4201 1 1 65 THR HA   H  19.629  23.162 -14.193 1.00 . A A . 65 THR HA   1 1 
        4  4202 1 1 65 THR HB   H  19.979  25.732 -14.864 1.00 . A A . 65 THR HB   1 1 
        4  4203 1 1 65 THR HG1  H  18.470  25.872 -12.471 1.00 . A A . 65 THR HG1  1 1 
        4  4204 1 1 65 THR HG21 H  17.928  25.605 -15.703 1.00 . A A . 65 THR HG21 1 1 
        4  4205 1 1 65 THR HG22 H  17.199  25.364 -14.116 1.00 . A A . 65 THR HG22 1 1 
        4  4206 1 1 65 THR HG23 H  17.869  23.990 -14.997 1.00 . A A . 65 THR HG23 1 1 
        4  4207 1 1 65 THR N    N  19.610  23.767 -12.220 1.00 . A A . 65 THR N    1 1 
        4  4208 1 1 65 THR O    O  22.131  24.989 -13.197 1.00 . A A . 65 THR O    1 1 
        4  4209 1 1 65 THR OG1  O  19.137  26.207 -13.076 1.00 . A A . 65 THR OG1  1 1 
        4  4210 1 1 66 ALA C    C  23.888  22.175 -15.847 1.00 . A A . 66 ALA C    1 1 
        4  4211 1 1 66 ALA CA   C  23.517  23.143 -14.728 1.00 . A A . 66 ALA CA   1 1 
        4  4212 1 1 66 ALA CB   C  24.240  22.770 -13.443 1.00 . A A . 66 ALA CB   1 1 
        4  4213 1 1 66 ALA H    H  21.518  22.474 -14.929 1.00 . A A . 66 ALA H    1 1 
        4  4214 1 1 66 ALA HA   H  23.825  24.139 -15.010 1.00 . A A . 66 ALA HA   1 1 
        4  4215 1 1 66 ALA HB1  H  23.762  23.257 -12.606 1.00 . A A . 66 ALA HB1  1 1 
        4  4216 1 1 66 ALA HB2  H  25.270  23.088 -13.504 1.00 . A A . 66 ALA HB2  1 1 
        4  4217 1 1 66 ALA HB3  H  24.202  21.699 -13.306 1.00 . A A . 66 ALA HB3  1 1 
        4  4218 1 1 66 ALA N    N  22.075  23.163 -14.510 1.00 . A A . 66 ALA N    1 1 
        4  4219 1 1 66 ALA O    O  23.773  20.949 -15.630 1.00 . A A . 66 ALA O    1 1 
        4  4220 1 1 66 ALA OXT  O  24.291  22.650 -16.929 1.00 . A A . 66 ALA OXT  1 1 
        5  4221 1 1  1 MET C    C   2.906  12.961   2.399 1.00 . A A .  1 MET C    1 1 
        5  4222 1 1  1 MET CA   C   2.331  14.372   2.356 1.00 . A A .  1 MET CA   1 1 
        5  4223 1 1  1 MET CB   C   3.339  15.333   1.721 1.00 . A A .  1 MET CB   1 1 
        5  4224 1 1  1 MET CE   C   3.973  16.417  -1.238 1.00 . A A .  1 MET CE   1 1 
        5  4225 1 1  1 MET CG   C   2.716  16.626   1.223 1.00 . A A .  1 MET CG   1 1 
        5  4226 1 1  1 MET H1   H   2.805  14.624   4.342 1.00 . A A .  1 MET H1   1 1 
        5  4227 1 1  1 MET H2   H   1.134  14.383   4.029 1.00 . A A .  1 MET H2   1 1 
        5  4228 1 1  1 MET H3   H   1.869  15.891   3.664 1.00 . A A .  1 MET H3   1 1 
        5  4229 1 1  1 MET HA   H   1.426  14.367   1.767 1.00 . A A .  1 MET HA   1 1 
        5  4230 1 1  1 MET HB2  H   4.094  15.580   2.453 1.00 . A A .  1 MET HB2  1 1 
        5  4231 1 1  1 MET HB3  H   3.811  14.840   0.884 1.00 . A A .  1 MET HB3  1 1 
        5  4232 1 1  1 MET HE1  H   4.074  17.089  -2.077 1.00 . A A .  1 MET HE1  1 1 
        5  4233 1 1  1 MET HE2  H   4.124  15.400  -1.570 1.00 . A A .  1 MET HE2  1 1 
        5  4234 1 1  1 MET HE3  H   4.709  16.664  -0.488 1.00 . A A .  1 MET HE3  1 1 
        5  4235 1 1  1 MET HG2  H   1.803  16.805   1.770 1.00 . A A .  1 MET HG2  1 1 
        5  4236 1 1  1 MET HG3  H   3.407  17.436   1.404 1.00 . A A .  1 MET HG3  1 1 
        5  4237 1 1  1 MET N    N   2.005  14.862   3.721 1.00 . A A .  1 MET N    1 1 
        5  4238 1 1  1 MET O    O   3.298  12.470   3.458 1.00 . A A .  1 MET O    1 1 
        5  4239 1 1  1 MET SD   S   2.332  16.578  -0.538 1.00 . A A .  1 MET SD   1 1 
        5  4240 1 1  2 GLU C    C   2.650   9.983   1.972 1.00 . A A .  2 GLU C    1 1 
        5  4241 1 1  2 GLU CA   C   3.484  10.956   1.143 1.00 . A A .  2 GLU CA   1 1 
        5  4242 1 1  2 GLU CB   C   4.942  10.920   1.605 1.00 . A A .  2 GLU CB   1 1 
        5  4243 1 1  2 GLU CD   C   6.841   9.301   2.007 1.00 . A A .  2 GLU CD   1 1 
        5  4244 1 1  2 GLU CG   C   5.716   9.721   1.080 1.00 . A A .  2 GLU CG   1 1 
        5  4245 1 1  2 GLU H    H   2.630  12.756   0.429 1.00 . A A .  2 GLU H    1 1 
        5  4246 1 1  2 GLU HA   H   3.438  10.655   0.107 1.00 . A A .  2 GLU HA   1 1 
        5  4247 1 1  2 GLU HB2  H   5.437  11.817   1.267 1.00 . A A .  2 GLU HB2  1 1 
        5  4248 1 1  2 GLU HB3  H   4.965  10.891   2.684 1.00 . A A .  2 GLU HB3  1 1 
        5  4249 1 1  2 GLU HG2  H   5.035   8.891   0.966 1.00 . A A .  2 GLU HG2  1 1 
        5  4250 1 1  2 GLU HG3  H   6.138   9.975   0.118 1.00 . A A .  2 GLU HG3  1 1 
        5  4251 1 1  2 GLU N    N   2.956  12.312   1.240 1.00 . A A .  2 GLU N    1 1 
        5  4252 1 1  2 GLU O    O   3.130   9.416   2.954 1.00 . A A .  2 GLU O    1 1 
        5  4253 1 1  2 GLU OE1  O   7.806  10.079   2.159 1.00 . A A .  2 GLU OE1  1 1 
        5  4254 1 1  2 GLU OE2  O   6.754   8.196   2.580 1.00 . A A .  2 GLU OE2  1 1 
        5  4255 1 1  3 GLN C    C   0.487   7.513   1.597 1.00 . A A .  3 GLN C    1 1 
        5  4256 1 1  3 GLN CA   C   0.498   8.884   2.267 1.00 . A A .  3 GLN CA   1 1 
        5  4257 1 1  3 GLN CB   C  -0.917   9.465   2.303 1.00 . A A .  3 GLN CB   1 1 
        5  4258 1 1  3 GLN CD   C  -1.431  10.626   4.486 1.00 . A A .  3 GLN CD   1 1 
        5  4259 1 1  3 GLN CG   C  -1.583   9.361   3.663 1.00 . A A .  3 GLN CG   1 1 
        5  4260 1 1  3 GLN H    H   1.076  10.270   0.775 1.00 . A A .  3 GLN H    1 1 
        5  4261 1 1  3 GLN HA   H   0.860   8.775   3.279 1.00 . A A .  3 GLN HA   1 1 
        5  4262 1 1  3 GLN HB2  H  -0.872  10.509   2.028 1.00 . A A .  3 GLN HB2  1 1 
        5  4263 1 1  3 GLN HB3  H  -1.529   8.940   1.584 1.00 . A A .  3 GLN HB3  1 1 
        5  4264 1 1  3 GLN HE21 H   0.547  10.556   4.269 1.00 . A A .  3 GLN HE21 1 1 
        5  4265 1 1  3 GLN HE22 H  -0.066  11.887   5.200 1.00 . A A .  3 GLN HE22 1 1 
        5  4266 1 1  3 GLN HG2  H  -2.636   9.167   3.523 1.00 . A A .  3 GLN HG2  1 1 
        5  4267 1 1  3 GLN HG3  H  -1.137   8.541   4.206 1.00 . A A .  3 GLN HG3  1 1 
        5  4268 1 1  3 GLN N    N   1.400   9.792   1.566 1.00 . A A .  3 GLN N    1 1 
        5  4269 1 1  3 GLN NE2  N  -0.192  11.067   4.671 1.00 . A A .  3 GLN NE2  1 1 
        5  4270 1 1  3 GLN O    O  -0.571   6.917   1.393 1.00 . A A .  3 GLN O    1 1 
        5  4271 1 1  3 GLN OE1  O  -2.416  11.201   4.950 1.00 . A A .  3 GLN OE1  1 1 
        5  4272 1 1  4 ARG C    C   2.591   4.752   1.479 1.00 . A A .  4 ARG C    1 1 
        5  4273 1 1  4 ARG CA   C   1.810   5.726   0.603 1.00 . A A .  4 ARG CA   1 1 
        5  4274 1 1  4 ARG CB   C   2.503   5.887  -0.751 1.00 . A A .  4 ARG CB   1 1 
        5  4275 1 1  4 ARG CD   C   4.591   6.586  -1.960 1.00 . A A .  4 ARG CD   1 1 
        5  4276 1 1  4 ARG CG   C   3.759   6.739  -0.696 1.00 . A A .  4 ARG CG   1 1 
        5  4277 1 1  4 ARG CZ   C   4.422   7.129  -4.357 1.00 . A A .  4 ARG CZ   1 1 
        5  4278 1 1  4 ARG H    H   2.479   7.551   1.443 1.00 . A A .  4 ARG H    1 1 
        5  4279 1 1  4 ARG HA   H   0.820   5.329   0.443 1.00 . A A .  4 ARG HA   1 1 
        5  4280 1 1  4 ARG HB2  H   2.772   4.911  -1.124 1.00 . A A .  4 ARG HB2  1 1 
        5  4281 1 1  4 ARG HB3  H   1.812   6.347  -1.441 1.00 . A A .  4 ARG HB3  1 1 
        5  4282 1 1  4 ARG HD2  H   5.510   7.139  -1.839 1.00 . A A .  4 ARG HD2  1 1 
        5  4283 1 1  4 ARG HD3  H   4.815   5.540  -2.103 1.00 . A A .  4 ARG HD3  1 1 
        5  4284 1 1  4 ARG HE   H   2.969   7.406  -3.018 1.00 . A A .  4 ARG HE   1 1 
        5  4285 1 1  4 ARG HG2  H   3.476   7.775  -0.588 1.00 . A A .  4 ARG HG2  1 1 
        5  4286 1 1  4 ARG HG3  H   4.353   6.436   0.154 1.00 . A A .  4 ARG HG3  1 1 
        5  4287 1 1  4 ARG HH11 H   6.203   6.350  -3.797 1.00 . A A .  4 ARG HH11 1 1 
        5  4288 1 1  4 ARG HH12 H   6.059   6.739  -5.477 1.00 . A A .  4 ARG HH12 1 1 
        5  4289 1 1  4 ARG HH21 H   2.779   7.919  -5.228 1.00 . A A .  4 ARG HH21 1 1 
        5  4290 1 1  4 ARG HH22 H   4.117   7.631  -6.290 1.00 . A A .  4 ARG HH22 1 1 
        5  4291 1 1  4 ARG N    N   1.674   7.024   1.255 1.00 . A A .  4 ARG N    1 1 
        5  4292 1 1  4 ARG NE   N   3.888   7.087  -3.139 1.00 . A A .  4 ARG NE   1 1 
        5  4293 1 1  4 ARG NH1  N   5.664   6.705  -4.560 1.00 . A A .  4 ARG NH1  1 1 
        5  4294 1 1  4 ARG NH2  N   3.713   7.599  -5.375 1.00 . A A .  4 ARG NH2  1 1 
        5  4295 1 1  4 ARG O    O   3.809   4.624   1.349 1.00 . A A .  4 ARG O    1 1 
        5  4296 1 1  5 ILE C    C   2.762   1.793   2.563 1.00 . A A .  5 ILE C    1 1 
        5  4297 1 1  5 ILE CA   C   2.506   3.111   3.273 1.00 . A A .  5 ILE CA   1 1 
        5  4298 1 1  5 ILE CB   C   1.626   2.841   4.510 1.00 . A A .  5 ILE CB   1 1 
        5  4299 1 1  5 ILE CD1  C  -0.607   3.978   4.946 1.00 . A A .  5 ILE CD1  1 1 
        5  4300 1 1  5 ILE CG1  C   0.899   4.114   4.930 1.00 . A A .  5 ILE CG1  1 1 
        5  4301 1 1  5 ILE CG2  C   2.467   2.304   5.660 1.00 . A A .  5 ILE CG2  1 1 
        5  4302 1 1  5 ILE H    H   0.916   4.221   2.436 1.00 . A A .  5 ILE H    1 1 
        5  4303 1 1  5 ILE HA   H   3.447   3.523   3.606 1.00 . A A .  5 ILE HA   1 1 
        5  4304 1 1  5 ILE HB   H   0.897   2.089   4.249 1.00 . A A .  5 ILE HB   1 1 
        5  4305 1 1  5 ILE HD11 H  -0.993   4.368   5.876 1.00 . A A .  5 ILE HD11 1 1 
        5  4306 1 1  5 ILE HD12 H  -0.875   2.934   4.856 1.00 . A A .  5 ILE HD12 1 1 
        5  4307 1 1  5 ILE HD13 H  -1.029   4.531   4.121 1.00 . A A .  5 ILE HD13 1 1 
        5  4308 1 1  5 ILE HG12 H   1.218   4.390   5.917 1.00 . A A .  5 ILE HG12 1 1 
        5  4309 1 1  5 ILE HG13 H   1.156   4.904   4.246 1.00 . A A .  5 ILE HG13 1 1 
        5  4310 1 1  5 ILE HG21 H   2.074   2.672   6.596 1.00 . A A .  5 ILE HG21 1 1 
        5  4311 1 1  5 ILE HG22 H   3.488   2.636   5.544 1.00 . A A .  5 ILE HG22 1 1 
        5  4312 1 1  5 ILE HG23 H   2.436   1.225   5.655 1.00 . A A .  5 ILE HG23 1 1 
        5  4313 1 1  5 ILE N    N   1.882   4.070   2.373 1.00 . A A .  5 ILE N    1 1 
        5  4314 1 1  5 ILE O    O   2.306   1.578   1.442 1.00 . A A .  5 ILE O    1 1 
        5  4315 1 1  6 THR C    C   2.602  -1.296   2.636 1.00 . A A .  6 THR C    1 1 
        5  4316 1 1  6 THR CA   C   3.826  -0.389   2.668 1.00 . A A .  6 THR CA   1 1 
        5  4317 1 1  6 THR CB   C   4.944  -1.047   3.479 1.00 . A A .  6 THR CB   1 1 
        5  4318 1 1  6 THR CG2  C   6.320  -0.832   2.886 1.00 . A A .  6 THR CG2  1 1 
        5  4319 1 1  6 THR H    H   3.825   1.159   4.118 1.00 . A A .  6 THR H    1 1 
        5  4320 1 1  6 THR HA   H   4.170  -0.236   1.656 1.00 . A A .  6 THR HA   1 1 
        5  4321 1 1  6 THR HB   H   4.765  -2.111   3.522 1.00 . A A .  6 THR HB   1 1 
        5  4322 1 1  6 THR HG1  H   5.301  -1.222   5.397 1.00 . A A .  6 THR HG1  1 1 
        5  4323 1 1  6 THR HG21 H   6.819  -0.036   3.416 1.00 . A A .  6 THR HG21 1 1 
        5  4324 1 1  6 THR HG22 H   6.224  -0.567   1.842 1.00 . A A .  6 THR HG22 1 1 
        5  4325 1 1  6 THR HG23 H   6.896  -1.742   2.976 1.00 . A A .  6 THR HG23 1 1 
        5  4326 1 1  6 THR N    N   3.497   0.917   3.228 1.00 . A A .  6 THR N    1 1 
        5  4327 1 1  6 THR O    O   1.672  -1.133   3.426 1.00 . A A .  6 THR O    1 1 
        5  4328 1 1  6 THR OG1  O   4.964  -0.545   4.804 1.00 . A A .  6 THR OG1  1 1 
        5  4329 1 1  7 LEU C    C   1.412  -4.111   2.796 1.00 . A A .  7 LEU C    1 1 
        5  4330 1 1  7 LEU CA   C   1.501  -3.195   1.578 1.00 . A A .  7 LEU CA   1 1 
        5  4331 1 1  7 LEU CB   C   1.666  -4.030   0.307 1.00 . A A .  7 LEU CB   1 1 
        5  4332 1 1  7 LEU CD1  C  -0.685  -4.504  -0.423 1.00 . A A .  7 LEU CD1  1 1 
        5  4333 1 1  7 LEU CD2  C   1.117  -6.183  -0.853 1.00 . A A .  7 LEU CD2  1 1 
        5  4334 1 1  7 LEU CG   C   0.605  -5.114   0.100 1.00 . A A .  7 LEU CG   1 1 
        5  4335 1 1  7 LEU H    H   3.380  -2.337   1.115 1.00 . A A .  7 LEU H    1 1 
        5  4336 1 1  7 LEU HA   H   0.588  -2.621   1.507 1.00 . A A .  7 LEU HA   1 1 
        5  4337 1 1  7 LEU HB2  H   1.639  -3.362  -0.542 1.00 . A A .  7 LEU HB2  1 1 
        5  4338 1 1  7 LEU HB3  H   2.633  -4.507   0.339 1.00 . A A .  7 LEU HB3  1 1 
        5  4339 1 1  7 LEU HD11 H  -1.277  -4.145   0.405 1.00 . A A .  7 LEU HD11 1 1 
        5  4340 1 1  7 LEU HD12 H  -1.244  -5.254  -0.966 1.00 . A A .  7 LEU HD12 1 1 
        5  4341 1 1  7 LEU HD13 H  -0.454  -3.680  -1.084 1.00 . A A .  7 LEU HD13 1 1 
        5  4342 1 1  7 LEU HD21 H   1.553  -5.713  -1.721 1.00 . A A .  7 LEU HD21 1 1 
        5  4343 1 1  7 LEU HD22 H   0.297  -6.816  -1.157 1.00 . A A .  7 LEU HD22 1 1 
        5  4344 1 1  7 LEU HD23 H   1.867  -6.780  -0.353 1.00 . A A .  7 LEU HD23 1 1 
        5  4345 1 1  7 LEU HG   H   0.391  -5.583   1.049 1.00 . A A .  7 LEU HG   1 1 
        5  4346 1 1  7 LEU N    N   2.608  -2.257   1.716 1.00 . A A .  7 LEU N    1 1 
        5  4347 1 1  7 LEU O    O   0.329  -4.348   3.328 1.00 . A A .  7 LEU O    1 1 
        5  4348 1 1  8 LYS C    C   1.999  -4.840   5.612 1.00 . A A .  8 LYS C    1 1 
        5  4349 1 1  8 LYS CA   C   2.613  -5.508   4.388 1.00 . A A .  8 LYS CA   1 1 
        5  4350 1 1  8 LYS CB   C   4.060  -5.910   4.684 1.00 . A A .  8 LYS CB   1 1 
        5  4351 1 1  8 LYS CD   C   5.445  -7.528   6.017 1.00 . A A .  8 LYS CD   1 1 
        5  4352 1 1  8 LYS CE   C   6.702  -7.681   5.173 1.00 . A A .  8 LYS CE   1 1 
        5  4353 1 1  8 LYS CG   C   4.209  -7.348   5.150 1.00 . A A .  8 LYS CG   1 1 
        5  4354 1 1  8 LYS H    H   3.394  -4.392   2.767 1.00 . A A .  8 LYS H    1 1 
        5  4355 1 1  8 LYS HA   H   2.044  -6.395   4.152 1.00 . A A .  8 LYS HA   1 1 
        5  4356 1 1  8 LYS HB2  H   4.648  -5.782   3.787 1.00 . A A .  8 LYS HB2  1 1 
        5  4357 1 1  8 LYS HB3  H   4.450  -5.263   5.455 1.00 . A A .  8 LYS HB3  1 1 
        5  4358 1 1  8 LYS HD2  H   5.556  -6.663   6.653 1.00 . A A .  8 LYS HD2  1 1 
        5  4359 1 1  8 LYS HD3  H   5.321  -8.411   6.625 1.00 . A A .  8 LYS HD3  1 1 
        5  4360 1 1  8 LYS HE2  H   6.970  -8.726   5.137 1.00 . A A .  8 LYS HE2  1 1 
        5  4361 1 1  8 LYS HE3  H   6.493  -7.330   4.172 1.00 . A A .  8 LYS HE3  1 1 
        5  4362 1 1  8 LYS HG2  H   3.337  -7.625   5.724 1.00 . A A .  8 LYS HG2  1 1 
        5  4363 1 1  8 LYS HG3  H   4.291  -7.990   4.285 1.00 . A A .  8 LYS HG3  1 1 
        5  4364 1 1  8 LYS HZ1  H   7.492  -6.104   6.292 1.00 . A A .  8 LYS HZ1  1 1 
        5  4365 1 1  8 LYS HZ2  H   8.438  -6.539   4.960 1.00 . A A .  8 LYS HZ2  1 1 
        5  4366 1 1  8 LYS HZ3  H   8.424  -7.515   6.341 1.00 . A A .  8 LYS HZ3  1 1 
        5  4367 1 1  8 LYS N    N   2.561  -4.621   3.233 1.00 . A A .  8 LYS N    1 1 
        5  4368 1 1  8 LYS NZ   N   7.843  -6.905   5.730 1.00 . A A .  8 LYS NZ   1 1 
        5  4369 1 1  8 LYS O    O   1.316  -5.483   6.410 1.00 . A A .  8 LYS O    1 1 
        5  4370 1 1  9 ASP C    C   0.213  -2.553   6.710 1.00 . A A .  9 ASP C    1 1 
        5  4371 1 1  9 ASP CA   C   1.712  -2.777   6.872 1.00 . A A .  9 ASP CA   1 1 
        5  4372 1 1  9 ASP CB   C   2.427  -1.429   6.981 1.00 . A A .  9 ASP CB   1 1 
        5  4373 1 1  9 ASP CG   C   3.869  -1.574   7.423 1.00 . A A .  9 ASP CG   1 1 
        5  4374 1 1  9 ASP H    H   2.792  -3.084   5.079 1.00 . A A .  9 ASP H    1 1 
        5  4375 1 1  9 ASP HA   H   1.887  -3.343   7.776 1.00 . A A .  9 ASP HA   1 1 
        5  4376 1 1  9 ASP HB2  H   2.414  -0.945   6.015 1.00 . A A .  9 ASP HB2  1 1 
        5  4377 1 1  9 ASP HB3  H   1.908  -0.809   7.696 1.00 . A A .  9 ASP HB3  1 1 
        5  4378 1 1  9 ASP N    N   2.243  -3.541   5.752 1.00 . A A .  9 ASP N    1 1 
        5  4379 1 1  9 ASP O    O  -0.535  -2.537   7.688 1.00 . A A .  9 ASP O    1 1 
        5  4380 1 1  9 ASP OD1  O   4.646  -2.240   6.709 1.00 . A A .  9 ASP OD1  1 1 
        5  4381 1 1  9 ASP OD2  O   4.223  -1.020   8.487 1.00 . A A .  9 ASP OD2  1 1 
        5  4382 1 1 10 TYR C    C  -2.492  -3.299   5.661 1.00 . A A . 10 TYR C    1 1 
        5  4383 1 1 10 TYR CA   C  -1.623  -2.150   5.161 1.00 . A A . 10 TYR CA   1 1 
        5  4384 1 1 10 TYR CB   C  -1.810  -1.977   3.654 1.00 . A A . 10 TYR CB   1 1 
        5  4385 1 1 10 TYR CD1  C  -4.296  -1.555   3.527 1.00 . A A . 10 TYR CD1  1 1 
        5  4386 1 1 10 TYR CD2  C  -2.823   0.117   2.682 1.00 . A A . 10 TYR CD2  1 1 
        5  4387 1 1 10 TYR CE1  C  -5.384  -0.777   3.182 1.00 . A A . 10 TYR CE1  1 1 
        5  4388 1 1 10 TYR CE2  C  -3.905   0.903   2.336 1.00 . A A . 10 TYR CE2  1 1 
        5  4389 1 1 10 TYR CG   C  -3.000  -1.122   3.282 1.00 . A A . 10 TYR CG   1 1 
        5  4390 1 1 10 TYR CZ   C  -5.184   0.451   2.587 1.00 . A A . 10 TYR CZ   1 1 
        5  4391 1 1 10 TYR H    H   0.432  -2.401   4.731 1.00 . A A . 10 TYR H    1 1 
        5  4392 1 1 10 TYR HA   H  -1.925  -1.241   5.658 1.00 . A A . 10 TYR HA   1 1 
        5  4393 1 1 10 TYR HB2  H  -0.926  -1.513   3.241 1.00 . A A . 10 TYR HB2  1 1 
        5  4394 1 1 10 TYR HB3  H  -1.944  -2.948   3.202 1.00 . A A . 10 TYR HB3  1 1 
        5  4395 1 1 10 TYR HD1  H  -4.448  -2.517   3.994 1.00 . A A . 10 TYR HD1  1 1 
        5  4396 1 1 10 TYR HD2  H  -1.821   0.468   2.489 1.00 . A A . 10 TYR HD2  1 1 
        5  4397 1 1 10 TYR HE1  H  -6.385  -1.130   3.381 1.00 . A A . 10 TYR HE1  1 1 
        5  4398 1 1 10 TYR HE2  H  -3.747   1.863   1.867 1.00 . A A . 10 TYR HE2  1 1 
        5  4399 1 1 10 TYR HH   H  -6.098   2.140   2.496 1.00 . A A . 10 TYR HH   1 1 
        5  4400 1 1 10 TYR N    N  -0.216  -2.379   5.466 1.00 . A A . 10 TYR N    1 1 
        5  4401 1 1 10 TYR O    O  -3.483  -3.080   6.357 1.00 . A A . 10 TYR O    1 1 
        5  4402 1 1 10 TYR OH   O  -6.265   1.229   2.243 1.00 . A A . 10 TYR OH   1 1 
        5  4403 1 1 11 ALA C    C  -2.990  -5.795   7.218 1.00 . A A . 11 ALA C    1 1 
        5  4404 1 1 11 ALA CA   C  -2.875  -5.700   5.700 1.00 . A A . 11 ALA CA   1 1 
        5  4405 1 1 11 ALA CB   C  -2.223  -6.956   5.141 1.00 . A A . 11 ALA CB   1 1 
        5  4406 1 1 11 ALA H    H  -1.326  -4.629   4.734 1.00 . A A . 11 ALA H    1 1 
        5  4407 1 1 11 ALA HA   H  -3.867  -5.623   5.278 1.00 . A A . 11 ALA HA   1 1 
        5  4408 1 1 11 ALA HB1  H  -2.663  -7.194   4.182 1.00 . A A . 11 ALA HB1  1 1 
        5  4409 1 1 11 ALA HB2  H  -2.382  -7.778   5.823 1.00 . A A . 11 ALA HB2  1 1 
        5  4410 1 1 11 ALA HB3  H  -1.163  -6.787   5.019 1.00 . A A . 11 ALA HB3  1 1 
        5  4411 1 1 11 ALA N    N  -2.123  -4.520   5.294 1.00 . A A . 11 ALA N    1 1 
        5  4412 1 1 11 ALA O    O  -4.089  -5.878   7.762 1.00 . A A . 11 ALA O    1 1 
        5  4413 1 1 12 MET C    C  -2.445  -4.656  10.005 1.00 . A A . 12 MET C    1 1 
        5  4414 1 1 12 MET CA   C  -1.824  -5.888   9.350 1.00 . A A . 12 MET CA   1 1 
        5  4415 1 1 12 MET CB   C  -0.387  -6.071   9.841 1.00 . A A . 12 MET CB   1 1 
        5  4416 1 1 12 MET CE   C   2.287  -8.609   9.704 1.00 . A A . 12 MET CE   1 1 
        5  4417 1 1 12 MET CG   C  -0.118  -7.444  10.438 1.00 . A A . 12 MET CG   1 1 
        5  4418 1 1 12 MET H    H  -1.003  -5.732   7.406 1.00 . A A . 12 MET H    1 1 
        5  4419 1 1 12 MET HA   H  -2.400  -6.752   9.629 1.00 . A A . 12 MET HA   1 1 
        5  4420 1 1 12 MET HB2  H   0.287  -5.927   9.010 1.00 . A A . 12 MET HB2  1 1 
        5  4421 1 1 12 MET HB3  H  -0.176  -5.328  10.596 1.00 . A A . 12 MET HB3  1 1 
        5  4422 1 1 12 MET HE1  H   1.504  -9.154   9.199 1.00 . A A . 12 MET HE1  1 1 
        5  4423 1 1 12 MET HE2  H   3.001  -9.305  10.117 1.00 . A A . 12 MET HE2  1 1 
        5  4424 1 1 12 MET HE3  H   2.784  -7.958   8.999 1.00 . A A . 12 MET HE3  1 1 
        5  4425 1 1 12 MET HG2  H  -0.790  -7.599  11.269 1.00 . A A . 12 MET HG2  1 1 
        5  4426 1 1 12 MET HG3  H  -0.306  -8.194   9.681 1.00 . A A . 12 MET HG3  1 1 
        5  4427 1 1 12 MET N    N  -1.850  -5.793   7.896 1.00 . A A . 12 MET N    1 1 
        5  4428 1 1 12 MET O    O  -2.896  -4.710  11.148 1.00 . A A . 12 MET O    1 1 
        5  4429 1 1 12 MET SD   S   1.577  -7.628  11.023 1.00 . A A . 12 MET SD   1 1 
        5  4430 1 1 13 ARG C    C  -4.499  -2.168   9.476 1.00 . A A . 13 ARG C    1 1 
        5  4431 1 1 13 ARG CA   C  -3.011  -2.300   9.795 1.00 . A A . 13 ARG CA   1 1 
        5  4432 1 1 13 ARG CB   C  -2.249  -1.102   9.226 1.00 . A A . 13 ARG CB   1 1 
        5  4433 1 1 13 ARG CD   C  -1.710   0.636  10.958 1.00 . A A . 13 ARG CD   1 1 
        5  4434 1 1 13 ARG CG   C  -2.657   0.226   9.842 1.00 . A A . 13 ARG CG   1 1 
        5  4435 1 1 13 ARG CZ   C  -1.823   1.739  13.157 1.00 . A A . 13 ARG CZ   1 1 
        5  4436 1 1 13 ARG H    H  -2.076  -3.564   8.377 1.00 . A A . 13 ARG H    1 1 
        5  4437 1 1 13 ARG HA   H  -2.891  -2.307  10.867 1.00 . A A . 13 ARG HA   1 1 
        5  4438 1 1 13 ARG HB2  H  -1.191  -1.247   9.403 1.00 . A A . 13 ARG HB2  1 1 
        5  4439 1 1 13 ARG HB3  H  -2.426  -1.050   8.160 1.00 . A A . 13 ARG HB3  1 1 
        5  4440 1 1 13 ARG HD2  H  -1.144  -0.230  11.269 1.00 . A A . 13 ARG HD2  1 1 
        5  4441 1 1 13 ARG HD3  H  -1.034   1.389  10.581 1.00 . A A . 13 ARG HD3  1 1 
        5  4442 1 1 13 ARG HE   H  -3.402   1.112  12.111 1.00 . A A . 13 ARG HE   1 1 
        5  4443 1 1 13 ARG HG2  H  -2.643   0.988   9.074 1.00 . A A . 13 ARG HG2  1 1 
        5  4444 1 1 13 ARG HG3  H  -3.657   0.132  10.246 1.00 . A A . 13 ARG HG3  1 1 
        5  4445 1 1 13 ARG HH11 H   0.052   1.494  12.438 1.00 . A A . 13 ARG HH11 1 1 
        5  4446 1 1 13 ARG HH12 H  -0.055   2.268  13.983 1.00 . A A . 13 ARG HH12 1 1 
        5  4447 1 1 13 ARG HH21 H  -3.544   2.129  14.143 1.00 . A A . 13 ARG HH21 1 1 
        5  4448 1 1 13 ARG HH22 H  -2.095   2.628  14.952 1.00 . A A . 13 ARG HH22 1 1 
        5  4449 1 1 13 ARG N    N  -2.456  -3.546   9.278 1.00 . A A . 13 ARG N    1 1 
        5  4450 1 1 13 ARG NE   N  -2.423   1.174  12.113 1.00 . A A . 13 ARG NE   1 1 
        5  4451 1 1 13 ARG NH1  N  -0.500   1.842  13.196 1.00 . A A . 13 ARG NH1  1 1 
        5  4452 1 1 13 ARG NH2  N  -2.547   2.204  14.167 1.00 . A A . 13 ARG NH2  1 1 
        5  4453 1 1 13 ARG O    O  -5.345  -2.273  10.363 1.00 . A A . 13 ARG O    1 1 
        5  4454 1 1 14 PHE C    C  -6.885  -3.084   7.580 1.00 . A A . 14 PHE C    1 1 
        5  4455 1 1 14 PHE CA   C  -6.177  -1.744   7.769 1.00 . A A . 14 PHE CA   1 1 
        5  4456 1 1 14 PHE CB   C  -6.174  -0.959   6.466 1.00 . A A . 14 PHE CB   1 1 
        5  4457 1 1 14 PHE CD1  C  -6.230   1.479   7.044 1.00 . A A . 14 PHE CD1  1 1 
        5  4458 1 1 14 PHE CD2  C  -4.182   0.554   6.268 1.00 . A A . 14 PHE CD2  1 1 
        5  4459 1 1 14 PHE CE1  C  -5.631   2.706   7.167 1.00 . A A . 14 PHE CE1  1 1 
        5  4460 1 1 14 PHE CE2  C  -3.578   1.780   6.389 1.00 . A A . 14 PHE CE2  1 1 
        5  4461 1 1 14 PHE CG   C  -5.516   0.384   6.592 1.00 . A A . 14 PHE CG   1 1 
        5  4462 1 1 14 PHE CZ   C  -4.306   2.854   6.838 1.00 . A A . 14 PHE CZ   1 1 
        5  4463 1 1 14 PHE H    H  -4.094  -1.825   7.549 1.00 . A A . 14 PHE H    1 1 
        5  4464 1 1 14 PHE HA   H  -6.700  -1.171   8.519 1.00 . A A . 14 PHE HA   1 1 
        5  4465 1 1 14 PHE HB2  H  -5.641  -1.522   5.713 1.00 . A A . 14 PHE HB2  1 1 
        5  4466 1 1 14 PHE HB3  H  -7.182  -0.808   6.146 1.00 . A A . 14 PHE HB3  1 1 
        5  4467 1 1 14 PHE HD1  H  -7.263   1.369   7.300 1.00 . A A . 14 PHE HD1  1 1 
        5  4468 1 1 14 PHE HD2  H  -3.610  -0.280   5.917 1.00 . A A . 14 PHE HD2  1 1 
        5  4469 1 1 14 PHE HE1  H  -6.198   3.555   7.520 1.00 . A A . 14 PHE HE1  1 1 
        5  4470 1 1 14 PHE HE2  H  -2.536   1.899   6.134 1.00 . A A . 14 PHE HE2  1 1 
        5  4471 1 1 14 PHE HZ   H  -3.841   3.802   6.933 1.00 . A A . 14 PHE HZ   1 1 
        5  4472 1 1 14 PHE N    N  -4.808  -1.915   8.209 1.00 . A A . 14 PHE N    1 1 
        5  4473 1 1 14 PHE O    O  -8.052  -3.234   7.943 1.00 . A A . 14 PHE O    1 1 
        5  4474 1 1 15 GLY C    C  -6.755  -5.760   5.322 1.00 . A A . 15 GLY C    1 1 
        5  4475 1 1 15 GLY CA   C  -6.767  -5.361   6.785 1.00 . A A . 15 GLY CA   1 1 
        5  4476 1 1 15 GLY H    H  -5.253  -3.879   6.740 1.00 . A A . 15 GLY H    1 1 
        5  4477 1 1 15 GLY HA2  H  -6.215  -6.096   7.352 1.00 . A A . 15 GLY HA2  1 1 
        5  4478 1 1 15 GLY HA3  H  -7.789  -5.350   7.134 1.00 . A A . 15 GLY HA3  1 1 
        5  4479 1 1 15 GLY N    N  -6.177  -4.053   7.010 1.00 . A A . 15 GLY N    1 1 
        5  4480 1 1 15 GLY O    O  -6.933  -4.919   4.442 1.00 . A A . 15 GLY O    1 1 
        5  4481 1 1 16 GLN C    C  -7.842  -7.315   2.990 1.00 . A A . 16 GLN C    1 1 
        5  4482 1 1 16 GLN CA   C  -6.510  -7.556   3.696 1.00 . A A . 16 GLN CA   1 1 
        5  4483 1 1 16 GLN CB   C  -6.182  -9.052   3.696 1.00 . A A . 16 GLN CB   1 1 
        5  4484 1 1 16 GLN CD   C  -4.190 -10.420   4.433 1.00 . A A . 16 GLN CD   1 1 
        5  4485 1 1 16 GLN CG   C  -4.706  -9.350   3.491 1.00 . A A . 16 GLN CG   1 1 
        5  4486 1 1 16 GLN H    H  -6.410  -7.669   5.808 1.00 . A A . 16 GLN H    1 1 
        5  4487 1 1 16 GLN HA   H  -5.735  -7.026   3.165 1.00 . A A . 16 GLN HA   1 1 
        5  4488 1 1 16 GLN HB2  H  -6.486  -9.475   4.642 1.00 . A A . 16 GLN HB2  1 1 
        5  4489 1 1 16 GLN HB3  H  -6.738  -9.530   2.903 1.00 . A A . 16 GLN HB3  1 1 
        5  4490 1 1 16 GLN HE21 H  -2.461  -9.452   4.620 1.00 . A A . 16 GLN HE21 1 1 
        5  4491 1 1 16 GLN HE22 H  -2.602 -10.931   5.519 1.00 . A A . 16 GLN HE22 1 1 
        5  4492 1 1 16 GLN HG2  H  -4.558  -9.685   2.475 1.00 . A A . 16 GLN HG2  1 1 
        5  4493 1 1 16 GLN HG3  H  -4.143  -8.443   3.656 1.00 . A A . 16 GLN HG3  1 1 
        5  4494 1 1 16 GLN N    N  -6.546  -7.046   5.063 1.00 . A A . 16 GLN N    1 1 
        5  4495 1 1 16 GLN NE2  N  -2.961 -10.251   4.905 1.00 . A A . 16 GLN NE2  1 1 
        5  4496 1 1 16 GLN O    O  -7.885  -7.117   1.776 1.00 . A A . 16 GLN O    1 1 
        5  4497 1 1 16 GLN OE1  O  -4.889 -11.387   4.735 1.00 . A A . 16 GLN OE1  1 1 
        5  4498 1 1 17 THR C    C -10.400  -5.695   2.677 1.00 . A A . 17 THR C    1 1 
        5  4499 1 1 17 THR CA   C -10.250  -7.118   3.205 1.00 . A A . 17 THR CA   1 1 
        5  4500 1 1 17 THR CB   C -11.320  -7.394   4.267 1.00 . A A . 17 THR CB   1 1 
        5  4501 1 1 17 THR CG2  C -12.730  -7.278   3.741 1.00 . A A . 17 THR CG2  1 1 
        5  4502 1 1 17 THR H    H  -8.829  -7.497   4.719 1.00 . A A . 17 THR H    1 1 
        5  4503 1 1 17 THR HA   H -10.390  -7.809   2.387 1.00 . A A . 17 THR HA   1 1 
        5  4504 1 1 17 THR HB   H -11.210  -6.680   5.070 1.00 . A A . 17 THR HB   1 1 
        5  4505 1 1 17 THR HG1  H -10.380  -8.726   5.350 1.00 . A A . 17 THR HG1  1 1 
        5  4506 1 1 17 THR HG21 H -13.000  -8.183   3.212 1.00 . A A . 17 THR HG21 1 1 
        5  4507 1 1 17 THR HG22 H -12.800  -6.437   3.066 1.00 . A A . 17 THR HG22 1 1 
        5  4508 1 1 17 THR HG23 H -13.420  -7.132   4.565 1.00 . A A . 17 THR HG23 1 1 
        5  4509 1 1 17 THR N    N  -8.926  -7.333   3.758 1.00 . A A . 17 THR N    1 1 
        5  4510 1 1 17 THR O    O -10.750  -5.487   1.514 1.00 . A A . 17 THR O    1 1 
        5  4511 1 1 17 THR OG1  O -11.170  -8.695   4.804 1.00 . A A . 17 THR OG1  1 1 
        5  4512 1 1 18 LYS C    C  -9.318  -2.982   2.006 1.00 . A A . 18 LYS C    1 1 
        5  4513 1 1 18 LYS CA   C -10.250  -3.314   3.163 1.00 . A A . 18 LYS CA   1 1 
        5  4514 1 1 18 LYS CB   C  -9.944  -2.415   4.360 1.00 . A A . 18 LYS CB   1 1 
        5  4515 1 1 18 LYS CD   C  -9.811   0.029   4.931 1.00 . A A . 18 LYS CD   1 1 
        5  4516 1 1 18 LYS CE   C -10.640   0.957   5.801 1.00 . A A . 18 LYS CE   1 1 
        5  4517 1 1 18 LYS CG   C -10.650  -1.074   4.319 1.00 . A A . 18 LYS CG   1 1 
        5  4518 1 1 18 LYS H    H  -9.879  -4.947   4.454 1.00 . A A . 18 LYS H    1 1 
        5  4519 1 1 18 LYS HA   H -11.270  -3.133   2.846 1.00 . A A . 18 LYS HA   1 1 
        5  4520 1 1 18 LYS HB2  H -10.230  -2.928   5.265 1.00 . A A . 18 LYS HB2  1 1 
        5  4521 1 1 18 LYS HB3  H  -8.880  -2.231   4.388 1.00 . A A . 18 LYS HB3  1 1 
        5  4522 1 1 18 LYS HD2  H  -9.037  -0.419   5.538 1.00 . A A . 18 LYS HD2  1 1 
        5  4523 1 1 18 LYS HD3  H  -9.358   0.605   4.137 1.00 . A A . 18 LYS HD3  1 1 
        5  4524 1 1 18 LYS HE2  H -11.520   0.422   6.137 1.00 . A A . 18 LYS HE2  1 1 
        5  4525 1 1 18 LYS HE3  H -10.050   1.252   6.656 1.00 . A A . 18 LYS HE3  1 1 
        5  4526 1 1 18 LYS HG2  H -10.870  -0.822   3.291 1.00 . A A . 18 LYS HG2  1 1 
        5  4527 1 1 18 LYS HG3  H -11.580  -1.155   4.872 1.00 . A A . 18 LYS HG3  1 1 
        5  4528 1 1 18 LYS HZ1  H -11.310   2.934   5.732 1.00 . A A . 18 LYS HZ1  1 1 
        5  4529 1 1 18 LYS HZ2  H -11.900   1.965   4.480 1.00 . A A . 18 LYS HZ2  1 1 
        5  4530 1 1 18 LYS HZ3  H -10.300   2.505   4.441 1.00 . A A . 18 LYS HZ3  1 1 
        5  4531 1 1 18 LYS N    N -10.140  -4.718   3.540 1.00 . A A . 18 LYS N    1 1 
        5  4532 1 1 18 LYS NZ   N -11.070   2.175   5.062 1.00 . A A . 18 LYS NZ   1 1 
        5  4533 1 1 18 LYS O    O  -9.674  -2.228   1.103 1.00 . A A . 18 LYS O    1 1 
        5  4534 1 1 19 THR C    C  -7.663  -3.730  -0.370 1.00 . A A . 19 THR C    1 1 
        5  4535 1 1 19 THR CA   C  -7.127  -3.314   0.997 1.00 . A A . 19 THR CA   1 1 
        5  4536 1 1 19 THR CB   C  -5.838  -4.077   1.303 1.00 . A A . 19 THR CB   1 1 
        5  4537 1 1 19 THR CG2  C  -4.653  -3.603   0.488 1.00 . A A . 19 THR CG2  1 1 
        5  4538 1 1 19 THR H    H  -7.890  -4.144   2.790 1.00 . A A . 19 THR H    1 1 
        5  4539 1 1 19 THR HA   H  -6.912  -2.256   0.979 1.00 . A A . 19 THR HA   1 1 
        5  4540 1 1 19 THR HB   H  -5.991  -5.124   1.085 1.00 . A A . 19 THR HB   1 1 
        5  4541 1 1 19 THR HG1  H  -5.699  -4.773   3.128 1.00 . A A . 19 THR HG1  1 1 
        5  4542 1 1 19 THR HG21 H  -5.000  -3.204  -0.453 1.00 . A A . 19 THR HG21 1 1 
        5  4543 1 1 19 THR HG22 H  -3.988  -4.434   0.304 1.00 . A A . 19 THR HG22 1 1 
        5  4544 1 1 19 THR HG23 H  -4.126  -2.835   1.034 1.00 . A A . 19 THR HG23 1 1 
        5  4545 1 1 19 THR N    N  -8.117  -3.551   2.042 1.00 . A A . 19 THR N    1 1 
        5  4546 1 1 19 THR O    O  -7.627  -2.953  -1.325 1.00 . A A . 19 THR O    1 1 
        5  4547 1 1 19 THR OG1  O  -5.495  -3.953   2.670 1.00 . A A . 19 THR OG1  1 1 
        5  4548 1 1 20 ALA C    C  -9.978  -4.760  -2.103 1.00 . A A . 20 ALA C    1 1 
        5  4549 1 1 20 ALA CA   C  -8.696  -5.484  -1.705 1.00 . A A . 20 ALA CA   1 1 
        5  4550 1 1 20 ALA CB   C  -8.949  -6.977  -1.581 1.00 . A A . 20 ALA CB   1 1 
        5  4551 1 1 20 ALA H    H  -8.154  -5.532   0.341 1.00 . A A . 20 ALA H    1 1 
        5  4552 1 1 20 ALA HA   H  -7.954  -5.332  -2.475 1.00 . A A . 20 ALA HA   1 1 
        5  4553 1 1 20 ALA HB1  H  -9.812  -7.148  -0.955 1.00 . A A . 20 ALA HB1  1 1 
        5  4554 1 1 20 ALA HB2  H  -8.085  -7.454  -1.139 1.00 . A A . 20 ALA HB2  1 1 
        5  4555 1 1 20 ALA HB3  H  -9.127  -7.395  -2.561 1.00 . A A . 20 ALA HB3  1 1 
        5  4556 1 1 20 ALA N    N  -8.156  -4.961  -0.456 1.00 . A A . 20 ALA N    1 1 
        5  4557 1 1 20 ALA O    O -10.300  -4.667  -3.286 1.00 . A A . 20 ALA O    1 1 
        5  4558 1 1 21 LYS C    C -11.690  -2.099  -1.777 1.00 . A A . 21 LYS C    1 1 
        5  4559 1 1 21 LYS CA   C -11.950  -3.544  -1.363 1.00 . A A . 21 LYS CA   1 1 
        5  4560 1 1 21 LYS CB   C -12.840  -3.576  -0.119 1.00 . A A . 21 LYS CB   1 1 
        5  4561 1 1 21 LYS CD   C -14.740  -5.205  -0.312 1.00 . A A . 21 LYS CD   1 1 
        5  4562 1 1 21 LYS CE   C -15.680  -5.606  -1.439 1.00 . A A . 21 LYS CE   1 1 
        5  4563 1 1 21 LYS CG   C -14.310  -3.750  -0.431 1.00 . A A . 21 LYS CG   1 1 
        5  4564 1 1 21 LYS H    H -10.390  -4.361  -0.187 1.00 . A A . 21 LYS H    1 1 
        5  4565 1 1 21 LYS HA   H -12.460  -4.049  -2.170 1.00 . A A . 21 LYS HA   1 1 
        5  4566 1 1 21 LYS HB2  H -12.530  -4.396   0.512 1.00 . A A . 21 LYS HB2  1 1 
        5  4567 1 1 21 LYS HB3  H -12.710  -2.650   0.423 1.00 . A A . 21 LYS HB3  1 1 
        5  4568 1 1 21 LYS HD2  H -13.860  -5.833  -0.348 1.00 . A A . 21 LYS HD2  1 1 
        5  4569 1 1 21 LYS HD3  H -15.250  -5.344   0.632 1.00 . A A . 21 LYS HD3  1 1 
        5  4570 1 1 21 LYS HE2  H -16.580  -5.024  -1.363 1.00 . A A . 21 LYS HE2  1 1 
        5  4571 1 1 21 LYS HE3  H -15.200  -5.398  -2.383 1.00 . A A . 21 LYS HE3  1 1 
        5  4572 1 1 21 LYS HG2  H -14.890  -3.158   0.262 1.00 . A A . 21 LYS HG2  1 1 
        5  4573 1 1 21 LYS HG3  H -14.500  -3.412  -1.440 1.00 . A A . 21 LYS HG3  1 1 
        5  4574 1 1 21 LYS HZ1  H -15.170  -7.624  -1.277 1.00 . A A . 21 LYS HZ1  1 1 
        5  4575 1 1 21 LYS HZ2  H -16.510  -7.337  -2.257 1.00 . A A . 21 LYS HZ2  1 1 
        5  4576 1 1 21 LYS HZ3  H -16.660  -7.236  -0.575 1.00 . A A . 21 LYS HZ3  1 1 
        5  4577 1 1 21 LYS N    N -10.700  -4.253  -1.110 1.00 . A A . 21 LYS N    1 1 
        5  4578 1 1 21 LYS NZ   N -16.030  -7.052  -1.383 1.00 . A A . 21 LYS NZ   1 1 
        5  4579 1 1 21 LYS O    O -12.370  -1.564  -2.656 1.00 . A A . 21 LYS O    1 1 
        5  4580 1 1 22 ASP C    C  -9.760   0.038  -2.832 1.00 . A A . 22 ASP C    1 1 
        5  4581 1 1 22 ASP CA   C -10.370  -0.086  -1.439 1.00 . A A . 22 ASP CA   1 1 
        5  4582 1 1 22 ASP CB   C  -9.393   0.453  -0.392 1.00 . A A . 22 ASP CB   1 1 
        5  4583 1 1 22 ASP CG   C -10.080   1.304   0.657 1.00 . A A . 22 ASP CG   1 1 
        5  4584 1 1 22 ASP H    H -10.210  -1.946  -0.446 1.00 . A A . 22 ASP H    1 1 
        5  4585 1 1 22 ASP HA   H -11.270   0.496  -1.403 1.00 . A A . 22 ASP HA   1 1 
        5  4586 1 1 22 ASP HB2  H  -8.914  -0.380   0.107 1.00 . A A . 22 ASP HB2  1 1 
        5  4587 1 1 22 ASP HB3  H  -8.643   1.056  -0.884 1.00 . A A . 22 ASP HB3  1 1 
        5  4588 1 1 22 ASP N    N -10.710  -1.470  -1.138 1.00 . A A . 22 ASP N    1 1 
        5  4589 1 1 22 ASP O    O -10.040   0.986  -3.563 1.00 . A A . 22 ASP O    1 1 
        5  4590 1 1 22 ASP OD1  O -10.790   2.259   0.274 1.00 . A A . 22 ASP OD1  1 1 
        5  4591 1 1 22 ASP OD2  O  -9.916   1.015   1.861 1.00 . A A . 22 ASP OD2  1 1 
        5  4592 1 1 23 LEU C    C  -9.210  -1.442  -5.578 1.00 . A A . 23 LEU C    1 1 
        5  4593 1 1 23 LEU CA   C  -8.268  -0.920  -4.498 1.00 . A A . 23 LEU CA   1 1 
        5  4594 1 1 23 LEU CB   C  -6.995  -1.766  -4.457 1.00 . A A . 23 LEU CB   1 1 
        5  4595 1 1 23 LEU CD1  C  -4.642  -1.281  -3.730 1.00 . A A . 23 LEU CD1  1 1 
        5  4596 1 1 23 LEU CD2  C  -5.197  -1.384  -6.168 1.00 . A A . 23 LEU CD2  1 1 
        5  4597 1 1 23 LEU CG   C  -5.706  -1.007  -4.783 1.00 . A A . 23 LEU CG   1 1 
        5  4598 1 1 23 LEU H    H  -8.728  -1.653  -2.566 1.00 . A A . 23 LEU H    1 1 
        5  4599 1 1 23 LEU HA   H  -8.002   0.100  -4.731 1.00 . A A . 23 LEU HA   1 1 
        5  4600 1 1 23 LEU HB2  H  -6.901  -2.187  -3.466 1.00 . A A . 23 LEU HB2  1 1 
        5  4601 1 1 23 LEU HB3  H  -7.098  -2.576  -5.164 1.00 . A A . 23 LEU HB3  1 1 
        5  4602 1 1 23 LEU HD11 H  -3.833  -0.577  -3.845 1.00 . A A . 23 LEU HD11 1 1 
        5  4603 1 1 23 LEU HD12 H  -4.268  -2.287  -3.850 1.00 . A A . 23 LEU HD12 1 1 
        5  4604 1 1 23 LEU HD13 H  -5.077  -1.173  -2.747 1.00 . A A . 23 LEU HD13 1 1 
        5  4605 1 1 23 LEU HD21 H  -4.857  -0.496  -6.681 1.00 . A A . 23 LEU HD21 1 1 
        5  4606 1 1 23 LEU HD22 H  -5.995  -1.842  -6.733 1.00 . A A . 23 LEU HD22 1 1 
        5  4607 1 1 23 LEU HD23 H  -4.377  -2.080  -6.074 1.00 . A A . 23 LEU HD23 1 1 
        5  4608 1 1 23 LEU HG   H  -5.910   0.055  -4.779 1.00 . A A . 23 LEU HG   1 1 
        5  4609 1 1 23 LEU N    N  -8.918  -0.924  -3.192 1.00 . A A . 23 LEU N    1 1 
        5  4610 1 1 23 LEU O    O  -9.301  -0.872  -6.665 1.00 . A A . 23 LEU O    1 1 
        5  4611 1 1 24 GLY C    C -10.330  -4.430  -6.787 1.00 . A A . 24 GLY C    1 1 
        5  4612 1 1 24 GLY CA   C -10.830  -3.112  -6.225 1.00 . A A . 24 GLY CA   1 1 
        5  4613 1 1 24 GLY H    H  -9.795  -2.941  -4.389 1.00 . A A . 24 GLY H    1 1 
        5  4614 1 1 24 GLY HA2  H -11.780  -3.280  -5.735 1.00 . A A . 24 GLY HA2  1 1 
        5  4615 1 1 24 GLY HA3  H -10.970  -2.419  -7.039 1.00 . A A . 24 GLY HA3  1 1 
        5  4616 1 1 24 GLY N    N  -9.908  -2.530  -5.271 1.00 . A A . 24 GLY N    1 1 
        5  4617 1 1 24 GLY O    O -10.670  -4.803  -7.910 1.00 . A A . 24 GLY O    1 1 
        5  4618 1 1 25 VAL C    C  -9.416  -7.536  -5.492 1.00 . A A . 25 VAL C    1 1 
        5  4619 1 1 25 VAL CA   C  -8.971  -6.415  -6.426 1.00 . A A . 25 VAL CA   1 1 
        5  4620 1 1 25 VAL CB   C  -7.430  -6.377  -6.467 1.00 . A A . 25 VAL CB   1 1 
        5  4621 1 1 25 VAL CG1  C  -6.949  -5.564  -7.658 1.00 . A A . 25 VAL CG1  1 1 
        5  4622 1 1 25 VAL CG2  C  -6.875  -5.814  -5.168 1.00 . A A . 25 VAL CG2  1 1 
        5  4623 1 1 25 VAL H    H  -9.288  -4.781  -5.119 1.00 . A A . 25 VAL H    1 1 
        5  4624 1 1 25 VAL HA   H  -9.333  -6.623  -7.421 1.00 . A A . 25 VAL HA   1 1 
        5  4625 1 1 25 VAL HB   H  -7.069  -7.389  -6.580 1.00 . A A . 25 VAL HB   1 1 
        5  4626 1 1 25 VAL HG11 H  -6.690  -4.568  -7.334 1.00 . A A . 25 VAL HG11 1 1 
        5  4627 1 1 25 VAL HG12 H  -7.732  -5.511  -8.399 1.00 . A A . 25 VAL HG12 1 1 
        5  4628 1 1 25 VAL HG13 H  -6.078  -6.040  -8.089 1.00 . A A . 25 VAL HG13 1 1 
        5  4629 1 1 25 VAL HG21 H  -5.887  -6.214  -4.995 1.00 . A A . 25 VAL HG21 1 1 
        5  4630 1 1 25 VAL HG22 H  -7.524  -6.089  -4.350 1.00 . A A . 25 VAL HG22 1 1 
        5  4631 1 1 25 VAL HG23 H  -6.821  -4.738  -5.236 1.00 . A A . 25 VAL HG23 1 1 
        5  4632 1 1 25 VAL N    N  -9.521  -5.133  -6.003 1.00 . A A . 25 VAL N    1 1 
        5  4633 1 1 25 VAL O    O -10.160  -7.305  -4.543 1.00 . A A . 25 VAL O    1 1 
        5  4634 1 1 26 GLN C    C  -8.270 -10.101  -3.837 1.00 . A A . 26 GLN C    1 1 
        5  4635 1 1 26 GLN CA   C  -9.293  -9.902  -4.948 1.00 . A A . 26 GLN CA   1 1 
        5  4636 1 1 26 GLN CB   C  -9.377 -11.162  -5.812 1.00 . A A . 26 GLN CB   1 1 
        5  4637 1 1 26 GLN CD   C  -9.807 -10.908  -8.289 1.00 . A A . 26 GLN CD   1 1 
        5  4638 1 1 26 GLN CG   C -10.420 -11.075  -6.913 1.00 . A A . 26 GLN CG   1 1 
        5  4639 1 1 26 GLN H    H  -8.351  -8.871  -6.529 1.00 . A A . 26 GLN H    1 1 
        5  4640 1 1 26 GLN HA   H -10.250  -9.716  -4.504 1.00 . A A . 26 GLN HA   1 1 
        5  4641 1 1 26 GLN HB2  H  -8.415 -11.334  -6.271 1.00 . A A . 26 GLN HB2  1 1 
        5  4642 1 1 26 GLN HB3  H  -9.621 -12.003  -5.180 1.00 . A A . 26 GLN HB3  1 1 
        5  4643 1 1 26 GLN HE21 H -11.290 -11.937  -9.108 1.00 . A A . 26 GLN HE21 1 1 
        5  4644 1 1 26 GLN HE22 H -10.090 -11.368 -10.202 1.00 . A A . 26 GLN HE22 1 1 
        5  4645 1 1 26 GLN HG2  H -11.000 -11.981  -6.907 1.00 . A A . 26 GLN HG2  1 1 
        5  4646 1 1 26 GLN HG3  H -11.060 -10.229  -6.717 1.00 . A A . 26 GLN HG3  1 1 
        5  4647 1 1 26 GLN N    N  -8.946  -8.748  -5.765 1.00 . A A . 26 GLN N    1 1 
        5  4648 1 1 26 GLN NE2  N -10.460 -11.461  -9.303 1.00 . A A . 26 GLN NE2  1 1 
        5  4649 1 1 26 GLN O    O  -7.077  -9.860  -4.024 1.00 . A A . 26 GLN O    1 1 
        5  4650 1 1 26 GLN OE1  O  -8.754 -10.290  -8.440 1.00 . A A . 26 GLN OE1  1 1 
        5  4651 1 1 27 GLN C    C  -6.749 -11.740  -1.877 1.00 . A A . 27 GLN C    1 1 
        5  4652 1 1 27 GLN CA   C  -7.880 -10.775  -1.530 1.00 . A A . 27 GLN CA   1 1 
        5  4653 1 1 27 GLN CB   C  -8.693 -11.324  -0.356 1.00 . A A . 27 GLN CB   1 1 
        5  4654 1 1 27 GLN CD   C -11.150 -11.119   0.193 1.00 . A A . 27 GLN CD   1 1 
        5  4655 1 1 27 GLN CG   C  -9.819 -10.403   0.087 1.00 . A A . 27 GLN CG   1 1 
        5  4656 1 1 27 GLN H    H  -9.706 -10.712  -2.598 1.00 . A A . 27 GLN H    1 1 
        5  4657 1 1 27 GLN HA   H  -7.450  -9.829  -1.247 1.00 . A A . 27 GLN HA   1 1 
        5  4658 1 1 27 GLN HB2  H  -9.122 -12.273  -0.643 1.00 . A A . 27 GLN HB2  1 1 
        5  4659 1 1 27 GLN HB3  H  -8.031 -11.476   0.485 1.00 . A A . 27 GLN HB3  1 1 
        5  4660 1 1 27 GLN HE21 H -11.830  -9.716   1.426 1.00 . A A . 27 GLN HE21 1 1 
        5  4661 1 1 27 GLN HE22 H -12.930 -10.993   1.058 1.00 . A A . 27 GLN HE22 1 1 
        5  4662 1 1 27 GLN HG2  H  -9.571  -9.991   1.052 1.00 . A A . 27 GLN HG2  1 1 
        5  4663 1 1 27 GLN HG3  H  -9.913  -9.601  -0.633 1.00 . A A . 27 GLN HG3  1 1 
        5  4664 1 1 27 GLN N    N  -8.747 -10.542  -2.681 1.00 . A A . 27 GLN N    1 1 
        5  4665 1 1 27 GLN NE2  N -12.060 -10.552   0.971 1.00 . A A . 27 GLN NE2  1 1 
        5  4666 1 1 27 GLN O    O  -5.702 -11.741  -1.229 1.00 . A A . 27 GLN O    1 1 
        5  4667 1 1 27 GLN OE1  O -11.350 -12.168  -0.417 1.00 . A A . 27 GLN OE1  1 1 
        5  4668 1 1 28 SER C    C  -4.700 -12.819  -3.807 1.00 . A A . 28 SER C    1 1 
        5  4669 1 1 28 SER CA   C  -5.967 -13.523  -3.333 1.00 . A A . 28 SER CA   1 1 
        5  4670 1 1 28 SER CB   C  -6.528 -14.401  -4.455 1.00 . A A . 28 SER CB   1 1 
        5  4671 1 1 28 SER H    H  -7.820 -12.505  -3.375 1.00 . A A . 28 SER H    1 1 
        5  4672 1 1 28 SER HA   H  -5.723 -14.147  -2.487 1.00 . A A . 28 SER HA   1 1 
        5  4673 1 1 28 SER HB2  H  -7.607 -14.390  -4.410 1.00 . A A . 28 SER HB2  1 1 
        5  4674 1 1 28 SER HB3  H  -6.203 -14.012  -5.407 1.00 . A A . 28 SER HB3  1 1 
        5  4675 1 1 28 SER HG   H  -6.630 -16.313  -4.865 1.00 . A A . 28 SER HG   1 1 
        5  4676 1 1 28 SER N    N  -6.968 -12.556  -2.899 1.00 . A A . 28 SER N    1 1 
        5  4677 1 1 28 SER O    O  -3.589 -13.252  -3.506 1.00 . A A . 28 SER O    1 1 
        5  4678 1 1 28 SER OG   O  -6.079 -15.739  -4.328 1.00 . A A . 28 SER OG   1 1 
        5  4679 1 1 29 ALA C    C  -2.912 -10.386  -3.933 1.00 . A A . 29 ALA C    1 1 
        5  4680 1 1 29 ALA CA   C  -3.748 -10.966  -5.068 1.00 . A A . 29 ALA CA   1 1 
        5  4681 1 1 29 ALA CB   C  -4.240  -9.855  -5.984 1.00 . A A . 29 ALA CB   1 1 
        5  4682 1 1 29 ALA H    H  -5.788 -11.437  -4.756 1.00 . A A . 29 ALA H    1 1 
        5  4683 1 1 29 ALA HA   H  -3.131 -11.635  -5.651 1.00 . A A . 29 ALA HA   1 1 
        5  4684 1 1 29 ALA HB1  H  -3.568  -9.756  -6.823 1.00 . A A . 29 ALA HB1  1 1 
        5  4685 1 1 29 ALA HB2  H  -4.273  -8.924  -5.436 1.00 . A A . 29 ALA HB2  1 1 
        5  4686 1 1 29 ALA HB3  H  -5.230 -10.095  -6.342 1.00 . A A . 29 ALA HB3  1 1 
        5  4687 1 1 29 ALA N    N  -4.877 -11.731  -4.551 1.00 . A A . 29 ALA N    1 1 
        5  4688 1 1 29 ALA O    O  -1.686 -10.311  -4.029 1.00 . A A . 29 ALA O    1 1 
        5  4689 1 1 30 ILE C    C  -1.936 -10.423  -1.086 1.00 . A A . 30 ILE C    1 1 
        5  4690 1 1 30 ILE CA   C  -2.891  -9.410  -1.706 1.00 . A A . 30 ILE CA   1 1 
        5  4691 1 1 30 ILE CB   C  -3.886  -8.935  -0.628 1.00 . A A . 30 ILE CB   1 1 
        5  4692 1 1 30 ILE CD1  C  -4.458  -6.904  -2.056 1.00 . A A . 30 ILE CD1  1 1 
        5  4693 1 1 30 ILE CG1  C  -4.985  -8.074  -1.254 1.00 . A A . 30 ILE CG1  1 1 
        5  4694 1 1 30 ILE CG2  C  -3.156  -8.163   0.460 1.00 . A A . 30 ILE CG2  1 1 
        5  4695 1 1 30 ILE H    H  -4.554 -10.067  -2.838 1.00 . A A . 30 ILE H    1 1 
        5  4696 1 1 30 ILE HA   H  -2.324  -8.556  -2.045 1.00 . A A . 30 ILE HA   1 1 
        5  4697 1 1 30 ILE HB   H  -4.335  -9.807  -0.176 1.00 . A A . 30 ILE HB   1 1 
        5  4698 1 1 30 ILE HD11 H  -3.794  -7.267  -2.827 1.00 . A A . 30 ILE HD11 1 1 
        5  4699 1 1 30 ILE HD12 H  -3.919  -6.233  -1.403 1.00 . A A . 30 ILE HD12 1 1 
        5  4700 1 1 30 ILE HD13 H  -5.285  -6.377  -2.510 1.00 . A A . 30 ILE HD13 1 1 
        5  4701 1 1 30 ILE HG12 H  -5.582  -8.685  -1.913 1.00 . A A . 30 ILE HG12 1 1 
        5  4702 1 1 30 ILE HG13 H  -5.616  -7.681  -0.468 1.00 . A A . 30 ILE HG13 1 1 
        5  4703 1 1 30 ILE HG21 H  -2.161  -8.564   0.582 1.00 . A A . 30 ILE HG21 1 1 
        5  4704 1 1 30 ILE HG22 H  -3.698  -8.252   1.390 1.00 . A A . 30 ILE HG22 1 1 
        5  4705 1 1 30 ILE HG23 H  -3.091  -7.121   0.181 1.00 . A A . 30 ILE HG23 1 1 
        5  4706 1 1 30 ILE N    N  -3.579  -9.980  -2.858 1.00 . A A . 30 ILE N    1 1 
        5  4707 1 1 30 ILE O    O  -0.781 -10.110  -0.802 1.00 . A A . 30 ILE O    1 1 
        5  4708 1 1 31 ASN C    C  -0.436 -13.044  -1.205 1.00 . A A . 31 ASN C    1 1 
        5  4709 1 1 31 ASN CA   C  -1.617 -12.704  -0.302 1.00 . A A . 31 ASN CA   1 1 
        5  4710 1 1 31 ASN CB   C  -2.470 -13.951  -0.062 1.00 . A A . 31 ASN CB   1 1 
        5  4711 1 1 31 ASN CG   C  -3.001 -14.024   1.356 1.00 . A A . 31 ASN CG   1 1 
        5  4712 1 1 31 ASN H    H  -3.354 -11.831  -1.134 1.00 . A A . 31 ASN H    1 1 
        5  4713 1 1 31 ASN HA   H  -1.240 -12.350   0.645 1.00 . A A . 31 ASN HA   1 1 
        5  4714 1 1 31 ASN HB2  H  -3.311 -13.941  -0.740 1.00 . A A . 31 ASN HB2  1 1 
        5  4715 1 1 31 ASN HB3  H  -1.872 -14.830  -0.249 1.00 . A A . 31 ASN HB3  1 1 
        5  4716 1 1 31 ASN HD21 H  -1.321 -14.904   1.962 1.00 . A A . 31 ASN HD21 1 1 
        5  4717 1 1 31 ASN HD22 H  -2.522 -14.638   3.189 1.00 . A A . 31 ASN HD22 1 1 
        5  4718 1 1 31 ASN N    N  -2.426 -11.641  -0.885 1.00 . A A . 31 ASN N    1 1 
        5  4719 1 1 31 ASN ND2  N  -2.201 -14.577   2.260 1.00 . A A . 31 ASN ND2  1 1 
        5  4720 1 1 31 ASN O    O   0.652 -13.360  -0.725 1.00 . A A . 31 ASN O    1 1 
        5  4721 1 1 31 ASN OD1  O  -4.118 -13.588   1.636 1.00 . A A . 31 ASN OD1  1 1 
        5  4722 1 1 32 LYS C    C   1.408 -12.158  -3.558 1.00 . A A . 32 LYS C    1 1 
        5  4723 1 1 32 LYS CA   C   0.386 -13.284  -3.482 1.00 . A A . 32 LYS CA   1 1 
        5  4724 1 1 32 LYS CB   C  -0.220 -13.531  -4.864 1.00 . A A . 32 LYS CB   1 1 
        5  4725 1 1 32 LYS CD   C  -1.147 -15.680  -5.793 1.00 . A A . 32 LYS CD   1 1 
        5  4726 1 1 32 LYS CE   C  -0.722 -16.927  -5.036 1.00 . A A . 32 LYS CE   1 1 
        5  4727 1 1 32 LYS CG   C  -1.387 -14.507  -4.853 1.00 . A A . 32 LYS CG   1 1 
        5  4728 1 1 32 LYS H    H  -1.546 -12.726  -2.837 1.00 . A A . 32 LYS H    1 1 
        5  4729 1 1 32 LYS HA   H   0.882 -14.176  -3.151 1.00 . A A . 32 LYS HA   1 1 
        5  4730 1 1 32 LYS HB2  H  -0.568 -12.589  -5.263 1.00 . A A . 32 LYS HB2  1 1 
        5  4731 1 1 32 LYS HB3  H   0.547 -13.926  -5.514 1.00 . A A . 32 LYS HB3  1 1 
        5  4732 1 1 32 LYS HD2  H  -2.060 -15.891  -6.329 1.00 . A A . 32 LYS HD2  1 1 
        5  4733 1 1 32 LYS HD3  H  -0.370 -15.413  -6.494 1.00 . A A . 32 LYS HD3  1 1 
        5  4734 1 1 32 LYS HE2  H   0.185 -17.309  -5.478 1.00 . A A . 32 LYS HE2  1 1 
        5  4735 1 1 32 LYS HE3  H  -0.536 -16.663  -4.004 1.00 . A A . 32 LYS HE3  1 1 
        5  4736 1 1 32 LYS HG2  H  -1.520 -14.884  -3.851 1.00 . A A . 32 LYS HG2  1 1 
        5  4737 1 1 32 LYS HG3  H  -2.280 -13.985  -5.165 1.00 . A A . 32 LYS HG3  1 1 
        5  4738 1 1 32 LYS HZ1  H  -2.687 -17.597  -4.801 1.00 . A A . 32 LYS HZ1  1 1 
        5  4739 1 1 32 LYS HZ2  H  -1.517 -18.764  -4.438 1.00 . A A . 32 LYS HZ2  1 1 
        5  4740 1 1 32 LYS HZ3  H  -1.844 -18.369  -6.049 1.00 . A A . 32 LYS HZ3  1 1 
        5  4741 1 1 32 LYS N    N  -0.659 -12.980  -2.514 1.00 . A A . 32 LYS N    1 1 
        5  4742 1 1 32 LYS NZ   N  -1.765 -17.989  -5.084 1.00 . A A . 32 LYS NZ   1 1 
        5  4743 1 1 32 LYS O    O   2.577 -12.386  -3.869 1.00 . A A . 32 LYS O    1 1 
        5  4744 1 1 33 TRP C    C   2.833  -9.808  -2.177 1.00 . A A . 33 TRP C    1 1 
        5  4745 1 1 33 TRP CA   C   1.819  -9.780  -3.315 1.00 . A A . 33 TRP CA   1 1 
        5  4746 1 1 33 TRP CB   C   0.947  -8.538  -3.225 1.00 . A A . 33 TRP CB   1 1 
        5  4747 1 1 33 TRP CD1  C   0.426  -8.812  -5.686 1.00 . A A . 33 TRP CD1  1 1 
        5  4748 1 1 33 TRP CD2  C  -0.865  -7.324  -4.651 1.00 . A A . 33 TRP CD2  1 1 
        5  4749 1 1 33 TRP CE2  C  -1.246  -7.374  -6.002 1.00 . A A . 33 TRP CE2  1 1 
        5  4750 1 1 33 TRP CE3  C  -1.536  -6.464  -3.790 1.00 . A A . 33 TRP CE3  1 1 
        5  4751 1 1 33 TRP CG   C   0.212  -8.242  -4.481 1.00 . A A . 33 TRP CG   1 1 
        5  4752 1 1 33 TRP CH2  C  -2.920  -5.750  -5.647 1.00 . A A . 33 TRP CH2  1 1 
        5  4753 1 1 33 TRP CZ2  C  -2.274  -6.589  -6.514 1.00 . A A . 33 TRP CZ2  1 1 
        5  4754 1 1 33 TRP CZ3  C  -2.560  -5.683  -4.294 1.00 . A A . 33 TRP CZ3  1 1 
        5  4755 1 1 33 TRP H    H   0.017 -10.822  -3.040 1.00 . A A . 33 TRP H    1 1 
        5  4756 1 1 33 TRP HA   H   2.341  -9.776  -4.260 1.00 . A A . 33 TRP HA   1 1 
        5  4757 1 1 33 TRP HB2  H   0.215  -8.695  -2.462 1.00 . A A . 33 TRP HB2  1 1 
        5  4758 1 1 33 TRP HB3  H   1.558  -7.688  -2.975 1.00 . A A . 33 TRP HB3  1 1 
        5  4759 1 1 33 TRP HD1  H   1.175  -9.557  -5.859 1.00 . A A . 33 TRP HD1  1 1 
        5  4760 1 1 33 TRP HE1  H  -0.474  -8.540  -7.565 1.00 . A A . 33 TRP HE1  1 1 
        5  4761 1 1 33 TRP HE3  H  -1.269  -6.410  -2.745 1.00 . A A . 33 TRP HE3  1 1 
        5  4762 1 1 33 TRP HH2  H  -3.726  -5.123  -6.000 1.00 . A A . 33 TRP HH2  1 1 
        5  4763 1 1 33 TRP HZ2  H  -2.560  -6.633  -7.554 1.00 . A A . 33 TRP HZ2  1 1 
        5  4764 1 1 33 TRP HZ3  H  -3.092  -5.008  -3.640 1.00 . A A . 33 TRP HZ3  1 1 
        5  4765 1 1 33 TRP N    N   0.959 -10.945  -3.278 1.00 . A A . 33 TRP N    1 1 
        5  4766 1 1 33 TRP NE1  N  -0.439  -8.293  -6.619 1.00 . A A . 33 TRP NE1  1 1 
        5  4767 1 1 33 TRP O    O   4.029  -9.604  -2.393 1.00 . A A . 33 TRP O    1 1 
        5  4768 1 1 34 ILE C    C   3.974 -11.447   0.257 1.00 . A A . 34 ILE C    1 1 
        5  4769 1 1 34 ILE CA   C   3.214 -10.125   0.204 1.00 . A A . 34 ILE CA   1 1 
        5  4770 1 1 34 ILE CB   C   2.409  -9.959   1.507 1.00 . A A . 34 ILE CB   1 1 
        5  4771 1 1 34 ILE CD1  C   0.492  -8.650   2.552 1.00 . A A . 34 ILE CD1  1 1 
        5  4772 1 1 34 ILE CG1  C   1.475  -8.753   1.406 1.00 . A A . 34 ILE CG1  1 1 
        5  4773 1 1 34 ILE CG2  C   3.347  -9.812   2.695 1.00 . A A . 34 ILE CG2  1 1 
        5  4774 1 1 34 ILE H    H   1.388 -10.223  -0.860 1.00 . A A . 34 ILE H    1 1 
        5  4775 1 1 34 ILE HA   H   3.925  -9.315   0.137 1.00 . A A . 34 ILE HA   1 1 
        5  4776 1 1 34 ILE HB   H   1.820 -10.851   1.656 1.00 . A A . 34 ILE HB   1 1 
        5  4777 1 1 34 ILE HD11 H   0.566  -9.533   3.170 1.00 . A A . 34 ILE HD11 1 1 
        5  4778 1 1 34 ILE HD12 H  -0.510  -8.570   2.160 1.00 . A A . 34 ILE HD12 1 1 
        5  4779 1 1 34 ILE HD13 H   0.721  -7.776   3.144 1.00 . A A . 34 ILE HD13 1 1 
        5  4780 1 1 34 ILE HG12 H   2.065  -7.848   1.394 1.00 . A A . 34 ILE HG12 1 1 
        5  4781 1 1 34 ILE HG13 H   0.910  -8.819   0.488 1.00 . A A . 34 ILE HG13 1 1 
        5  4782 1 1 34 ILE HG21 H   2.837  -9.296   3.496 1.00 . A A . 34 ILE HG21 1 1 
        5  4783 1 1 34 ILE HG22 H   4.217  -9.243   2.397 1.00 . A A . 34 ILE HG22 1 1 
        5  4784 1 1 34 ILE HG23 H   3.655 -10.789   3.036 1.00 . A A . 34 ILE HG23 1 1 
        5  4785 1 1 34 ILE N    N   2.350 -10.066  -0.967 1.00 . A A . 34 ILE N    1 1 
        5  4786 1 1 34 ILE O    O   5.055 -11.530   0.843 1.00 . A A . 34 ILE O    1 1 
        5  4787 1 1 35 HIS C    C   5.393 -13.742  -1.053 1.00 . A A . 35 HIS C    1 1 
        5  4788 1 1 35 HIS CA   C   4.025 -13.796  -0.386 1.00 . A A . 35 HIS CA   1 1 
        5  4789 1 1 35 HIS CB   C   3.121 -14.785  -1.124 1.00 . A A . 35 HIS CB   1 1 
        5  4790 1 1 35 HIS CD2  C   1.621 -16.797  -0.474 1.00 . A A . 35 HIS CD2  1 1 
        5  4791 1 1 35 HIS CE1  C   1.438 -16.386   1.672 1.00 . A A . 35 HIS CE1  1 1 
        5  4792 1 1 35 HIS CG   C   2.327 -15.671  -0.215 1.00 . A A . 35 HIS CG   1 1 
        5  4793 1 1 35 HIS H    H   2.542 -12.351  -0.808 1.00 . A A . 35 HIS H    1 1 
        5  4794 1 1 35 HIS HA   H   4.149 -14.123   0.631 1.00 . A A . 35 HIS HA   1 1 
        5  4795 1 1 35 HIS HB2  H   2.425 -14.234  -1.738 1.00 . A A . 35 HIS HB2  1 1 
        5  4796 1 1 35 HIS HB3  H   3.729 -15.415  -1.755 1.00 . A A . 35 HIS HB3  1 1 
        5  4797 1 1 35 HIS HD1  H   2.588 -14.695   1.636 1.00 . A A . 35 HIS HD1  1 1 
        5  4798 1 1 35 HIS HD2  H   1.505 -17.271  -1.438 1.00 . A A . 35 HIS HD2  1 1 
        5  4799 1 1 35 HIS HE1  H   1.162 -16.463   2.714 1.00 . A A . 35 HIS HE1  1 1 
        5  4800 1 1 35 HIS HE2  H   0.444 -17.961   0.818 1.00 . A A . 35 HIS HE2  1 1 
        5  4801 1 1 35 HIS N    N   3.404 -12.478  -0.359 1.00 . A A . 35 HIS N    1 1 
        5  4802 1 1 35 HIS ND1  N   2.192 -15.441   1.139 1.00 . A A . 35 HIS ND1  1 1 
        5  4803 1 1 35 HIS NE2  N   1.079 -17.221   0.714 1.00 . A A . 35 HIS NE2  1 1 
        5  4804 1 1 35 HIS O    O   6.283 -14.535  -0.740 1.00 . A A . 35 HIS O    1 1 
        5  4805 1 1 36 ALA C    C   7.505 -11.334  -2.318 1.00 . A A . 36 ALA C    1 1 
        5  4806 1 1 36 ALA CA   C   6.807 -12.640  -2.696 1.00 . A A . 36 ALA CA   1 1 
        5  4807 1 1 36 ALA CB   C   6.559 -12.692  -4.194 1.00 . A A . 36 ALA CB   1 1 
        5  4808 1 1 36 ALA H    H   4.801 -12.208  -2.177 1.00 . A A . 36 ALA H    1 1 
        5  4809 1 1 36 ALA HA   H   7.450 -13.467  -2.434 1.00 . A A . 36 ALA HA   1 1 
        5  4810 1 1 36 ALA HB1  H   5.778 -13.407  -4.404 1.00 . A A . 36 ALA HB1  1 1 
        5  4811 1 1 36 ALA HB2  H   7.467 -12.991  -4.699 1.00 . A A . 36 ALA HB2  1 1 
        5  4812 1 1 36 ALA HB3  H   6.258 -11.716  -4.543 1.00 . A A . 36 ALA HB3  1 1 
        5  4813 1 1 36 ALA N    N   5.551 -12.805  -1.974 1.00 . A A . 36 ALA N    1 1 
        5  4814 1 1 36 ALA O    O   8.508 -10.962  -2.926 1.00 . A A . 36 ALA O    1 1 
        5  4815 1 1 37 GLY C    C   7.610  -8.356  -1.990 1.00 . A A . 37 GLY C    1 1 
        5  4816 1 1 37 GLY CA   C   7.564  -9.391  -0.882 1.00 . A A . 37 GLY CA   1 1 
        5  4817 1 1 37 GLY H    H   6.173 -10.984  -0.864 1.00 . A A . 37 GLY H    1 1 
        5  4818 1 1 37 GLY HA2  H   6.984  -8.996  -0.060 1.00 . A A . 37 GLY HA2  1 1 
        5  4819 1 1 37 GLY HA3  H   8.570  -9.580  -0.539 1.00 . A A . 37 GLY HA3  1 1 
        5  4820 1 1 37 GLY N    N   6.972 -10.643  -1.315 1.00 . A A . 37 GLY N    1 1 
        5  4821 1 1 37 GLY O    O   8.619  -7.674  -2.168 1.00 . A A . 37 GLY O    1 1 
        5  4822 1 1 38 ARG C    C   6.413  -5.848  -3.297 1.00 . A A . 38 ARG C    1 1 
        5  4823 1 1 38 ARG CA   C   6.437  -7.278  -3.828 1.00 . A A . 38 ARG CA   1 1 
        5  4824 1 1 38 ARG CB   C   5.191  -7.541  -4.677 1.00 . A A . 38 ARG CB   1 1 
        5  4825 1 1 38 ARG CD   C   6.029  -7.860  -7.027 1.00 . A A . 38 ARG CD   1 1 
        5  4826 1 1 38 ARG CG   C   5.271  -6.948  -6.076 1.00 . A A . 38 ARG CG   1 1 
        5  4827 1 1 38 ARG CZ   C   5.555  -9.059  -9.127 1.00 . A A . 38 ARG CZ   1 1 
        5  4828 1 1 38 ARG H    H   5.742  -8.809  -2.542 1.00 . A A . 38 ARG H    1 1 
        5  4829 1 1 38 ARG HA   H   7.314  -7.406  -4.445 1.00 . A A . 38 ARG HA   1 1 
        5  4830 1 1 38 ARG HB2  H   5.051  -8.608  -4.771 1.00 . A A . 38 ARG HB2  1 1 
        5  4831 1 1 38 ARG HB3  H   4.333  -7.116  -4.178 1.00 . A A . 38 ARG HB3  1 1 
        5  4832 1 1 38 ARG HD2  H   6.989  -7.415  -7.242 1.00 . A A . 38 ARG HD2  1 1 
        5  4833 1 1 38 ARG HD3  H   6.175  -8.817  -6.550 1.00 . A A . 38 ARG HD3  1 1 
        5  4834 1 1 38 ARG HE   H   4.603  -7.418  -8.507 1.00 . A A . 38 ARG HE   1 1 
        5  4835 1 1 38 ARG HG2  H   4.270  -6.803  -6.453 1.00 . A A . 38 ARG HG2  1 1 
        5  4836 1 1 38 ARG HG3  H   5.778  -5.995  -6.022 1.00 . A A . 38 ARG HG3  1 1 
        5  4837 1 1 38 ARG HH11 H   7.037  -9.870  -8.014 1.00 . A A . 38 ARG HH11 1 1 
        5  4838 1 1 38 ARG HH12 H   6.684 -10.696  -9.496 1.00 . A A . 38 ARG HH12 1 1 
        5  4839 1 1 38 ARG HH21 H   4.137  -8.503 -10.455 1.00 . A A . 38 ARG HH21 1 1 
        5  4840 1 1 38 ARG HH22 H   5.037  -9.920 -10.881 1.00 . A A . 38 ARG HH22 1 1 
        5  4841 1 1 38 ARG N    N   6.515  -8.237  -2.733 1.00 . A A . 38 ARG N    1 1 
        5  4842 1 1 38 ARG NE   N   5.309  -8.060  -8.283 1.00 . A A . 38 ARG NE   1 1 
        5  4843 1 1 38 ARG NH1  N   6.503  -9.948  -8.857 1.00 . A A . 38 ARG NH1  1 1 
        5  4844 1 1 38 ARG NH2  N   4.851  -9.169 -10.246 1.00 . A A . 38 ARG NH2  1 1 
        5  4845 1 1 38 ARG O    O   5.517  -5.470  -2.545 1.00 . A A . 38 ARG O    1 1 
        5  4846 1 1 39 LYS C    C   6.310  -2.860  -3.761 1.00 . A A . 39 LYS C    1 1 
        5  4847 1 1 39 LYS CA   C   7.500  -3.672  -3.258 1.00 . A A . 39 LYS CA   1 1 
        5  4848 1 1 39 LYS CB   C   8.808  -3.047  -3.752 1.00 . A A . 39 LYS CB   1 1 
        5  4849 1 1 39 LYS CD   C  11.074  -3.736  -2.906 1.00 . A A . 39 LYS CD   1 1 
        5  4850 1 1 39 LYS CE   C  12.341  -3.070  -2.395 1.00 . A A . 39 LYS CE   1 1 
        5  4851 1 1 39 LYS CG   C   9.848  -2.870  -2.658 1.00 . A A . 39 LYS CG   1 1 
        5  4852 1 1 39 LYS H    H   8.091  -5.419  -4.295 1.00 . A A . 39 LYS H    1 1 
        5  4853 1 1 39 LYS HA   H   7.494  -3.663  -2.178 1.00 . A A . 39 LYS HA   1 1 
        5  4854 1 1 39 LYS HB2  H   9.227  -3.678  -4.521 1.00 . A A . 39 LYS HB2  1 1 
        5  4855 1 1 39 LYS HB3  H   8.593  -2.075  -4.174 1.00 . A A . 39 LYS HB3  1 1 
        5  4856 1 1 39 LYS HD2  H  10.945  -4.680  -2.397 1.00 . A A . 39 LYS HD2  1 1 
        5  4857 1 1 39 LYS HD3  H  11.171  -3.909  -3.968 1.00 . A A . 39 LYS HD3  1 1 
        5  4858 1 1 39 LYS HE2  H  12.162  -2.009  -2.302 1.00 . A A . 39 LYS HE2  1 1 
        5  4859 1 1 39 LYS HE3  H  12.582  -3.480  -1.426 1.00 . A A . 39 LYS HE3  1 1 
        5  4860 1 1 39 LYS HG2  H  10.153  -1.836  -2.626 1.00 . A A . 39 LYS HG2  1 1 
        5  4861 1 1 39 LYS HG3  H   9.410  -3.147  -1.709 1.00 . A A . 39 LYS HG3  1 1 
        5  4862 1 1 39 LYS HZ1  H  13.169  -3.267  -4.302 1.00 . A A . 39 LYS HZ1  1 1 
        5  4863 1 1 39 LYS HZ2  H  13.931  -4.210  -3.125 1.00 . A A . 39 LYS HZ2  1 1 
        5  4864 1 1 39 LYS HZ3  H  14.205  -2.542  -3.178 1.00 . A A . 39 LYS HZ3  1 1 
        5  4865 1 1 39 LYS N    N   7.406  -5.059  -3.695 1.00 . A A . 39 LYS N    1 1 
        5  4866 1 1 39 LYS NZ   N  13.492  -3.288  -3.315 1.00 . A A . 39 LYS NZ   1 1 
        5  4867 1 1 39 LYS O    O   6.232  -2.514  -4.939 1.00 . A A . 39 LYS O    1 1 
        5  4868 1 1 40 ILE C    C   3.830  -0.820  -2.082 1.00 . A A . 40 ILE C    1 1 
        5  4869 1 1 40 ILE CA   C   4.197  -1.788  -3.202 1.00 . A A . 40 ILE CA   1 1 
        5  4870 1 1 40 ILE CB   C   2.993  -2.708  -3.486 1.00 . A A . 40 ILE CB   1 1 
        5  4871 1 1 40 ILE CD1  C   2.179  -4.597  -4.987 1.00 . A A . 40 ILE CD1  1 1 
        5  4872 1 1 40 ILE CG1  C   3.346  -3.725  -4.572 1.00 . A A . 40 ILE CG1  1 1 
        5  4873 1 1 40 ILE CG2  C   1.776  -1.887  -3.895 1.00 . A A . 40 ILE CG2  1 1 
        5  4874 1 1 40 ILE H    H   5.503  -2.863  -1.932 1.00 . A A . 40 ILE H    1 1 
        5  4875 1 1 40 ILE HA   H   4.412  -1.223  -4.097 1.00 . A A . 40 ILE HA   1 1 
        5  4876 1 1 40 ILE HB   H   2.749  -3.234  -2.577 1.00 . A A . 40 ILE HB   1 1 
        5  4877 1 1 40 ILE HD11 H   2.491  -5.264  -5.776 1.00 . A A . 40 ILE HD11 1 1 
        5  4878 1 1 40 ILE HD12 H   1.373  -3.970  -5.341 1.00 . A A . 40 ILE HD12 1 1 
        5  4879 1 1 40 ILE HD13 H   1.841  -5.173  -4.138 1.00 . A A . 40 ILE HD13 1 1 
        5  4880 1 1 40 ILE HG12 H   3.694  -3.200  -5.449 1.00 . A A . 40 ILE HG12 1 1 
        5  4881 1 1 40 ILE HG13 H   4.132  -4.372  -4.210 1.00 . A A . 40 ILE HG13 1 1 
        5  4882 1 1 40 ILE HG21 H   1.447  -1.288  -3.059 1.00 . A A . 40 ILE HG21 1 1 
        5  4883 1 1 40 ILE HG22 H   0.980  -2.550  -4.198 1.00 . A A . 40 ILE HG22 1 1 
        5  4884 1 1 40 ILE HG23 H   2.038  -1.241  -4.720 1.00 . A A . 40 ILE HG23 1 1 
        5  4885 1 1 40 ILE N    N   5.384  -2.559  -2.855 1.00 . A A . 40 ILE N    1 1 
        5  4886 1 1 40 ILE O    O   4.193  -1.029  -0.925 1.00 . A A . 40 ILE O    1 1 
        5  4887 1 1 41 PHE C    C   1.304   1.786  -1.785 1.00 . A A . 41 PHE C    1 1 
        5  4888 1 1 41 PHE CA   C   2.683   1.228  -1.450 1.00 . A A . 41 PHE CA   1 1 
        5  4889 1 1 41 PHE CB   C   3.698   2.368  -1.368 1.00 . A A . 41 PHE CB   1 1 
        5  4890 1 1 41 PHE CD1  C   5.970   1.364  -1.719 1.00 . A A . 41 PHE CD1  1 1 
        5  4891 1 1 41 PHE CD2  C   5.388   2.113   0.469 1.00 . A A . 41 PHE CD2  1 1 
        5  4892 1 1 41 PHE CE1  C   7.212   0.969  -1.257 1.00 . A A . 41 PHE CE1  1 1 
        5  4893 1 1 41 PHE CE2  C   6.627   1.721   0.936 1.00 . A A . 41 PHE CE2  1 1 
        5  4894 1 1 41 PHE CG   C   5.045   1.940  -0.862 1.00 . A A . 41 PHE CG   1 1 
        5  4895 1 1 41 PHE CZ   C   7.541   1.148   0.072 1.00 . A A . 41 PHE CZ   1 1 
        5  4896 1 1 41 PHE H    H   2.838   0.345  -3.370 1.00 . A A . 41 PHE H    1 1 
        5  4897 1 1 41 PHE HA   H   2.634   0.735  -0.491 1.00 . A A . 41 PHE HA   1 1 
        5  4898 1 1 41 PHE HB2  H   3.832   2.795  -2.352 1.00 . A A . 41 PHE HB2  1 1 
        5  4899 1 1 41 PHE HB3  H   3.317   3.129  -0.700 1.00 . A A . 41 PHE HB3  1 1 
        5  4900 1 1 41 PHE HD1  H   5.715   1.225  -2.760 1.00 . A A . 41 PHE HD1  1 1 
        5  4901 1 1 41 PHE HD2  H   4.675   2.560   1.144 1.00 . A A . 41 PHE HD2  1 1 
        5  4902 1 1 41 PHE HE1  H   7.922   0.522  -1.934 1.00 . A A . 41 PHE HE1  1 1 
        5  4903 1 1 41 PHE HE2  H   6.881   1.860   1.977 1.00 . A A . 41 PHE HE2  1 1 
        5  4904 1 1 41 PHE HZ   H   8.509   0.840   0.436 1.00 . A A . 41 PHE HZ   1 1 
        5  4905 1 1 41 PHE N    N   3.101   0.235  -2.433 1.00 . A A . 41 PHE N    1 1 
        5  4906 1 1 41 PHE O    O   1.116   2.429  -2.819 1.00 . A A . 41 PHE O    1 1 
        5  4907 1 1 42 LEU C    C  -1.158   3.475  -0.710 1.00 . A A . 42 LEU C    1 1 
        5  4908 1 1 42 LEU CA   C  -1.020   2.008  -1.096 1.00 . A A . 42 LEU CA   1 1 
        5  4909 1 1 42 LEU CB   C  -1.980   1.163  -0.264 1.00 . A A . 42 LEU CB   1 1 
        5  4910 1 1 42 LEU CD1  C  -1.376  -1.266  -0.284 1.00 . A A . 42 LEU CD1  1 1 
        5  4911 1 1 42 LEU CD2  C  -3.756  -0.570  -0.610 1.00 . A A . 42 LEU CD2  1 1 
        5  4912 1 1 42 LEU CG   C  -2.301  -0.204  -0.859 1.00 . A A . 42 LEU CG   1 1 
        5  4913 1 1 42 LEU H    H   0.554   1.014  -0.104 1.00 . A A . 42 LEU H    1 1 
        5  4914 1 1 42 LEU HA   H  -1.268   1.896  -2.141 1.00 . A A . 42 LEU HA   1 1 
        5  4915 1 1 42 LEU HB2  H  -1.543   1.018   0.711 1.00 . A A . 42 LEU HB2  1 1 
        5  4916 1 1 42 LEU HB3  H  -2.903   1.708  -0.150 1.00 . A A . 42 LEU HB3  1 1 
        5  4917 1 1 42 LEU HD11 H  -1.905  -2.205  -0.213 1.00 . A A . 42 LEU HD11 1 1 
        5  4918 1 1 42 LEU HD12 H  -1.043  -0.964   0.696 1.00 . A A . 42 LEU HD12 1 1 
        5  4919 1 1 42 LEU HD13 H  -0.519  -1.385  -0.934 1.00 . A A . 42 LEU HD13 1 1 
        5  4920 1 1 42 LEU HD21 H  -3.988  -1.489  -1.128 1.00 . A A . 42 LEU HD21 1 1 
        5  4921 1 1 42 LEU HD22 H  -4.394   0.221  -0.975 1.00 . A A . 42 LEU HD22 1 1 
        5  4922 1 1 42 LEU HD23 H  -3.919  -0.703   0.449 1.00 . A A . 42 LEU HD23 1 1 
        5  4923 1 1 42 LEU HG   H  -2.142  -0.162  -1.923 1.00 . A A . 42 LEU HG   1 1 
        5  4924 1 1 42 LEU N    N   0.343   1.535  -0.904 1.00 . A A . 42 LEU N    1 1 
        5  4925 1 1 42 LEU O    O  -0.863   3.860   0.422 1.00 . A A . 42 LEU O    1 1 
        5  4926 1 1 43 THR C    C  -3.289   6.025  -1.219 1.00 . A A . 43 THR C    1 1 
        5  4927 1 1 43 THR CA   C  -1.810   5.710  -1.411 1.00 . A A . 43 THR CA   1 1 
        5  4928 1 1 43 THR CB   C  -1.245   6.531  -2.573 1.00 . A A . 43 THR CB   1 1 
        5  4929 1 1 43 THR CG2  C  -0.635   7.843  -2.135 1.00 . A A . 43 THR CG2  1 1 
        5  4930 1 1 43 THR H    H  -1.845   3.916  -2.534 1.00 . A A . 43 THR H    1 1 
        5  4931 1 1 43 THR HA   H  -1.278   5.967  -0.507 1.00 . A A . 43 THR HA   1 1 
        5  4932 1 1 43 THR HB   H  -2.046   6.753  -3.265 1.00 . A A . 43 THR HB   1 1 
        5  4933 1 1 43 THR HG1  H   0.088   6.329  -3.992 1.00 . A A . 43 THR HG1  1 1 
        5  4934 1 1 43 THR HG21 H  -1.214   8.662  -2.534 1.00 . A A . 43 THR HG21 1 1 
        5  4935 1 1 43 THR HG22 H   0.379   7.908  -2.501 1.00 . A A . 43 THR HG22 1 1 
        5  4936 1 1 43 THR HG23 H  -0.630   7.897  -1.056 1.00 . A A . 43 THR HG23 1 1 
        5  4937 1 1 43 THR N    N  -1.621   4.286  -1.655 1.00 . A A . 43 THR N    1 1 
        5  4938 1 1 43 THR O    O  -4.097   5.841  -2.131 1.00 . A A . 43 THR O    1 1 
        5  4939 1 1 43 THR OG1  O  -0.249   5.801  -3.266 1.00 . A A . 43 THR OG1  1 1 
        5  4940 1 1 44 ILE C    C  -5.343   8.267  -0.118 1.00 . A A . 44 ILE C    1 1 
        5  4941 1 1 44 ILE CA   C  -5.022   6.833   0.285 1.00 . A A . 44 ILE CA   1 1 
        5  4942 1 1 44 ILE CB   C  -5.320   6.653   1.787 1.00 . A A . 44 ILE CB   1 1 
        5  4943 1 1 44 ILE CD1  C  -4.579   5.210   3.749 1.00 . A A . 44 ILE CD1  1 1 
        5  4944 1 1 44 ILE CG1  C  -4.850   5.276   2.262 1.00 . A A . 44 ILE CG1  1 1 
        5  4945 1 1 44 ILE CG2  C  -6.805   6.835   2.058 1.00 . A A . 44 ILE CG2  1 1 
        5  4946 1 1 44 ILE H    H  -2.949   6.618   0.659 1.00 . A A . 44 ILE H    1 1 
        5  4947 1 1 44 ILE HA   H  -5.660   6.162  -0.270 1.00 . A A . 44 ILE HA   1 1 
        5  4948 1 1 44 ILE HB   H  -4.784   7.416   2.331 1.00 . A A . 44 ILE HB   1 1 
        5  4949 1 1 44 ILE HD11 H  -5.409   5.647   4.286 1.00 . A A . 44 ILE HD11 1 1 
        5  4950 1 1 44 ILE HD12 H  -3.676   5.756   3.975 1.00 . A A . 44 ILE HD12 1 1 
        5  4951 1 1 44 ILE HD13 H  -4.461   4.179   4.048 1.00 . A A . 44 ILE HD13 1 1 
        5  4952 1 1 44 ILE HG12 H  -5.610   4.545   2.032 1.00 . A A . 44 ILE HG12 1 1 
        5  4953 1 1 44 ILE HG13 H  -3.939   5.015   1.746 1.00 . A A . 44 ILE HG13 1 1 
        5  4954 1 1 44 ILE HG21 H  -6.953   7.101   3.094 1.00 . A A . 44 ILE HG21 1 1 
        5  4955 1 1 44 ILE HG22 H  -7.326   5.912   1.846 1.00 . A A . 44 ILE HG22 1 1 
        5  4956 1 1 44 ILE HG23 H  -7.194   7.620   1.426 1.00 . A A . 44 ILE HG23 1 1 
        5  4957 1 1 44 ILE N    N  -3.638   6.496  -0.028 1.00 . A A . 44 ILE N    1 1 
        5  4958 1 1 44 ILE O    O  -4.730   9.214   0.375 1.00 . A A . 44 ILE O    1 1 
        5  4959 1 1 45 ASN C    C  -7.718  10.375  -0.529 1.00 . A A . 45 ASN C    1 1 
        5  4960 1 1 45 ASN CA   C  -6.715   9.741  -1.487 1.00 . A A . 45 ASN CA   1 1 
        5  4961 1 1 45 ASN CB   C  -7.321   9.645  -2.888 1.00 . A A . 45 ASN CB   1 1 
        5  4962 1 1 45 ASN CG   C  -6.481   8.803  -3.829 1.00 . A A . 45 ASN CG   1 1 
        5  4963 1 1 45 ASN H    H  -6.762   7.627  -1.373 1.00 . A A . 45 ASN H    1 1 
        5  4964 1 1 45 ASN HA   H  -5.833  10.362  -1.527 1.00 . A A . 45 ASN HA   1 1 
        5  4965 1 1 45 ASN HB2  H  -8.303   9.202  -2.820 1.00 . A A . 45 ASN HB2  1 1 
        5  4966 1 1 45 ASN HB3  H  -7.408  10.640  -3.304 1.00 . A A . 45 ASN HB3  1 1 
        5  4967 1 1 45 ASN HD21 H  -7.615   7.211  -3.452 1.00 . A A . 45 ASN HD21 1 1 
        5  4968 1 1 45 ASN HD22 H  -6.308   6.963  -4.568 1.00 . A A . 45 ASN HD22 1 1 
        5  4969 1 1 45 ASN N    N  -6.310   8.420  -1.017 1.00 . A A . 45 ASN N    1 1 
        5  4970 1 1 45 ASN ND2  N  -6.836   7.531  -3.963 1.00 . A A . 45 ASN ND2  1 1 
        5  4971 1 1 45 ASN O    O  -8.271   9.704   0.342 1.00 . A A . 45 ASN O    1 1 
        5  4972 1 1 45 ASN OD1  O  -5.522   9.291  -4.428 1.00 . A A . 45 ASN OD1  1 1 
        5  4973 1 1 46 ALA C    C -10.330  12.018  -0.159 1.00 . A A . 46 ALA C    1 1 
        5  4974 1 1 46 ALA CA   C  -8.889  12.401   0.151 1.00 . A A . 46 ALA CA   1 1 
        5  4975 1 1 46 ALA CB   C  -8.694  13.900  -0.016 1.00 . A A . 46 ALA CB   1 1 
        5  4976 1 1 46 ALA H    H  -7.480  12.154  -1.410 1.00 . A A . 46 ALA H    1 1 
        5  4977 1 1 46 ALA HA   H  -8.674  12.146   1.178 1.00 . A A . 46 ALA HA   1 1 
        5  4978 1 1 46 ALA HB1  H  -7.915  14.238   0.651 1.00 . A A . 46 ALA HB1  1 1 
        5  4979 1 1 46 ALA HB2  H  -9.616  14.412   0.221 1.00 . A A . 46 ALA HB2  1 1 
        5  4980 1 1 46 ALA HB3  H  -8.414  14.115  -1.036 1.00 . A A . 46 ALA HB3  1 1 
        5  4981 1 1 46 ALA N    N  -7.951  11.673  -0.697 1.00 . A A . 46 ALA N    1 1 
        5  4982 1 1 46 ALA O    O -11.250  12.390   0.574 1.00 . A A . 46 ALA O    1 1 
        5  4983 1 1 47 ASP C    C -12.270   9.560  -0.927 1.00 . A A . 47 ASP C    1 1 
        5  4984 1 1 47 ASP CA   C -11.870  10.846  -1.642 1.00 . A A . 47 ASP CA   1 1 
        5  4985 1 1 47 ASP CB   C -11.950  10.643  -3.161 1.00 . A A . 47 ASP CB   1 1 
        5  4986 1 1 47 ASP CG   C -10.620  10.270  -3.789 1.00 . A A . 47 ASP CG   1 1 
        5  4987 1 1 47 ASP H    H  -9.773  11.006  -1.789 1.00 . A A . 47 ASP H    1 1 
        5  4988 1 1 47 ASP HA   H -12.560  11.626  -1.360 1.00 . A A . 47 ASP HA   1 1 
        5  4989 1 1 47 ASP HB2  H -12.640   9.850  -3.367 1.00 . A A . 47 ASP HB2  1 1 
        5  4990 1 1 47 ASP HB3  H -12.300  11.558  -3.620 1.00 . A A . 47 ASP HB3  1 1 
        5  4991 1 1 47 ASP N    N -10.530  11.275  -1.244 1.00 . A A . 47 ASP N    1 1 
        5  4992 1 1 47 ASP O    O -13.460   9.237  -0.833 1.00 . A A . 47 ASP O    1 1 
        5  4993 1 1 47 ASP OD1  O -10.300   9.062  -3.836 1.00 . A A . 47 ASP OD1  1 1 
        5  4994 1 1 47 ASP OD2  O  -9.897  11.186  -4.234 1.00 . A A . 47 ASP OD2  1 1 
        5  4995 1 1 48 GLY C    C -11.170   6.365  -0.544 1.00 . A A . 48 GLY C    1 1 
        5  4996 1 1 48 GLY CA   C -11.560   7.587   0.270 1.00 . A A . 48 GLY CA   1 1 
        5  4997 1 1 48 GLY H    H -10.360   9.135  -0.534 1.00 . A A . 48 GLY H    1 1 
        5  4998 1 1 48 GLY HA2  H -11.000   7.578   1.198 1.00 . A A . 48 GLY HA2  1 1 
        5  4999 1 1 48 GLY HA3  H -12.610   7.537   0.489 1.00 . A A . 48 GLY HA3  1 1 
        5  5000 1 1 48 GLY N    N -11.280   8.829  -0.428 1.00 . A A . 48 GLY N    1 1 
        5  5001 1 1 48 GLY O    O -11.600   5.251  -0.241 1.00 . A A . 48 GLY O    1 1 
        5  5002 1 1 49 SER C    C  -8.458   5.124  -2.141 1.00 . A A . 49 SER C    1 1 
        5  5003 1 1 49 SER CA   C  -9.914   5.476  -2.427 1.00 . A A . 49 SER CA   1 1 
        5  5004 1 1 49 SER CB   C -10.080   5.844  -3.898 1.00 . A A . 49 SER CB   1 1 
        5  5005 1 1 49 SER H    H -10.040   7.481  -1.765 1.00 . A A . 49 SER H    1 1 
        5  5006 1 1 49 SER HA   H -10.520   4.619  -2.211 1.00 . A A . 49 SER HA   1 1 
        5  5007 1 1 49 SER HB2  H -10.500   6.835  -3.971 1.00 . A A . 49 SER HB2  1 1 
        5  5008 1 1 49 SER HB3  H  -9.127   5.818  -4.387 1.00 . A A . 49 SER HB3  1 1 
        5  5009 1 1 49 SER HG   H -10.590   4.048  -4.494 1.00 . A A . 49 SER HG   1 1 
        5  5010 1 1 49 SER N    N -10.350   6.571  -1.575 1.00 . A A . 49 SER N    1 1 
        5  5011 1 1 49 SER O    O  -7.776   5.825  -1.393 1.00 . A A . 49 SER O    1 1 
        5  5012 1 1 49 SER OG   O -10.950   4.935  -4.552 1.00 . A A . 49 SER OG   1 1 
        5  5013 1 1 50 VAL C    C  -6.093   2.863  -3.773 1.00 . A A . 50 VAL C    1 1 
        5  5014 1 1 50 VAL CA   C  -6.615   3.589  -2.542 1.00 . A A . 50 VAL CA   1 1 
        5  5015 1 1 50 VAL CB   C  -6.486   2.663  -1.318 1.00 . A A . 50 VAL CB   1 1 
        5  5016 1 1 50 VAL CG1  C  -5.049   2.634  -0.828 1.00 . A A . 50 VAL CG1  1 1 
        5  5017 1 1 50 VAL CG2  C  -7.424   3.102  -0.202 1.00 . A A . 50 VAL CG2  1 1 
        5  5018 1 1 50 VAL H    H  -8.582   3.515  -3.320 1.00 . A A . 50 VAL H    1 1 
        5  5019 1 1 50 VAL HA   H  -6.002   4.462  -2.370 1.00 . A A . 50 VAL HA   1 1 
        5  5020 1 1 50 VAL HB   H  -6.760   1.661  -1.618 1.00 . A A . 50 VAL HB   1 1 
        5  5021 1 1 50 VAL HG11 H  -4.412   2.229  -1.600 1.00 . A A . 50 VAL HG11 1 1 
        5  5022 1 1 50 VAL HG12 H  -4.982   2.016   0.056 1.00 . A A . 50 VAL HG12 1 1 
        5  5023 1 1 50 VAL HG13 H  -4.731   3.639  -0.590 1.00 . A A . 50 VAL HG13 1 1 
        5  5024 1 1 50 VAL HG21 H  -7.263   2.484   0.669 1.00 . A A . 50 VAL HG21 1 1 
        5  5025 1 1 50 VAL HG22 H  -8.447   3.001  -0.532 1.00 . A A . 50 VAL HG22 1 1 
        5  5026 1 1 50 VAL HG23 H  -7.226   4.134   0.047 1.00 . A A . 50 VAL HG23 1 1 
        5  5027 1 1 50 VAL N    N  -7.990   4.034  -2.737 1.00 . A A . 50 VAL N    1 1 
        5  5028 1 1 50 VAL O    O  -6.789   2.036  -4.361 1.00 . A A . 50 VAL O    1 1 
        5  5029 1 1 51 TYR C    C  -2.834   2.073  -4.991 1.00 . A A . 51 TYR C    1 1 
        5  5030 1 1 51 TYR CA   C  -4.241   2.560  -5.323 1.00 . A A . 51 TYR CA   1 1 
        5  5031 1 1 51 TYR CB   C  -4.195   3.546  -6.493 1.00 . A A . 51 TYR CB   1 1 
        5  5032 1 1 51 TYR CD1  C  -1.938   4.675  -6.493 1.00 . A A . 51 TYR CD1  1 1 
        5  5033 1 1 51 TYR CD2  C  -3.828   5.936  -5.768 1.00 . A A . 51 TYR CD2  1 1 
        5  5034 1 1 51 TYR CE1  C  -1.120   5.766  -6.269 1.00 . A A . 51 TYR CE1  1 1 
        5  5035 1 1 51 TYR CE2  C  -3.017   7.031  -5.543 1.00 . A A . 51 TYR CE2  1 1 
        5  5036 1 1 51 TYR CG   C  -3.304   4.741  -6.246 1.00 . A A . 51 TYR CG   1 1 
        5  5037 1 1 51 TYR CZ   C  -1.664   6.942  -5.795 1.00 . A A . 51 TYR CZ   1 1 
        5  5038 1 1 51 TYR H    H  -4.358   3.850  -3.649 1.00 . A A . 51 TYR H    1 1 
        5  5039 1 1 51 TYR HA   H  -4.844   1.709  -5.604 1.00 . A A . 51 TYR HA   1 1 
        5  5040 1 1 51 TYR HB2  H  -3.829   3.034  -7.370 1.00 . A A . 51 TYR HB2  1 1 
        5  5041 1 1 51 TYR HB3  H  -5.194   3.909  -6.685 1.00 . A A . 51 TYR HB3  1 1 
        5  5042 1 1 51 TYR HD1  H  -1.515   3.755  -6.864 1.00 . A A . 51 TYR HD1  1 1 
        5  5043 1 1 51 TYR HD2  H  -4.888   6.003  -5.572 1.00 . A A . 51 TYR HD2  1 1 
        5  5044 1 1 51 TYR HE1  H  -0.061   5.696  -6.466 1.00 . A A . 51 TYR HE1  1 1 
        5  5045 1 1 51 TYR HE2  H  -3.443   7.951  -5.171 1.00 . A A . 51 TYR HE2  1 1 
        5  5046 1 1 51 TYR HH   H  -1.035   8.393  -4.700 1.00 . A A . 51 TYR HH   1 1 
        5  5047 1 1 51 TYR N    N  -4.862   3.181  -4.159 1.00 . A A . 51 TYR N    1 1 
        5  5048 1 1 51 TYR O    O  -2.012   2.827  -4.471 1.00 . A A . 51 TYR O    1 1 
        5  5049 1 1 51 TYR OH   O  -0.852   8.030  -5.571 1.00 . A A . 51 TYR OH   1 1 
        5  5050 1 1 52 ALA C    C  -0.359   0.306  -6.252 1.00 . A A . 52 ALA C    1 1 
        5  5051 1 1 52 ALA CA   C  -1.259   0.219  -5.026 1.00 . A A . 52 ALA CA   1 1 
        5  5052 1 1 52 ALA CB   C  -1.418  -1.227  -4.581 1.00 . A A . 52 ALA CB   1 1 
        5  5053 1 1 52 ALA H    H  -3.262   0.258  -5.705 1.00 . A A . 52 ALA H    1 1 
        5  5054 1 1 52 ALA HA   H  -0.803   0.773  -4.217 1.00 . A A . 52 ALA HA   1 1 
        5  5055 1 1 52 ALA HB1  H  -1.298  -1.289  -3.509 1.00 . A A . 52 ALA HB1  1 1 
        5  5056 1 1 52 ALA HB2  H  -0.667  -1.837  -5.060 1.00 . A A . 52 ALA HB2  1 1 
        5  5057 1 1 52 ALA HB3  H  -2.399  -1.583  -4.853 1.00 . A A . 52 ALA HB3  1 1 
        5  5058 1 1 52 ALA N    N  -2.565   0.808  -5.293 1.00 . A A . 52 ALA N    1 1 
        5  5059 1 1 52 ALA O    O  -0.598  -0.362  -7.259 1.00 . A A . 52 ALA O    1 1 
        5  5060 1 1 53 GLU C    C   2.929   0.584  -6.987 1.00 . A A . 53 GLU C    1 1 
        5  5061 1 1 53 GLU CA   C   1.614   1.307  -7.266 1.00 . A A . 53 GLU CA   1 1 
        5  5062 1 1 53 GLU CB   C   1.876   2.796  -7.514 1.00 . A A . 53 GLU CB   1 1 
        5  5063 1 1 53 GLU CD   C   1.763   3.938  -5.258 1.00 . A A . 53 GLU CD   1 1 
        5  5064 1 1 53 GLU CG   C   2.653   3.479  -6.398 1.00 . A A . 53 GLU CG   1 1 
        5  5065 1 1 53 GLU H    H   0.814   1.639  -5.333 1.00 . A A . 53 GLU H    1 1 
        5  5066 1 1 53 GLU HA   H   1.165   0.880  -8.150 1.00 . A A . 53 GLU HA   1 1 
        5  5067 1 1 53 GLU HB2  H   2.436   2.903  -8.430 1.00 . A A . 53 GLU HB2  1 1 
        5  5068 1 1 53 GLU HB3  H   0.927   3.303  -7.623 1.00 . A A . 53 GLU HB3  1 1 
        5  5069 1 1 53 GLU HG2  H   3.381   2.785  -6.008 1.00 . A A . 53 GLU HG2  1 1 
        5  5070 1 1 53 GLU HG3  H   3.162   4.340  -6.808 1.00 . A A . 53 GLU HG3  1 1 
        5  5071 1 1 53 GLU N    N   0.677   1.133  -6.162 1.00 . A A . 53 GLU N    1 1 
        5  5072 1 1 53 GLU O    O   3.224   0.234  -5.845 1.00 . A A . 53 GLU O    1 1 
        5  5073 1 1 53 GLU OE1  O   0.539   3.700  -5.326 1.00 . A A . 53 GLU OE1  1 1 
        5  5074 1 1 53 GLU OE2  O   2.292   4.537  -4.298 1.00 . A A . 53 GLU OE2  1 1 
        5  5075 1 1 54 GLU C    C   6.139   0.696  -7.826 1.00 . A A . 54 GLU C    1 1 
        5  5076 1 1 54 GLU CA   C   4.997  -0.311  -7.903 1.00 . A A . 54 GLU CA   1 1 
        5  5077 1 1 54 GLU CB   C   5.220  -1.262  -9.080 1.00 . A A . 54 GLU CB   1 1 
        5  5078 1 1 54 GLU CD   C   5.054  -3.772  -8.821 1.00 . A A . 54 GLU CD   1 1 
        5  5079 1 1 54 GLU CG   C   5.938  -2.546  -8.695 1.00 . A A . 54 GLU CG   1 1 
        5  5080 1 1 54 GLU H    H   3.423   0.674  -8.921 1.00 . A A . 54 GLU H    1 1 
        5  5081 1 1 54 GLU HA   H   4.975  -0.884  -6.989 1.00 . A A . 54 GLU HA   1 1 
        5  5082 1 1 54 GLU HB2  H   4.262  -1.524  -9.504 1.00 . A A . 54 GLU HB2  1 1 
        5  5083 1 1 54 GLU HB3  H   5.810  -0.758  -9.831 1.00 . A A . 54 GLU HB3  1 1 
        5  5084 1 1 54 GLU HG2  H   6.795  -2.671  -9.340 1.00 . A A . 54 GLU HG2  1 1 
        5  5085 1 1 54 GLU HG3  H   6.271  -2.463  -7.670 1.00 . A A . 54 GLU HG3  1 1 
        5  5086 1 1 54 GLU N    N   3.714   0.368  -8.037 1.00 . A A . 54 GLU N    1 1 
        5  5087 1 1 54 GLU O    O   6.357   1.476  -8.753 1.00 . A A . 54 GLU O    1 1 
        5  5088 1 1 54 GLU OE1  O   4.182  -3.785  -9.715 1.00 . A A . 54 GLU OE1  1 1 
        5  5089 1 1 54 GLU OE2  O   5.236  -4.718  -8.028 1.00 . A A . 54 GLU OE2  1 1 
        5  5090 1 1 55 VAL C    C   9.248   1.053  -7.178 1.00 . A A . 55 VAL C    1 1 
        5  5091 1 1 55 VAL CA   C   7.983   1.584  -6.511 1.00 . A A . 55 VAL CA   1 1 
        5  5092 1 1 55 VAL CB   C   8.255   1.810  -5.010 1.00 . A A . 55 VAL CB   1 1 
        5  5093 1 1 55 VAL CG1  C   8.585   0.497  -4.320 1.00 . A A . 55 VAL CG1  1 1 
        5  5094 1 1 55 VAL CG2  C   9.375   2.822  -4.812 1.00 . A A . 55 VAL CG2  1 1 
        5  5095 1 1 55 VAL H    H   6.640   0.029  -6.009 1.00 . A A . 55 VAL H    1 1 
        5  5096 1 1 55 VAL HA   H   7.724   2.533  -6.955 1.00 . A A . 55 VAL HA   1 1 
        5  5097 1 1 55 VAL HB   H   7.358   2.209  -4.560 1.00 . A A . 55 VAL HB   1 1 
        5  5098 1 1 55 VAL HG11 H   9.319   0.670  -3.547 1.00 . A A . 55 VAL HG11 1 1 
        5  5099 1 1 55 VAL HG12 H   8.980  -0.202  -5.042 1.00 . A A . 55 VAL HG12 1 1 
        5  5100 1 1 55 VAL HG13 H   7.688   0.088  -3.878 1.00 . A A . 55 VAL HG13 1 1 
        5  5101 1 1 55 VAL HG21 H   9.235   3.333  -3.871 1.00 . A A . 55 VAL HG21 1 1 
        5  5102 1 1 55 VAL HG22 H   9.357   3.541  -5.619 1.00 . A A . 55 VAL HG22 1 1 
        5  5103 1 1 55 VAL HG23 H  10.325   2.309  -4.808 1.00 . A A . 55 VAL HG23 1 1 
        5  5104 1 1 55 VAL N    N   6.863   0.674  -6.712 1.00 . A A . 55 VAL N    1 1 
        5  5105 1 1 55 VAL O    O   9.467  -0.157  -7.244 1.00 . A A . 55 VAL O    1 1 
        5  5106 1 1 56 LYS C    C  12.531   1.943  -7.469 1.00 . A A . 56 LYS C    1 1 
        5  5107 1 1 56 LYS CA   C  11.322   1.591  -8.335 1.00 . A A . 56 LYS CA   1 1 
        5  5108 1 1 56 LYS CB   C  11.430   2.293  -9.690 1.00 . A A . 56 LYS CB   1 1 
        5  5109 1 1 56 LYS CD   C  10.717   4.472 -10.721 1.00 . A A . 56 LYS CD   1 1 
        5  5110 1 1 56 LYS CE   C  10.163   5.824 -10.303 1.00 . A A . 56 LYS CE   1 1 
        5  5111 1 1 56 LYS CG   C  11.484   3.809  -9.588 1.00 . A A . 56 LYS CG   1 1 
        5  5112 1 1 56 LYS H    H   9.849   2.915  -7.588 1.00 . A A . 56 LYS H    1 1 
        5  5113 1 1 56 LYS HA   H  11.302   0.523  -8.495 1.00 . A A . 56 LYS HA   1 1 
        5  5114 1 1 56 LYS HB2  H  12.328   1.955 -10.187 1.00 . A A . 56 LYS HB2  1 1 
        5  5115 1 1 56 LYS HB3  H  10.574   2.024 -10.291 1.00 . A A . 56 LYS HB3  1 1 
        5  5116 1 1 56 LYS HD2  H  11.382   4.611 -11.559 1.00 . A A . 56 LYS HD2  1 1 
        5  5117 1 1 56 LYS HD3  H   9.898   3.830 -11.012 1.00 . A A . 56 LYS HD3  1 1 
        5  5118 1 1 56 LYS HE2  H   9.326   6.069 -10.941 1.00 . A A . 56 LYS HE2  1 1 
        5  5119 1 1 56 LYS HE3  H   9.826   5.761  -9.279 1.00 . A A . 56 LYS HE3  1 1 
        5  5120 1 1 56 LYS HG2  H  11.050   4.113  -8.647 1.00 . A A . 56 LYS HG2  1 1 
        5  5121 1 1 56 LYS HG3  H  12.515   4.126  -9.630 1.00 . A A . 56 LYS HG3  1 1 
        5  5122 1 1 56 LYS HZ1  H  11.263   7.220 -11.400 1.00 . A A . 56 LYS HZ1  1 1 
        5  5123 1 1 56 LYS HZ2  H  12.111   6.547 -10.100 1.00 . A A . 56 LYS HZ2  1 1 
        5  5124 1 1 56 LYS HZ3  H  10.915   7.712  -9.819 1.00 . A A . 56 LYS HZ3  1 1 
        5  5125 1 1 56 LYS N    N  10.078   1.966  -7.671 1.00 . A A . 56 LYS N    1 1 
        5  5126 1 1 56 LYS NZ   N  11.184   6.901 -10.413 1.00 . A A . 56 LYS NZ   1 1 
        5  5127 1 1 56 LYS O    O  12.877   3.116  -7.328 1.00 . A A . 56 LYS O    1 1 
        5  5128 1 1 57 PRO C    C  15.565   1.668  -6.816 1.00 . A A . 57 PRO C    1 1 
        5  5129 1 1 57 PRO CA   C  14.367   1.156  -6.024 1.00 . A A . 57 PRO CA   1 1 
        5  5130 1 1 57 PRO CB   C  14.662  -0.230  -5.444 1.00 . A A . 57 PRO CB   1 1 
        5  5131 1 1 57 PRO CD   C  12.856  -0.498  -6.986 1.00 . A A . 57 PRO CD   1 1 
        5  5132 1 1 57 PRO CG   C  14.068  -1.186  -6.420 1.00 . A A . 57 PRO CG   1 1 
        5  5133 1 1 57 PRO HA   H  14.147   1.844  -5.222 1.00 . A A . 57 PRO HA   1 1 
        5  5134 1 1 57 PRO HB2  H  15.730  -0.367  -5.357 1.00 . A A . 57 PRO HB2  1 1 
        5  5135 1 1 57 PRO HB3  H  14.200  -0.323  -4.472 1.00 . A A . 57 PRO HB3  1 1 
        5  5136 1 1 57 PRO HD2  H  12.710  -0.782  -8.019 1.00 . A A . 57 PRO HD2  1 1 
        5  5137 1 1 57 PRO HD3  H  11.980  -0.735  -6.399 1.00 . A A . 57 PRO HD3  1 1 
        5  5138 1 1 57 PRO HG2  H  14.779  -1.398  -7.205 1.00 . A A . 57 PRO HG2  1 1 
        5  5139 1 1 57 PRO HG3  H  13.781  -2.095  -5.917 1.00 . A A . 57 PRO HG3  1 1 
        5  5140 1 1 57 PRO N    N  13.194   0.933  -6.875 1.00 . A A . 57 PRO N    1 1 
        5  5141 1 1 57 PRO O    O  15.788   1.265  -7.956 1.00 . A A . 57 PRO O    1 1 
        5  5142 1 1 58 ASP C    C  18.792   2.498  -6.309 1.00 . A A . 58 ASP C    1 1 
        5  5143 1 1 58 ASP CA   C  17.511   3.131  -6.849 1.00 . A A . 58 ASP CA   1 1 
        5  5144 1 1 58 ASP CB   C  17.549   4.647  -6.639 1.00 . A A . 58 ASP CB   1 1 
        5  5145 1 1 58 ASP CG   C  17.849   5.399  -7.921 1.00 . A A . 58 ASP CG   1 1 
        5  5146 1 1 58 ASP H    H  16.106   2.846  -5.292 1.00 . A A . 58 ASP H    1 1 
        5  5147 1 1 58 ASP HA   H  17.439   2.926  -7.906 1.00 . A A . 58 ASP HA   1 1 
        5  5148 1 1 58 ASP HB2  H  16.588   4.977  -6.267 1.00 . A A . 58 ASP HB2  1 1 
        5  5149 1 1 58 ASP HB3  H  18.316   4.886  -5.914 1.00 . A A . 58 ASP HB3  1 1 
        5  5150 1 1 58 ASP N    N  16.335   2.561  -6.201 1.00 . A A . 58 ASP N    1 1 
        5  5151 1 1 58 ASP O    O  19.345   2.955  -5.309 1.00 . A A . 58 ASP O    1 1 
        5  5152 1 1 58 ASP OD1  O  18.545   4.836  -8.791 1.00 . A A . 58 ASP OD1  1 1 
        5  5153 1 1 58 ASP OD2  O  17.389   6.554  -8.052 1.00 . A A . 58 ASP OD2  1 1 
        5  5154 1 1 59 PRO C    C  21.753   1.601  -6.738 1.00 . A A . 59 PRO C    1 1 
        5  5155 1 1 59 PRO CA   C  20.506   0.741  -6.543 1.00 . A A . 59 PRO CA   1 1 
        5  5156 1 1 59 PRO CB   C  20.557  -0.491  -7.450 1.00 . A A . 59 PRO CB   1 1 
        5  5157 1 1 59 PRO CD   C  18.690   0.819  -8.170 1.00 . A A . 59 PRO CD   1 1 
        5  5158 1 1 59 PRO CG   C  19.772  -0.106  -8.657 1.00 . A A . 59 PRO CG   1 1 
        5  5159 1 1 59 PRO HA   H  20.447   0.429  -5.511 1.00 . A A . 59 PRO HA   1 1 
        5  5160 1 1 59 PRO HB2  H  21.583  -0.715  -7.702 1.00 . A A . 59 PRO HB2  1 1 
        5  5161 1 1 59 PRO HB3  H  20.112  -1.333  -6.945 1.00 . A A . 59 PRO HB3  1 1 
        5  5162 1 1 59 PRO HD2  H  18.470   1.568  -8.915 1.00 . A A . 59 PRO HD2  1 1 
        5  5163 1 1 59 PRO HD3  H  17.801   0.260  -7.919 1.00 . A A . 59 PRO HD3  1 1 
        5  5164 1 1 59 PRO HG2  H  20.410   0.404  -9.364 1.00 . A A . 59 PRO HG2  1 1 
        5  5165 1 1 59 PRO HG3  H  19.338  -0.985  -9.109 1.00 . A A . 59 PRO HG3  1 1 
        5  5166 1 1 59 PRO N    N  19.285   1.431  -6.966 1.00 . A A . 59 PRO N    1 1 
        5  5167 1 1 59 PRO O    O  22.605   1.298  -7.574 1.00 . A A . 59 PRO O    1 1 
        5  5168 1 1 60 SER C    C  24.210   2.985  -5.349 1.00 . A A . 60 SER C    1 1 
        5  5169 1 1 60 SER CA   C  22.991   3.579  -6.047 1.00 . A A . 60 SER CA   1 1 
        5  5170 1 1 60 SER CB   C  22.642   4.933  -5.427 1.00 . A A . 60 SER CB   1 1 
        5  5171 1 1 60 SER H    H  21.138   2.862  -5.314 1.00 . A A . 60 SER H    1 1 
        5  5172 1 1 60 SER HA   H  23.224   3.719  -7.092 1.00 . A A . 60 SER HA   1 1 
        5  5173 1 1 60 SER HB2  H  21.788   5.351  -5.939 1.00 . A A . 60 SER HB2  1 1 
        5  5174 1 1 60 SER HB3  H  22.406   4.798  -4.383 1.00 . A A . 60 SER HB3  1 1 
        5  5175 1 1 60 SER HG   H  23.429   6.644  -5.965 1.00 . A A . 60 SER HG   1 1 
        5  5176 1 1 60 SER N    N  21.850   2.674  -5.961 1.00 . A A . 60 SER N    1 1 
        5  5177 1 1 60 SER O    O  25.297   2.924  -5.923 1.00 . A A . 60 SER O    1 1 
        5  5178 1 1 60 SER OG   O  23.727   5.838  -5.536 1.00 . A A . 60 SER OG   1 1 
        5  5179 1 1 61 ASN C    C  24.917   0.457  -3.184 1.00 . A A . 61 ASN C    1 1 
        5  5180 1 1 61 ASN CA   C  25.108   1.963  -3.330 1.00 . A A . 61 ASN CA   1 1 
        5  5181 1 1 61 ASN CB   C  25.185   2.615  -1.948 1.00 . A A . 61 ASN CB   1 1 
        5  5182 1 1 61 ASN CG   C  25.815   3.993  -1.994 1.00 . A A . 61 ASN CG   1 1 
        5  5183 1 1 61 ASN H    H  23.133   2.626  -3.702 1.00 . A A . 61 ASN H    1 1 
        5  5184 1 1 61 ASN HA   H  26.031   2.147  -3.858 1.00 . A A . 61 ASN HA   1 1 
        5  5185 1 1 61 ASN HB2  H  24.187   2.710  -1.545 1.00 . A A . 61 ASN HB2  1 1 
        5  5186 1 1 61 ASN HB3  H  25.775   1.990  -1.295 1.00 . A A . 61 ASN HB3  1 1 
        5  5187 1 1 61 ASN HD21 H  25.251   4.337  -0.116 1.00 . A A . 61 ASN HD21 1 1 
        5  5188 1 1 61 ASN HD22 H  26.121   5.623  -0.893 1.00 . A A . 61 ASN HD22 1 1 
        5  5189 1 1 61 ASN N    N  24.022   2.550  -4.106 1.00 . A A . 61 ASN N    1 1 
        5  5190 1 1 61 ASN ND2  N  25.720   4.725  -0.891 1.00 . A A . 61 ASN ND2  1 1 
        5  5191 1 1 61 ASN O    O  23.937  -0.002  -2.598 1.00 . A A . 61 ASN O    1 1 
        5  5192 1 1 61 ASN OD1  O  26.384   4.396  -3.010 1.00 . A A . 61 ASN OD1  1 1 
        5  5193 1 1 62 LYS C    C  26.805  -2.303  -2.634 1.00 . A A . 62 LYS C    1 1 
        5  5194 1 1 62 LYS CA   C  25.800  -1.764  -3.648 1.00 . A A . 62 LYS CA   1 1 
        5  5195 1 1 62 LYS CB   C  26.066  -2.377  -5.024 1.00 . A A . 62 LYS CB   1 1 
        5  5196 1 1 62 LYS CD   C  24.884  -4.078  -6.450 1.00 . A A . 62 LYS CD   1 1 
        5  5197 1 1 62 LYS CE   C  25.907  -4.097  -7.575 1.00 . A A . 62 LYS CE   1 1 
        5  5198 1 1 62 LYS CG   C  24.797  -2.709  -5.796 1.00 . A A . 62 LYS CG   1 1 
        5  5199 1 1 62 LYS H    H  26.622   0.115  -4.173 1.00 . A A . 62 LYS H    1 1 
        5  5200 1 1 62 LYS HA   H  24.805  -2.035  -3.329 1.00 . A A . 62 LYS HA   1 1 
        5  5201 1 1 62 LYS HB2  H  26.644  -1.678  -5.611 1.00 . A A . 62 LYS HB2  1 1 
        5  5202 1 1 62 LYS HB3  H  26.634  -3.286  -4.898 1.00 . A A . 62 LYS HB3  1 1 
        5  5203 1 1 62 LYS HD2  H  25.171  -4.805  -5.705 1.00 . A A . 62 LYS HD2  1 1 
        5  5204 1 1 62 LYS HD3  H  23.914  -4.336  -6.852 1.00 . A A . 62 LYS HD3  1 1 
        5  5205 1 1 62 LYS HE2  H  25.482  -4.616  -8.422 1.00 . A A . 62 LYS HE2  1 1 
        5  5206 1 1 62 LYS HE3  H  26.132  -3.079  -7.856 1.00 . A A . 62 LYS HE3  1 1 
        5  5207 1 1 62 LYS HG2  H  23.960  -2.701  -5.114 1.00 . A A . 62 LYS HG2  1 1 
        5  5208 1 1 62 LYS HG3  H  24.647  -1.962  -6.562 1.00 . A A . 62 LYS HG3  1 1 
        5  5209 1 1 62 LYS HZ1  H  27.813  -4.846  -7.982 1.00 . A A . 62 LYS HZ1  1 1 
        5  5210 1 1 62 LYS HZ2  H  26.958  -5.740  -6.829 1.00 . A A . 62 LYS HZ2  1 1 
        5  5211 1 1 62 LYS HZ3  H  27.633  -4.247  -6.410 1.00 . A A . 62 LYS HZ3  1 1 
        5  5212 1 1 62 LYS N    N  25.863  -0.308  -3.719 1.00 . A A . 62 LYS N    1 1 
        5  5213 1 1 62 LYS NZ   N  27.165  -4.781  -7.171 1.00 . A A . 62 LYS NZ   1 1 
        5  5214 1 1 62 LYS O    O  26.428  -2.945  -1.653 1.00 . A A . 62 LYS O    1 1 
        5  5215 1 1 63 LYS C    C  30.114  -1.369  -1.667 1.00 . A A . 63 LYS C    1 1 
        5  5216 1 1 63 LYS CA   C  29.144  -2.500  -1.989 1.00 . A A . 63 LYS CA   1 1 
        5  5217 1 1 63 LYS CB   C  29.899  -3.669  -2.625 1.00 . A A . 63 LYS CB   1 1 
        5  5218 1 1 63 LYS CD   C  28.189  -5.279  -3.523 1.00 . A A . 63 LYS CD   1 1 
        5  5219 1 1 63 LYS CE   C  28.318  -6.689  -4.077 1.00 . A A . 63 LYS CE   1 1 
        5  5220 1 1 63 LYS CG   C  29.215  -5.012  -2.431 1.00 . A A . 63 LYS CG   1 1 
        5  5221 1 1 63 LYS H    H  28.322  -1.525  -3.678 1.00 . A A . 63 LYS H    1 1 
        5  5222 1 1 63 LYS HA   H  28.684  -2.836  -1.073 1.00 . A A . 63 LYS HA   1 1 
        5  5223 1 1 63 LYS HB2  H  29.995  -3.487  -3.684 1.00 . A A . 63 LYS HB2  1 1 
        5  5224 1 1 63 LYS HB3  H  30.885  -3.726  -2.187 1.00 . A A . 63 LYS HB3  1 1 
        5  5225 1 1 63 LYS HD2  H  27.199  -5.154  -3.112 1.00 . A A . 63 LYS HD2  1 1 
        5  5226 1 1 63 LYS HD3  H  28.341  -4.570  -4.326 1.00 . A A . 63 LYS HD3  1 1 
        5  5227 1 1 63 LYS HE2  H  28.598  -7.354  -3.273 1.00 . A A . 63 LYS HE2  1 1 
        5  5228 1 1 63 LYS HE3  H  27.363  -6.992  -4.478 1.00 . A A . 63 LYS HE3  1 1 
        5  5229 1 1 63 LYS HG2  H  29.961  -5.792  -2.453 1.00 . A A . 63 LYS HG2  1 1 
        5  5230 1 1 63 LYS HG3  H  28.716  -5.017  -1.474 1.00 . A A . 63 LYS HG3  1 1 
        5  5231 1 1 63 LYS HZ1  H  29.046  -6.210  -5.976 1.00 . A A . 63 LYS HZ1  1 1 
        5  5232 1 1 63 LYS HZ2  H  29.472  -7.760  -5.449 1.00 . A A . 63 LYS HZ2  1 1 
        5  5233 1 1 63 LYS HZ3  H  30.254  -6.405  -4.808 1.00 . A A . 63 LYS HZ3  1 1 
        5  5234 1 1 63 LYS N    N  28.084  -2.040  -2.879 1.00 . A A . 63 LYS N    1 1 
        5  5235 1 1 63 LYS NZ   N  29.344  -6.772  -5.152 1.00 . A A . 63 LYS NZ   1 1 
        5  5236 1 1 63 LYS O    O  30.244  -0.413  -2.433 1.00 . A A . 63 LYS O    1 1 
        5  5237 1 1 64 THR C    C  32.856  -1.083   0.744 1.00 . A A . 64 THR C    1 1 
        5  5238 1 1 64 THR CA   C  31.751  -0.467  -0.108 1.00 . A A . 64 THR CA   1 1 
        5  5239 1 1 64 THR CB   C  31.043   0.639   0.675 1.00 . A A . 64 THR CB   1 1 
        5  5240 1 1 64 THR CG2  C  30.254   0.123   1.859 1.00 . A A . 64 THR CG2  1 1 
        5  5241 1 1 64 THR H    H  30.645  -2.267   0.038 1.00 . A A . 64 THR H    1 1 
        5  5242 1 1 64 THR HA   H  32.192  -0.040  -0.996 1.00 . A A . 64 THR HA   1 1 
        5  5243 1 1 64 THR HB   H  30.354   1.149   0.017 1.00 . A A . 64 THR HB   1 1 
        5  5244 1 1 64 THR HG1  H  31.508   2.329   1.549 1.00 . A A . 64 THR HG1  1 1 
        5  5245 1 1 64 THR HG21 H  29.966  -0.902   1.681 1.00 . A A . 64 THR HG21 1 1 
        5  5246 1 1 64 THR HG22 H  29.368   0.727   1.993 1.00 . A A . 64 THR HG22 1 1 
        5  5247 1 1 64 THR HG23 H  30.863   0.176   2.750 1.00 . A A . 64 THR HG23 1 1 
        5  5248 1 1 64 THR N    N  30.793  -1.482  -0.531 1.00 . A A . 64 THR N    1 1 
        5  5249 1 1 64 THR O    O  32.696  -1.258   1.953 1.00 . A A . 64 THR O    1 1 
        5  5250 1 1 64 THR OG1  O  31.977   1.586   1.163 1.00 . A A . 64 THR OG1  1 1 
        5  5251 1 1 65 THR C    C  36.376  -1.187   0.581 1.00 . A A . 65 THR C    1 1 
        5  5252 1 1 65 THR CA   C  35.108  -2.004   0.807 1.00 . A A . 65 THR CA   1 1 
        5  5253 1 1 65 THR CB   C  35.324  -3.443   0.339 1.00 . A A . 65 THR CB   1 1 
        5  5254 1 1 65 THR CG2  C  34.553  -4.459   1.153 1.00 . A A . 65 THR CG2  1 1 
        5  5255 1 1 65 THR H    H  34.043  -1.243  -0.857 1.00 . A A . 65 THR H    1 1 
        5  5256 1 1 65 THR HA   H  34.881  -2.007   1.863 1.00 . A A . 65 THR HA   1 1 
        5  5257 1 1 65 THR HB   H  36.376  -3.683   0.421 1.00 . A A . 65 THR HB   1 1 
        5  5258 1 1 65 THR HG1  H  35.079  -4.503  -1.289 1.00 . A A . 65 THR HG1  1 1 
        5  5259 1 1 65 THR HG21 H  35.213  -4.920   1.873 1.00 . A A . 65 THR HG21 1 1 
        5  5260 1 1 65 THR HG22 H  34.152  -5.216   0.496 1.00 . A A . 65 THR HG22 1 1 
        5  5261 1 1 65 THR HG23 H  33.744  -3.966   1.671 1.00 . A A . 65 THR HG23 1 1 
        5  5262 1 1 65 THR N    N  33.976  -1.408   0.108 1.00 . A A . 65 THR N    1 1 
        5  5263 1 1 65 THR O    O  37.480  -1.731   0.549 1.00 . A A . 65 THR O    1 1 
        5  5264 1 1 65 THR OG1  O  34.939  -3.593  -1.016 1.00 . A A . 65 THR OG1  1 1 
        5  5265 1 1 66 ALA C    C  38.166   1.184   1.474 1.00 . A A . 66 ALA C    1 1 
        5  5266 1 1 66 ALA CA   C  37.341   1.015   0.202 1.00 . A A . 66 ALA CA   1 1 
        5  5267 1 1 66 ALA CB   C  36.855   2.368  -0.297 1.00 . A A . 66 ALA CB   1 1 
        5  5268 1 1 66 ALA H    H  35.305   0.497   0.462 1.00 . A A . 66 ALA H    1 1 
        5  5269 1 1 66 ALA HA   H  37.965   0.578  -0.564 1.00 . A A . 66 ALA HA   1 1 
        5  5270 1 1 66 ALA HB1  H  35.873   2.259  -0.733 1.00 . A A . 66 ALA HB1  1 1 
        5  5271 1 1 66 ALA HB2  H  37.541   2.743  -1.043 1.00 . A A . 66 ALA HB2  1 1 
        5  5272 1 1 66 ALA HB3  H  36.806   3.060   0.529 1.00 . A A . 66 ALA HB3  1 1 
        5  5273 1 1 66 ALA N    N  36.211   0.122   0.425 1.00 . A A . 66 ALA N    1 1 
        5  5274 1 1 66 ALA O    O  39.411   1.122   1.384 1.00 . A A . 66 ALA O    1 1 
        5  5275 1 1 66 ALA OXT  O  37.560   1.378   2.549 1.00 . A A . 66 ALA OXT  1 1 
        6  5276 1 1  1 MET C    C   2.932  13.125   3.077 1.00 . A A .  1 MET C    1 1 
        6  5277 1 1  1 MET CA   C   3.627  14.068   4.054 1.00 . A A .  1 MET CA   1 1 
        6  5278 1 1  1 MET CB   C   3.796  13.388   5.414 1.00 . A A .  1 MET CB   1 1 
        6  5279 1 1  1 MET CE   C   6.082  14.736   7.242 1.00 . A A .  1 MET CE   1 1 
        6  5280 1 1  1 MET CG   C   5.145  12.714   5.595 1.00 . A A .  1 MET CG   1 1 
        6  5281 1 1  1 MET H1   H   1.848  15.051   4.368 1.00 . A A .  1 MET H1   1 1 
        6  5282 1 1  1 MET H2   H   2.974  15.903   3.392 1.00 . A A .  1 MET H2   1 1 
        6  5283 1 1  1 MET H3   H   3.212  15.797   5.088 1.00 . A A .  1 MET H3   1 1 
        6  5284 1 1  1 MET HA   H   4.600  14.326   3.662 1.00 . A A .  1 MET HA   1 1 
        6  5285 1 1  1 MET HB2  H   3.680  14.130   6.190 1.00 . A A .  1 MET HB2  1 1 
        6  5286 1 1  1 MET HB3  H   3.026  12.639   5.528 1.00 . A A .  1 MET HB3  1 1 
        6  5287 1 1  1 MET HE1  H   5.129  15.234   7.145 1.00 . A A .  1 MET HE1  1 1 
        6  5288 1 1  1 MET HE2  H   6.717  15.009   6.411 1.00 . A A .  1 MET HE2  1 1 
        6  5289 1 1  1 MET HE3  H   6.552  15.035   8.168 1.00 . A A .  1 MET HE3  1 1 
        6  5290 1 1  1 MET HG2  H   5.029  11.654   5.426 1.00 . A A .  1 MET HG2  1 1 
        6  5291 1 1  1 MET HG3  H   5.834  13.118   4.868 1.00 . A A .  1 MET HG3  1 1 
        6  5292 1 1  1 MET N    N   2.844  15.317   4.243 1.00 . A A .  1 MET N    1 1 
        6  5293 1 1  1 MET O    O   1.704  13.055   3.034 1.00 . A A .  1 MET O    1 1 
        6  5294 1 1  1 MET SD   S   5.833  12.963   7.243 1.00 . A A .  1 MET SD   1 1 
        6  5295 1 1  2 GLU C    C   2.400  10.351   2.008 1.00 . A A .  2 GLU C    1 1 
        6  5296 1 1  2 GLU CA   C   3.188  11.462   1.319 1.00 . A A .  2 GLU CA   1 1 
        6  5297 1 1  2 GLU CB   C   4.320  10.858   0.485 1.00 . A A .  2 GLU CB   1 1 
        6  5298 1 1  2 GLU CD   C   6.073  11.770  -1.090 1.00 . A A .  2 GLU CD   1 1 
        6  5299 1 1  2 GLU CG   C   4.591  11.611  -0.807 1.00 . A A .  2 GLU CG   1 1 
        6  5300 1 1  2 GLU H    H   4.698  12.501   2.377 1.00 . A A .  2 GLU H    1 1 
        6  5301 1 1  2 GLU HA   H   2.523  12.006   0.666 1.00 . A A .  2 GLU HA   1 1 
        6  5302 1 1  2 GLU HB2  H   5.225  10.857   1.074 1.00 . A A .  2 GLU HB2  1 1 
        6  5303 1 1  2 GLU HB3  H   4.064   9.838   0.235 1.00 . A A .  2 GLU HB3  1 1 
        6  5304 1 1  2 GLU HG2  H   4.141  11.070  -1.626 1.00 . A A .  2 GLU HG2  1 1 
        6  5305 1 1  2 GLU HG3  H   4.145  12.593  -0.737 1.00 . A A .  2 GLU HG3  1 1 
        6  5306 1 1  2 GLU N    N   3.727  12.401   2.295 1.00 . A A .  2 GLU N    1 1 
        6  5307 1 1  2 GLU O    O   2.798   9.854   3.061 1.00 . A A .  2 GLU O    1 1 
        6  5308 1 1  2 GLU OE1  O   6.771  10.740  -1.194 1.00 . A A .  2 GLU OE1  1 1 
        6  5309 1 1  2 GLU OE2  O   6.533  12.926  -1.206 1.00 . A A .  2 GLU OE2  1 1 
        6  5310 1 1  3 GLN C    C   0.709   7.584   1.274 1.00 . A A .  3 GLN C    1 1 
        6  5311 1 1  3 GLN CA   C   0.433   8.918   1.960 1.00 . A A .  3 GLN CA   1 1 
        6  5312 1 1  3 GLN CB   C  -1.042   9.294   1.811 1.00 . A A .  3 GLN CB   1 1 
        6  5313 1 1  3 GLN CD   C  -2.455   8.790   3.843 1.00 . A A .  3 GLN CD   1 1 
        6  5314 1 1  3 GLN CG   C  -1.663   9.837   3.086 1.00 . A A .  3 GLN CG   1 1 
        6  5315 1 1  3 GLN H    H   1.012  10.403   0.568 1.00 . A A .  3 GLN H    1 1 
        6  5316 1 1  3 GLN HA   H   0.670   8.823   3.009 1.00 . A A .  3 GLN HA   1 1 
        6  5317 1 1  3 GLN HB2  H  -1.133  10.048   1.042 1.00 . A A .  3 GLN HB2  1 1 
        6  5318 1 1  3 GLN HB3  H  -1.598   8.419   1.510 1.00 . A A .  3 GLN HB3  1 1 
        6  5319 1 1  3 GLN HE21 H  -0.827   7.657   4.021 1.00 . A A .  3 GLN HE21 1 1 
        6  5320 1 1  3 GLN HE22 H  -2.276   7.017   4.731 1.00 . A A .  3 GLN HE22 1 1 
        6  5321 1 1  3 GLN HG2  H  -0.874  10.202   3.726 1.00 . A A .  3 GLN HG2  1 1 
        6  5322 1 1  3 GLN HG3  H  -2.324  10.654   2.830 1.00 . A A .  3 GLN HG3  1 1 
        6  5323 1 1  3 GLN N    N   1.279   9.968   1.406 1.00 . A A .  3 GLN N    1 1 
        6  5324 1 1  3 GLN NE2  N  -1.785   7.713   4.238 1.00 . A A .  3 GLN NE2  1 1 
        6  5325 1 1  3 GLN O    O  -0.205   6.793   1.039 1.00 . A A .  3 GLN O    1 1 
        6  5326 1 1  3 GLN OE1  O  -3.655   8.946   4.069 1.00 . A A .  3 GLN OE1  1 1 
        6  5327 1 1  4 ARG C    C   2.817   5.059   1.315 1.00 . A A .  4 ARG C    1 1 
        6  5328 1 1  4 ARG CA   C   2.379   6.106   0.297 1.00 . A A .  4 ARG CA   1 1 
        6  5329 1 1  4 ARG CB   C   3.514   6.379  -0.691 1.00 . A A .  4 ARG CB   1 1 
        6  5330 1 1  4 ARG CD   C   4.192   8.258  -2.219 1.00 . A A .  4 ARG CD   1 1 
        6  5331 1 1  4 ARG CG   C   3.104   7.258  -1.862 1.00 . A A .  4 ARG CG   1 1 
        6  5332 1 1  4 ARG CZ   C   6.223   8.320  -3.613 1.00 . A A .  4 ARG CZ   1 1 
        6  5333 1 1  4 ARG H    H   2.657   8.014   1.173 1.00 . A A .  4 ARG H    1 1 
        6  5334 1 1  4 ARG HA   H   1.526   5.728  -0.246 1.00 . A A .  4 ARG HA   1 1 
        6  5335 1 1  4 ARG HB2  H   4.323   6.868  -0.166 1.00 . A A .  4 ARG HB2  1 1 
        6  5336 1 1  4 ARG HB3  H   3.869   5.437  -1.084 1.00 . A A .  4 ARG HB3  1 1 
        6  5337 1 1  4 ARG HD2  H   3.760   9.041  -2.824 1.00 . A A .  4 ARG HD2  1 1 
        6  5338 1 1  4 ARG HD3  H   4.585   8.685  -1.306 1.00 . A A .  4 ARG HD3  1 1 
        6  5339 1 1  4 ARG HE   H   5.326   6.656  -2.970 1.00 . A A .  4 ARG HE   1 1 
        6  5340 1 1  4 ARG HG2  H   2.911   6.631  -2.719 1.00 . A A .  4 ARG HG2  1 1 
        6  5341 1 1  4 ARG HG3  H   2.206   7.797  -1.598 1.00 . A A .  4 ARG HG3  1 1 
        6  5342 1 1  4 ARG HH11 H   5.479  10.138  -3.135 1.00 . A A .  4 ARG HH11 1 1 
        6  5343 1 1  4 ARG HH12 H   6.907  10.155  -4.113 1.00 . A A .  4 ARG HH12 1 1 
        6  5344 1 1  4 ARG HH21 H   7.206   6.676  -4.258 1.00 . A A .  4 ARG HH21 1 1 
        6  5345 1 1  4 ARG HH22 H   7.888   8.189  -4.753 1.00 . A A .  4 ARG HH22 1 1 
        6  5346 1 1  4 ARG N    N   1.976   7.342   0.958 1.00 . A A .  4 ARG N    1 1 
        6  5347 1 1  4 ARG NE   N   5.288   7.635  -2.959 1.00 . A A .  4 ARG NE   1 1 
        6  5348 1 1  4 ARG NH1  N   6.200   9.646  -3.621 1.00 . A A .  4 ARG NH1  1 1 
        6  5349 1 1  4 ARG NH2  N   7.183   7.675  -4.261 1.00 . A A .  4 ARG NH2  1 1 
        6  5350 1 1  4 ARG O    O   4.011   4.848   1.530 1.00 . A A .  4 ARG O    1 1 
        6  5351 1 1  5 ILE C    C   2.487   2.066   2.297 1.00 . A A .  5 ILE C    1 1 
        6  5352 1 1  5 ILE CA   C   2.122   3.391   2.944 1.00 . A A .  5 ILE CA   1 1 
        6  5353 1 1  5 ILE CB   C   0.906   3.171   3.868 1.00 . A A .  5 ILE CB   1 1 
        6  5354 1 1  5 ILE CD1  C  -1.206   4.505   4.335 1.00 . A A .  5 ILE CD1  1 1 
        6  5355 1 1  5 ILE CG1  C   0.305   4.512   4.263 1.00 . A A .  5 ILE CG1  1 1 
        6  5356 1 1  5 ILE CG2  C   1.306   2.381   5.105 1.00 . A A .  5 ILE CG2  1 1 
        6  5357 1 1  5 ILE H    H   0.911   4.629   1.739 1.00 . A A .  5 ILE H    1 1 
        6  5358 1 1  5 ILE HA   H   2.950   3.730   3.547 1.00 . A A .  5 ILE HA   1 1 
        6  5359 1 1  5 ILE HB   H   0.169   2.598   3.325 1.00 . A A .  5 ILE HB   1 1 
        6  5360 1 1  5 ILE HD11 H  -1.531   5.176   5.115 1.00 . A A .  5 ILE HD11 1 1 
        6  5361 1 1  5 ILE HD12 H  -1.551   3.505   4.551 1.00 . A A .  5 ILE HD12 1 1 
        6  5362 1 1  5 ILE HD13 H  -1.613   4.831   3.388 1.00 . A A .  5 ILE HD13 1 1 
        6  5363 1 1  5 ILE HG12 H   0.684   4.797   5.225 1.00 . A A .  5 ILE HG12 1 1 
        6  5364 1 1  5 ILE HG13 H   0.604   5.247   3.539 1.00 . A A .  5 ILE HG13 1 1 
        6  5365 1 1  5 ILE HG21 H   2.313   2.643   5.390 1.00 . A A .  5 ILE HG21 1 1 
        6  5366 1 1  5 ILE HG22 H   1.255   1.324   4.891 1.00 . A A .  5 ILE HG22 1 1 
        6  5367 1 1  5 ILE HG23 H   0.630   2.615   5.915 1.00 . A A .  5 ILE HG23 1 1 
        6  5368 1 1  5 ILE N    N   1.843   4.411   1.944 1.00 . A A .  5 ILE N    1 1 
        6  5369 1 1  5 ILE O    O   2.277   1.861   1.101 1.00 . A A .  5 ILE O    1 1 
        6  5370 1 1  6 THR C    C   2.270  -1.125   2.706 1.00 . A A .  6 THR C    1 1 
        6  5371 1 1  6 THR CA   C   3.437  -0.145   2.631 1.00 . A A .  6 THR CA   1 1 
        6  5372 1 1  6 THR CB   C   4.617  -0.669   3.455 1.00 . A A .  6 THR CB   1 1 
        6  5373 1 1  6 THR CG2  C   5.942  -0.573   2.731 1.00 . A A .  6 THR CG2  1 1 
        6  5374 1 1  6 THR H    H   3.168   1.414   4.043 1.00 . A A .  6 THR H    1 1 
        6  5375 1 1  6 THR HA   H   3.745  -0.049   1.601 1.00 . A A .  6 THR HA   1 1 
        6  5376 1 1  6 THR HB   H   4.445  -1.708   3.693 1.00 . A A .  6 THR HB   1 1 
        6  5377 1 1  6 THR HG1  H   5.483  -0.291   5.171 1.00 . A A .  6 THR HG1  1 1 
        6  5378 1 1  6 THR HG21 H   6.573  -1.398   3.025 1.00 . A A .  6 THR HG21 1 1 
        6  5379 1 1  6 THR HG22 H   6.424   0.359   2.986 1.00 . A A .  6 THR HG22 1 1 
        6  5380 1 1  6 THR HG23 H   5.772  -0.610   1.665 1.00 . A A .  6 THR HG23 1 1 
        6  5381 1 1  6 THR N    N   3.034   1.176   3.103 1.00 . A A .  6 THR N    1 1 
        6  5382 1 1  6 THR O    O   1.449  -1.060   3.621 1.00 . A A .  6 THR O    1 1 
        6  5383 1 1  6 THR OG1  O   4.739   0.050   4.671 1.00 . A A .  6 THR OG1  1 1 
        6  5384 1 1  7 LEU C    C   1.106  -3.853   2.974 1.00 . A A .  7 LEU C    1 1 
        6  5385 1 1  7 LEU CA   C   1.135  -3.025   1.692 1.00 . A A .  7 LEU CA   1 1 
        6  5386 1 1  7 LEU CB   C   1.312  -3.945   0.483 1.00 . A A .  7 LEU CB   1 1 
        6  5387 1 1  7 LEU CD1  C  -1.045  -4.373  -0.256 1.00 . A A .  7 LEU CD1  1 1 
        6  5388 1 1  7 LEU CD2  C   0.708  -6.125  -0.598 1.00 . A A .  7 LEU CD2  1 1 
        6  5389 1 1  7 LEU CG   C   0.221  -5.002   0.306 1.00 . A A .  7 LEU CG   1 1 
        6  5390 1 1  7 LEU H    H   2.886  -2.034   1.034 1.00 . A A .  7 LEU H    1 1 
        6  5391 1 1  7 LEU HA   H   0.198  -2.499   1.598 1.00 . A A .  7 LEU HA   1 1 
        6  5392 1 1  7 LEU HB2  H   1.339  -3.332  -0.408 1.00 . A A .  7 LEU HB2  1 1 
        6  5393 1 1  7 LEU HB3  H   2.261  -4.451   0.578 1.00 . A A .  7 LEU HB3  1 1 
        6  5394 1 1  7 LEU HD11 H  -0.829  -3.928  -1.216 1.00 . A A .  7 LEU HD11 1 1 
        6  5395 1 1  7 LEU HD12 H  -1.402  -3.614   0.422 1.00 . A A .  7 LEU HD12 1 1 
        6  5396 1 1  7 LEU HD13 H  -1.802  -5.135  -0.374 1.00 . A A .  7 LEU HD13 1 1 
        6  5397 1 1  7 LEU HD21 H   0.673  -5.798  -1.626 1.00 . A A .  7 LEU HD21 1 1 
        6  5398 1 1  7 LEU HD22 H   0.073  -6.989  -0.471 1.00 . A A .  7 LEU HD22 1 1 
        6  5399 1 1  7 LEU HD23 H   1.724  -6.382  -0.336 1.00 . A A .  7 LEU HD23 1 1 
        6  5400 1 1  7 LEU HG   H  -0.018  -5.428   1.271 1.00 . A A .  7 LEU HG   1 1 
        6  5401 1 1  7 LEU N    N   2.202  -2.032   1.737 1.00 . A A .  7 LEU N    1 1 
        6  5402 1 1  7 LEU O    O   0.038  -4.213   3.468 1.00 . A A .  7 LEU O    1 1 
        6  5403 1 1  8 LYS C    C   1.727  -4.216   5.899 1.00 . A A .  8 LYS C    1 1 
        6  5404 1 1  8 LYS CA   C   2.397  -4.932   4.731 1.00 . A A .  8 LYS CA   1 1 
        6  5405 1 1  8 LYS CB   C   3.867  -5.200   5.057 1.00 . A A .  8 LYS CB   1 1 
        6  5406 1 1  8 LYS CD   C   5.511  -6.738   6.174 1.00 . A A .  8 LYS CD   1 1 
        6  5407 1 1  8 LYS CE   C   5.832  -7.650   5.001 1.00 . A A .  8 LYS CE   1 1 
        6  5408 1 1  8 LYS CG   C   4.070  -6.259   6.128 1.00 . A A .  8 LYS CG   1 1 
        6  5409 1 1  8 LYS H    H   3.103  -3.832   3.067 1.00 . A A .  8 LYS H    1 1 
        6  5410 1 1  8 LYS HA   H   1.897  -5.875   4.567 1.00 . A A .  8 LYS HA   1 1 
        6  5411 1 1  8 LYS HB2  H   4.370  -5.526   4.159 1.00 . A A .  8 LYS HB2  1 1 
        6  5412 1 1  8 LYS HB3  H   4.321  -4.282   5.400 1.00 . A A .  8 LYS HB3  1 1 
        6  5413 1 1  8 LYS HD2  H   6.167  -5.881   6.140 1.00 . A A .  8 LYS HD2  1 1 
        6  5414 1 1  8 LYS HD3  H   5.671  -7.280   7.094 1.00 . A A .  8 LYS HD3  1 1 
        6  5415 1 1  8 LYS HE2  H   5.293  -7.302   4.132 1.00 . A A .  8 LYS HE2  1 1 
        6  5416 1 1  8 LYS HE3  H   6.894  -7.605   4.806 1.00 . A A .  8 LYS HE3  1 1 
        6  5417 1 1  8 LYS HG2  H   3.810  -5.841   7.089 1.00 . A A .  8 LYS HG2  1 1 
        6  5418 1 1  8 LYS HG3  H   3.426  -7.100   5.914 1.00 . A A .  8 LYS HG3  1 1 
        6  5419 1 1  8 LYS HZ1  H   5.438  -9.608   4.387 1.00 . A A .  8 LYS HZ1  1 1 
        6  5420 1 1  8 LYS HZ2  H   4.502  -9.100   5.701 1.00 . A A .  8 LYS HZ2  1 1 
        6  5421 1 1  8 LYS HZ3  H   6.131  -9.498   5.928 1.00 . A A .  8 LYS HZ3  1 1 
        6  5422 1 1  8 LYS N    N   2.287  -4.149   3.506 1.00 . A A .  8 LYS N    1 1 
        6  5423 1 1  8 LYS NZ   N   5.449  -9.063   5.273 1.00 . A A .  8 LYS NZ   1 1 
        6  5424 1 1  8 LYS O    O   1.209  -4.852   6.817 1.00 . A A .  8 LYS O    1 1 
        6  5425 1 1  9 ASP C    C  -0.370  -1.949   6.697 1.00 . A A .  9 ASP C    1 1 
        6  5426 1 1  9 ASP CA   C   1.134  -2.082   6.910 1.00 . A A .  9 ASP CA   1 1 
        6  5427 1 1  9 ASP CB   C   1.777  -0.695   6.956 1.00 . A A .  9 ASP CB   1 1 
        6  5428 1 1  9 ASP CG   C   3.183  -0.728   7.522 1.00 . A A .  9 ASP CG   1 1 
        6  5429 1 1  9 ASP H    H   2.167  -2.436   5.098 1.00 . A A .  9 ASP H    1 1 
        6  5430 1 1  9 ASP HA   H   1.308  -2.582   7.851 1.00 . A A .  9 ASP HA   1 1 
        6  5431 1 1  9 ASP HB2  H   1.820  -0.292   5.955 1.00 . A A .  9 ASP HB2  1 1 
        6  5432 1 1  9 ASP HB3  H   1.174  -0.046   7.576 1.00 . A A .  9 ASP HB3  1 1 
        6  5433 1 1  9 ASP N    N   1.740  -2.887   5.856 1.00 . A A .  9 ASP N    1 1 
        6  5434 1 1  9 ASP O    O  -1.157  -2.139   7.623 1.00 . A A .  9 ASP O    1 1 
        6  5435 1 1  9 ASP OD1  O   4.112  -1.116   6.780 1.00 . A A .  9 ASP OD1  1 1 
        6  5436 1 1  9 ASP OD2  O   3.356  -0.369   8.704 1.00 . A A .  9 ASP OD2  1 1 
        6  5437 1 1 10 TYR C    C  -2.951  -2.743   5.413 1.00 . A A . 10 TYR C    1 1 
        6  5438 1 1 10 TYR CA   C  -2.173  -1.460   5.135 1.00 . A A . 10 TYR CA   1 1 
        6  5439 1 1 10 TYR CB   C  -2.326  -1.066   3.665 1.00 . A A . 10 TYR CB   1 1 
        6  5440 1 1 10 TYR CD1  C  -4.822  -1.303   3.369 1.00 . A A . 10 TYR CD1  1 1 
        6  5441 1 1 10 TYR CD2  C  -3.839   0.832   2.971 1.00 . A A . 10 TYR CD2  1 1 
        6  5442 1 1 10 TYR CE1  C  -6.068  -0.791   3.061 1.00 . A A . 10 TYR CE1  1 1 
        6  5443 1 1 10 TYR CE2  C  -5.082   1.351   2.662 1.00 . A A . 10 TYR CE2  1 1 
        6  5444 1 1 10 TYR CG   C  -3.689  -0.502   3.329 1.00 . A A . 10 TYR CG   1 1 
        6  5445 1 1 10 TYR CZ   C  -6.193   0.537   2.709 1.00 . A A . 10 TYR CZ   1 1 
        6  5446 1 1 10 TYR H    H  -0.087  -1.482   4.775 1.00 . A A . 10 TYR H    1 1 
        6  5447 1 1 10 TYR HA   H  -2.572  -0.671   5.753 1.00 . A A . 10 TYR HA   1 1 
        6  5448 1 1 10 TYR HB2  H  -1.588  -0.315   3.422 1.00 . A A . 10 TYR HB2  1 1 
        6  5449 1 1 10 TYR HB3  H  -2.165  -1.937   3.047 1.00 . A A . 10 TYR HB3  1 1 
        6  5450 1 1 10 TYR HD1  H  -4.721  -2.342   3.645 1.00 . A A . 10 TYR HD1  1 1 
        6  5451 1 1 10 TYR HD2  H  -2.968   1.468   2.934 1.00 . A A . 10 TYR HD2  1 1 
        6  5452 1 1 10 TYR HE1  H  -6.939  -1.430   3.098 1.00 . A A . 10 TYR HE1  1 1 
        6  5453 1 1 10 TYR HE2  H  -5.179   2.391   2.386 1.00 . A A . 10 TYR HE2  1 1 
        6  5454 1 1 10 TYR HH   H  -7.939   0.397   1.913 1.00 . A A . 10 TYR HH   1 1 
        6  5455 1 1 10 TYR N    N  -0.763  -1.621   5.470 1.00 . A A . 10 TYR N    1 1 
        6  5456 1 1 10 TYR O    O  -4.104  -2.699   5.843 1.00 . A A . 10 TYR O    1 1 
        6  5457 1 1 10 TYR OH   O  -7.432   1.050   2.404 1.00 . A A . 10 TYR OH   1 1 
        6  5458 1 1 11 ALA C    C  -3.114  -5.461   6.875 1.00 . A A . 11 ALA C    1 1 
        6  5459 1 1 11 ALA CA   C  -2.950  -5.177   5.386 1.00 . A A . 11 ALA CA   1 1 
        6  5460 1 1 11 ALA CB   C  -2.143  -6.281   4.721 1.00 . A A . 11 ALA CB   1 1 
        6  5461 1 1 11 ALA H    H  -1.398  -3.853   4.821 1.00 . A A . 11 ALA H    1 1 
        6  5462 1 1 11 ALA HA   H  -3.927  -5.150   4.925 1.00 . A A . 11 ALA HA   1 1 
        6  5463 1 1 11 ALA HB1  H  -2.396  -7.230   5.169 1.00 . A A . 11 ALA HB1  1 1 
        6  5464 1 1 11 ALA HB2  H  -1.089  -6.088   4.858 1.00 . A A . 11 ALA HB2  1 1 
        6  5465 1 1 11 ALA HB3  H  -2.370  -6.308   3.666 1.00 . A A . 11 ALA HB3  1 1 
        6  5466 1 1 11 ALA N    N  -2.316  -3.883   5.163 1.00 . A A . 11 ALA N    1 1 
        6  5467 1 1 11 ALA O    O  -4.213  -5.764   7.342 1.00 . A A . 11 ALA O    1 1 
        6  5468 1 1 12 MET C    C  -2.784  -4.514   9.795 1.00 . A A . 12 MET C    1 1 
        6  5469 1 1 12 MET CA   C  -2.037  -5.618   9.051 1.00 . A A . 12 MET CA   1 1 
        6  5470 1 1 12 MET CB   C  -0.609  -5.740   9.588 1.00 . A A . 12 MET CB   1 1 
        6  5471 1 1 12 MET CE   C   0.976  -8.799   8.109 1.00 . A A . 12 MET CE   1 1 
        6  5472 1 1 12 MET CG   C  -0.229  -7.155   9.987 1.00 . A A . 12 MET CG   1 1 
        6  5473 1 1 12 MET H    H  -1.171  -5.126   7.188 1.00 . A A . 12 MET H    1 1 
        6  5474 1 1 12 MET HA   H  -2.550  -6.549   9.210 1.00 . A A . 12 MET HA   1 1 
        6  5475 1 1 12 MET HB2  H   0.079  -5.406   8.824 1.00 . A A . 12 MET HB2  1 1 
        6  5476 1 1 12 MET HB3  H  -0.505  -5.103  10.454 1.00 . A A . 12 MET HB3  1 1 
        6  5477 1 1 12 MET HE1  H   1.544  -8.577   7.218 1.00 . A A . 12 MET HE1  1 1 
        6  5478 1 1 12 MET HE2  H  -0.079  -8.722   7.893 1.00 . A A . 12 MET HE2  1 1 
        6  5479 1 1 12 MET HE3  H   1.204  -9.801   8.440 1.00 . A A . 12 MET HE3  1 1 
        6  5480 1 1 12 MET HG2  H  -0.240  -7.226  11.063 1.00 . A A . 12 MET HG2  1 1 
        6  5481 1 1 12 MET HG3  H  -0.958  -7.839   9.575 1.00 . A A . 12 MET HG3  1 1 
        6  5482 1 1 12 MET N    N  -2.015  -5.367   7.616 1.00 . A A . 12 MET N    1 1 
        6  5483 1 1 12 MET O    O  -3.304  -4.731  10.890 1.00 . A A . 12 MET O    1 1 
        6  5484 1 1 12 MET SD   S   1.408  -7.631   9.397 1.00 . A A . 12 MET SD   1 1 
        6  5485 1 1 13 ARG C    C  -4.971  -2.131   9.379 1.00 . A A . 13 ARG C    1 1 
        6  5486 1 1 13 ARG CA   C  -3.506  -2.191   9.800 1.00 . A A . 13 ARG CA   1 1 
        6  5487 1 1 13 ARG CB   C  -2.803  -0.891   9.409 1.00 . A A . 13 ARG CB   1 1 
        6  5488 1 1 13 ARG CD   C  -2.259   0.774  11.213 1.00 . A A . 13 ARG CD   1 1 
        6  5489 1 1 13 ARG CG   C  -3.287   0.321  10.189 1.00 . A A . 13 ARG CG   1 1 
        6  5490 1 1 13 ARG CZ   C  -2.719   3.189  11.389 1.00 . A A . 13 ARG CZ   1 1 
        6  5491 1 1 13 ARG H    H  -2.392  -3.225   8.326 1.00 . A A . 13 ARG H    1 1 
        6  5492 1 1 13 ARG HA   H  -3.456  -2.305  10.871 1.00 . A A . 13 ARG HA   1 1 
        6  5493 1 1 13 ARG HB2  H  -1.741  -1.003   9.581 1.00 . A A . 13 ARG HB2  1 1 
        6  5494 1 1 13 ARG HB3  H  -2.972  -0.707   8.356 1.00 . A A . 13 ARG HB3  1 1 
        6  5495 1 1 13 ARG HD2  H  -2.103  -0.022  11.925 1.00 . A A . 13 ARG HD2  1 1 
        6  5496 1 1 13 ARG HD3  H  -1.332   0.986  10.702 1.00 . A A . 13 ARG HD3  1 1 
        6  5497 1 1 13 ARG HE   H  -2.976   1.865  12.860 1.00 . A A . 13 ARG HE   1 1 
        6  5498 1 1 13 ARG HG2  H  -3.474   1.132   9.497 1.00 . A A . 13 ARG HG2  1 1 
        6  5499 1 1 13 ARG HG3  H  -4.205   0.062  10.702 1.00 . A A . 13 ARG HG3  1 1 
        6  5500 1 1 13 ARG HH11 H  -2.032   2.596   9.580 1.00 . A A . 13 ARG HH11 1 1 
        6  5501 1 1 13 ARG HH12 H  -2.363   4.290   9.730 1.00 . A A . 13 ARG HH12 1 1 
        6  5502 1 1 13 ARG HH21 H  -3.413   4.092  13.059 1.00 . A A . 13 ARG HH21 1 1 
        6  5503 1 1 13 ARG HH22 H  -3.145   5.138  11.705 1.00 . A A . 13 ARG HH22 1 1 
        6  5504 1 1 13 ARG N    N  -2.828  -3.334   9.196 1.00 . A A . 13 ARG N    1 1 
        6  5505 1 1 13 ARG NE   N  -2.691   1.973  11.928 1.00 . A A . 13 ARG NE   1 1 
        6  5506 1 1 13 ARG NH1  N  -2.339   3.373  10.130 1.00 . A A . 13 ARG NH1  1 1 
        6  5507 1 1 13 ARG NH2  N  -3.125   4.226  12.110 1.00 . A A . 13 ARG NH2  1 1 
        6  5508 1 1 13 ARG O    O  -5.871  -2.245  10.213 1.00 . A A . 13 ARG O    1 1 
        6  5509 1 1 14 PHE C    C  -7.068  -3.203   7.089 1.00 . A A . 14 PHE C    1 1 
        6  5510 1 1 14 PHE CA   C  -6.544  -1.843   7.549 1.00 . A A . 14 PHE CA   1 1 
        6  5511 1 1 14 PHE CB   C  -6.534  -0.865   6.385 1.00 . A A . 14 PHE CB   1 1 
        6  5512 1 1 14 PHE CD1  C  -7.269   1.370   7.255 1.00 . A A . 14 PHE CD1  1 1 
        6  5513 1 1 14 PHE CD2  C  -4.964   1.056   6.754 1.00 . A A . 14 PHE CD2  1 1 
        6  5514 1 1 14 PHE CE1  C  -7.009   2.660   7.644 1.00 . A A . 14 PHE CE1  1 1 
        6  5515 1 1 14 PHE CE2  C  -4.702   2.344   7.141 1.00 . A A . 14 PHE CE2  1 1 
        6  5516 1 1 14 PHE CG   C  -6.252   0.548   6.804 1.00 . A A . 14 PHE CG   1 1 
        6  5517 1 1 14 PHE CZ   C  -5.725   3.143   7.585 1.00 . A A . 14 PHE CZ   1 1 
        6  5518 1 1 14 PHE H    H  -4.449  -1.840   7.472 1.00 . A A . 14 PHE H    1 1 
        6  5519 1 1 14 PHE HA   H  -7.190  -1.461   8.323 1.00 . A A . 14 PHE HA   1 1 
        6  5520 1 1 14 PHE HB2  H  -5.773  -1.162   5.679 1.00 . A A . 14 PHE HB2  1 1 
        6  5521 1 1 14 PHE HB3  H  -7.489  -0.888   5.903 1.00 . A A . 14 PHE HB3  1 1 
        6  5522 1 1 14 PHE HD1  H  -8.270   0.996   7.303 1.00 . A A . 14 PHE HD1  1 1 
        6  5523 1 1 14 PHE HD2  H  -4.163   0.436   6.408 1.00 . A A . 14 PHE HD2  1 1 
        6  5524 1 1 14 PHE HE1  H  -7.811   3.292   7.994 1.00 . A A . 14 PHE HE1  1 1 
        6  5525 1 1 14 PHE HE2  H  -3.694   2.727   7.097 1.00 . A A . 14 PHE HE2  1 1 
        6  5526 1 1 14 PHE HZ   H  -5.525   4.139   7.884 1.00 . A A . 14 PHE HZ   1 1 
        6  5527 1 1 14 PHE N    N  -5.202  -1.938   8.085 1.00 . A A . 14 PHE N    1 1 
        6  5528 1 1 14 PHE O    O  -7.972  -3.277   6.258 1.00 . A A . 14 PHE O    1 1 
        6  5529 1 1 15 GLY C    C  -6.713  -5.897   5.783 1.00 . A A . 15 GLY C    1 1 
        6  5530 1 1 15 GLY CA   C  -6.930  -5.610   7.256 1.00 . A A . 15 GLY CA   1 1 
        6  5531 1 1 15 GLY H    H  -5.783  -4.164   8.289 1.00 . A A . 15 GLY H    1 1 
        6  5532 1 1 15 GLY HA2  H  -6.378  -6.332   7.838 1.00 . A A . 15 GLY HA2  1 1 
        6  5533 1 1 15 GLY HA3  H  -7.982  -5.712   7.480 1.00 . A A . 15 GLY HA3  1 1 
        6  5534 1 1 15 GLY N    N  -6.499  -4.276   7.631 1.00 . A A . 15 GLY N    1 1 
        6  5535 1 1 15 GLY O    O  -6.757  -4.991   4.953 1.00 . A A . 15 GLY O    1 1 
        6  5536 1 1 16 GLN C    C  -7.520  -7.409   3.245 1.00 . A A . 16 GLN C    1 1 
        6  5537 1 1 16 GLN CA   C  -6.250  -7.569   4.075 1.00 . A A . 16 GLN CA   1 1 
        6  5538 1 1 16 GLN CB   C  -5.769  -9.020   4.019 1.00 . A A . 16 GLN CB   1 1 
        6  5539 1 1 16 GLN CD   C  -3.914  -9.656   5.611 1.00 . A A . 16 GLN CD   1 1 
        6  5540 1 1 16 GLN CG   C  -4.270  -9.173   4.219 1.00 . A A . 16 GLN CG   1 1 
        6  5541 1 1 16 GLN H    H  -6.453  -7.842   6.165 1.00 . A A . 16 GLN H    1 1 
        6  5542 1 1 16 GLN HA   H  -5.482  -6.928   3.665 1.00 . A A . 16 GLN HA   1 1 
        6  5543 1 1 16 GLN HB2  H  -6.272  -9.584   4.790 1.00 . A A . 16 GLN HB2  1 1 
        6  5544 1 1 16 GLN HB3  H  -6.026  -9.435   3.055 1.00 . A A . 16 GLN HB3  1 1 
        6  5545 1 1 16 GLN HE21 H  -3.090 -11.302   4.851 1.00 . A A . 16 GLN HE21 1 1 
        6  5546 1 1 16 GLN HE22 H  -3.043 -11.160   6.582 1.00 . A A . 16 GLN HE22 1 1 
        6  5547 1 1 16 GLN HG2  H  -3.896  -9.885   3.500 1.00 . A A . 16 GLN HG2  1 1 
        6  5548 1 1 16 GLN HG3  H  -3.799  -8.214   4.055 1.00 . A A . 16 GLN HG3  1 1 
        6  5549 1 1 16 GLN N    N  -6.476  -7.164   5.458 1.00 . A A . 16 GLN N    1 1 
        6  5550 1 1 16 GLN NE2  N  -3.285 -10.823   5.689 1.00 . A A . 16 GLN NE2  1 1 
        6  5551 1 1 16 GLN O    O  -7.458  -7.160   2.040 1.00 . A A . 16 GLN O    1 1 
        6  5552 1 1 16 GLN OE1  O  -4.200  -8.989   6.605 1.00 . A A . 16 GLN OE1  1 1 
        6  5553 1 1 17 THR C    C -10.150  -6.013   2.678 1.00 . A A . 17 THR C    1 1 
        6  5554 1 1 17 THR CA   C  -9.953  -7.426   3.215 1.00 . A A . 17 THR CA   1 1 
        6  5555 1 1 17 THR CB   C -11.090  -7.785   4.166 1.00 . A A . 17 THR CB   1 1 
        6  5556 1 1 17 THR CG2  C -12.460  -7.734   3.512 1.00 . A A . 17 THR CG2  1 1 
        6  5557 1 1 17 THR H    H  -8.655  -7.753   4.854 1.00 . A A . 17 THR H    1 1 
        6  5558 1 1 17 THR HA   H  -9.958  -8.118   2.386 1.00 . A A . 17 THR HA   1 1 
        6  5559 1 1 17 THR HB   H -11.090  -7.086   4.990 1.00 . A A . 17 THR HB   1 1 
        6  5560 1 1 17 THR HG1  H -11.570  -9.251   5.375 1.00 . A A . 17 THR HG1  1 1 
        6  5561 1 1 17 THR HG21 H -13.210  -7.556   4.264 1.00 . A A . 17 THR HG21 1 1 
        6  5562 1 1 17 THR HG22 H -12.650  -8.675   3.018 1.00 . A A . 17 THR HG22 1 1 
        6  5563 1 1 17 THR HG23 H -12.480  -6.935   2.785 1.00 . A A . 17 THR HG23 1 1 
        6  5564 1 1 17 THR N    N  -8.670  -7.554   3.895 1.00 . A A . 17 THR N    1 1 
        6  5565 1 1 17 THR O    O -10.380  -5.818   1.486 1.00 . A A . 17 THR O    1 1 
        6  5566 1 1 17 THR OG1  O -10.920  -9.090   4.693 1.00 . A A . 17 THR OG1  1 1 
        6  5567 1 1 18 LYS C    C  -9.204  -3.228   2.116 1.00 . A A . 18 LYS C    1 1 
        6  5568 1 1 18 LYS CA   C -10.220  -3.631   3.180 1.00 . A A . 18 LYS CA   1 1 
        6  5569 1 1 18 LYS CB   C -10.080  -2.724   4.404 1.00 . A A . 18 LYS CB   1 1 
        6  5570 1 1 18 LYS CD   C -11.100  -0.831   5.706 1.00 . A A . 18 LYS CD   1 1 
        6  5571 1 1 18 LYS CE   C -10.980   0.683   5.627 1.00 . A A . 18 LYS CE   1 1 
        6  5572 1 1 18 LYS CG   C -10.940  -1.478   4.339 1.00 . A A . 18 LYS CG   1 1 
        6  5573 1 1 18 LYS H    H  -9.860  -5.246   4.502 1.00 . A A . 18 LYS H    1 1 
        6  5574 1 1 18 LYS HA   H -11.210  -3.520   2.772 1.00 . A A . 18 LYS HA   1 1 
        6  5575 1 1 18 LYS HB2  H -10.350  -3.283   5.285 1.00 . A A . 18 LYS HB2  1 1 
        6  5576 1 1 18 LYS HB3  H  -9.051  -2.415   4.492 1.00 . A A . 18 LYS HB3  1 1 
        6  5577 1 1 18 LYS HD2  H -12.070  -1.087   6.109 1.00 . A A . 18 LYS HD2  1 1 
        6  5578 1 1 18 LYS HD3  H -10.320  -1.207   6.360 1.00 . A A . 18 LYS HD3  1 1 
        6  5579 1 1 18 LYS HE2  H -10.070   0.989   6.109 1.00 . A A . 18 LYS HE2  1 1 
        6  5580 1 1 18 LYS HE3  H -10.960   0.976   4.586 1.00 . A A . 18 LYS HE3  1 1 
        6  5581 1 1 18 LYS HG2  H -10.490  -0.769   3.665 1.00 . A A . 18 LYS HG2  1 1 
        6  5582 1 1 18 LYS HG3  H -11.920  -1.752   3.968 1.00 . A A . 18 LYS HG3  1 1 
        6  5583 1 1 18 LYS HZ1  H -12.350   2.254   5.802 1.00 . A A . 18 LYS HZ1  1 1 
        6  5584 1 1 18 LYS HZ2  H -11.890   1.575   7.283 1.00 . A A . 18 LYS HZ2  1 1 
        6  5585 1 1 18 LYS HZ3  H -12.970   0.750   6.272 1.00 . A A . 18 LYS HZ3  1 1 
        6  5586 1 1 18 LYS N    N -10.050  -5.028   3.565 1.00 . A A . 18 LYS N    1 1 
        6  5587 1 1 18 LYS NZ   N -12.130   1.364   6.291 1.00 . A A . 18 LYS NZ   1 1 
        6  5588 1 1 18 LYS O    O  -9.484  -2.384   1.265 1.00 . A A . 18 LYS O    1 1 
        6  5589 1 1 19 THR C    C  -7.420  -3.846  -0.213 1.00 . A A . 19 THR C    1 1 
        6  5590 1 1 19 THR CA   C  -6.966  -3.540   1.212 1.00 . A A . 19 THR CA   1 1 
        6  5591 1 1 19 THR CB   C  -5.708  -4.344   1.542 1.00 . A A . 19 THR CB   1 1 
        6  5592 1 1 19 THR CG2  C  -4.467  -3.822   0.853 1.00 . A A . 19 THR CG2  1 1 
        6  5593 1 1 19 THR H    H  -7.861  -4.501   2.873 1.00 . A A . 19 THR H    1 1 
        6  5594 1 1 19 THR HA   H  -6.739  -2.487   1.286 1.00 . A A . 19 THR HA   1 1 
        6  5595 1 1 19 THR HB   H  -5.855  -5.368   1.228 1.00 . A A . 19 THR HB   1 1 
        6  5596 1 1 19 THR HG1  H  -5.991  -5.018   3.359 1.00 . A A . 19 THR HG1  1 1 
        6  5597 1 1 19 THR HG21 H  -4.280  -4.400  -0.041 1.00 . A A . 19 THR HG21 1 1 
        6  5598 1 1 19 THR HG22 H  -3.621  -3.909   1.519 1.00 . A A . 19 THR HG22 1 1 
        6  5599 1 1 19 THR HG23 H  -4.611  -2.786   0.587 1.00 . A A . 19 THR HG23 1 1 
        6  5600 1 1 19 THR N    N  -8.023  -3.837   2.171 1.00 . A A . 19 THR N    1 1 
        6  5601 1 1 19 THR O    O  -7.234  -3.036  -1.121 1.00 . A A . 19 THR O    1 1 
        6  5602 1 1 19 THR OG1  O  -5.461  -4.338   2.936 1.00 . A A . 19 THR OG1  1 1 
        6  5603 1 1 20 ALA C    C  -9.759  -4.676  -2.104 1.00 . A A . 20 ALA C    1 1 
        6  5604 1 1 20 ALA CA   C  -8.493  -5.432  -1.714 1.00 . A A . 20 ALA CA   1 1 
        6  5605 1 1 20 ALA CB   C  -8.745  -6.933  -1.734 1.00 . A A . 20 ALA CB   1 1 
        6  5606 1 1 20 ALA H    H  -8.132  -5.623   0.363 1.00 . A A . 20 ALA H    1 1 
        6  5607 1 1 20 ALA HA   H  -7.718  -5.213  -2.434 1.00 . A A . 20 ALA HA   1 1 
        6  5608 1 1 20 ALA HB1  H  -8.441  -7.337  -2.688 1.00 . A A . 20 ALA HB1  1 1 
        6  5609 1 1 20 ALA HB2  H  -9.798  -7.122  -1.583 1.00 . A A . 20 ALA HB2  1 1 
        6  5610 1 1 20 ALA HB3  H  -8.179  -7.404  -0.946 1.00 . A A . 20 ALA HB3  1 1 
        6  5611 1 1 20 ALA N    N  -8.014  -5.020  -0.400 1.00 . A A . 20 ALA N    1 1 
        6  5612 1 1 20 ALA O    O -10.020  -4.462  -3.287 1.00 . A A . 20 ALA O    1 1 
        6  5613 1 1 21 LYS C    C -11.480  -2.096  -1.736 1.00 . A A . 21 LYS C    1 1 
        6  5614 1 1 21 LYS CA   C -11.770  -3.542  -1.344 1.00 . A A . 21 LYS CA   1 1 
        6  5615 1 1 21 LYS CB   C -12.660  -3.580  -0.101 1.00 . A A . 21 LYS CB   1 1 
        6  5616 1 1 21 LYS CD   C -14.610  -2.331   0.878 1.00 . A A . 21 LYS CD   1 1 
        6  5617 1 1 21 LYS CE   C -16.120  -2.203   0.824 1.00 . A A . 21 LYS CE   1 1 
        6  5618 1 1 21 LYS CG   C -14.070  -3.056  -0.342 1.00 . A A . 21 LYS CG   1 1 
        6  5619 1 1 21 LYS H    H -10.270  -4.475  -0.181 1.00 . A A . 21 LYS H    1 1 
        6  5620 1 1 21 LYS HA   H -12.290  -4.027  -2.158 1.00 . A A . 21 LYS HA   1 1 
        6  5621 1 1 21 LYS HB2  H -12.730  -4.600   0.245 1.00 . A A . 21 LYS HB2  1 1 
        6  5622 1 1 21 LYS HB3  H -12.200  -2.979   0.673 1.00 . A A . 21 LYS HB3  1 1 
        6  5623 1 1 21 LYS HD2  H -14.330  -2.885   1.765 1.00 . A A . 21 LYS HD2  1 1 
        6  5624 1 1 21 LYS HD3  H -14.170  -1.343   0.921 1.00 . A A . 21 LYS HD3  1 1 
        6  5625 1 1 21 LYS HE2  H -16.510  -2.948   0.146 1.00 . A A . 21 LYS HE2  1 1 
        6  5626 1 1 21 LYS HE3  H -16.520  -2.373   1.813 1.00 . A A . 21 LYS HE3  1 1 
        6  5627 1 1 21 LYS HG2  H -14.040  -2.371  -1.176 1.00 . A A . 21 LYS HG2  1 1 
        6  5628 1 1 21 LYS HG3  H -14.710  -3.889  -0.573 1.00 . A A . 21 LYS HG3  1 1 
        6  5629 1 1 21 LYS HZ1  H -17.420  -0.563   0.848 1.00 . A A . 21 LYS HZ1  1 1 
        6  5630 1 1 21 LYS HZ2  H -16.730  -0.872  -0.667 1.00 . A A . 21 LYS HZ2  1 1 
        6  5631 1 1 21 LYS HZ3  H -15.800  -0.156   0.549 1.00 . A A . 21 LYS HZ3  1 1 
        6  5632 1 1 21 LYS N    N -10.530  -4.274  -1.103 1.00 . A A . 21 LYS N    1 1 
        6  5633 1 1 21 LYS NZ   N -16.550  -0.855   0.355 1.00 . A A . 21 LYS NZ   1 1 
        6  5634 1 1 21 LYS O    O -12.110  -1.557  -2.651 1.00 . A A . 21 LYS O    1 1 
        6  5635 1 1 22 ASP C    C  -9.503   0.038  -2.676 1.00 . A A . 22 ASP C    1 1 
        6  5636 1 1 22 ASP CA   C -10.180  -0.090  -1.313 1.00 . A A . 22 ASP CA   1 1 
        6  5637 1 1 22 ASP CB   C  -9.252   0.436  -0.218 1.00 . A A . 22 ASP CB   1 1 
        6  5638 1 1 22 ASP CG   C  -9.986   1.285   0.801 1.00 . A A . 22 ASP CG   1 1 
        6  5639 1 1 22 ASP H    H -10.080  -1.954  -0.322 1.00 . A A . 22 ASP H    1 1 
        6  5640 1 1 22 ASP HA   H -11.080   0.497  -1.319 1.00 . A A . 22 ASP HA   1 1 
        6  5641 1 1 22 ASP HB2  H  -8.804  -0.402   0.299 1.00 . A A . 22 ASP HB2  1 1 
        6  5642 1 1 22 ASP HB3  H  -8.475   1.036  -0.669 1.00 . A A . 22 ASP HB3  1 1 
        6  5643 1 1 22 ASP N    N -10.540  -1.473  -1.040 1.00 . A A . 22 ASP N    1 1 
        6  5644 1 1 22 ASP O    O  -9.694   1.026  -3.384 1.00 . A A . 22 ASP O    1 1 
        6  5645 1 1 22 ASP OD1  O -10.420   2.396   0.441 1.00 . A A . 22 ASP OD1  1 1 
        6  5646 1 1 22 ASP OD2  O -10.120   0.839   1.961 1.00 . A A . 22 ASP OD2  1 1 
        6  5647 1 1 23 LEU C    C  -8.931  -1.403  -5.446 1.00 . A A . 23 LEU C    1 1 
        6  5648 1 1 23 LEU CA   C  -8.010  -0.965  -4.313 1.00 . A A . 23 LEU CA   1 1 
        6  5649 1 1 23 LEU CB   C  -6.789  -1.885  -4.249 1.00 . A A . 23 LEU CB   1 1 
        6  5650 1 1 23 LEU CD1  C  -5.258  -1.536  -2.291 1.00 . A A . 23 LEU CD1  1 1 
        6  5651 1 1 23 LEU CD2  C  -4.315  -1.657  -4.604 1.00 . A A . 23 LEU CD2  1 1 
        6  5652 1 1 23 LEU CG   C  -5.501  -1.217  -3.758 1.00 . A A . 23 LEU CG   1 1 
        6  5653 1 1 23 LEU H    H  -8.599  -1.729  -2.430 1.00 . A A . 23 LEU H    1 1 
        6  5654 1 1 23 LEU HA   H  -7.677   0.044  -4.506 1.00 . A A . 23 LEU HA   1 1 
        6  5655 1 1 23 LEU HB2  H  -7.020  -2.707  -3.588 1.00 . A A . 23 LEU HB2  1 1 
        6  5656 1 1 23 LEU HB3  H  -6.610  -2.280  -5.238 1.00 . A A . 23 LEU HB3  1 1 
        6  5657 1 1 23 LEU HD11 H  -4.358  -1.041  -1.959 1.00 . A A . 23 LEU HD11 1 1 
        6  5658 1 1 23 LEU HD12 H  -5.149  -2.604  -2.168 1.00 . A A . 23 LEU HD12 1 1 
        6  5659 1 1 23 LEU HD13 H  -6.096  -1.190  -1.704 1.00 . A A . 23 LEU HD13 1 1 
        6  5660 1 1 23 LEU HD21 H  -3.821  -2.489  -4.126 1.00 . A A . 23 LEU HD21 1 1 
        6  5661 1 1 23 LEU HD22 H  -3.621  -0.835  -4.704 1.00 . A A . 23 LEU HD22 1 1 
        6  5662 1 1 23 LEU HD23 H  -4.661  -1.957  -5.581 1.00 . A A . 23 LEU HD23 1 1 
        6  5663 1 1 23 LEU HG   H  -5.602  -0.146  -3.853 1.00 . A A . 23 LEU HG   1 1 
        6  5664 1 1 23 LEU N    N  -8.713  -0.968  -3.037 1.00 . A A . 23 LEU N    1 1 
        6  5665 1 1 23 LEU O    O  -9.308  -0.600  -6.300 1.00 . A A . 23 LEU O    1 1 
        6  5666 1 1 24 GLY C    C  -9.959  -4.689  -6.720 1.00 . A A . 24 GLY C    1 1 
        6  5667 1 1 24 GLY CA   C -10.160  -3.206  -6.481 1.00 . A A . 24 GLY CA   1 1 
        6  5668 1 1 24 GLY H    H  -8.959  -3.276  -4.743 1.00 . A A . 24 GLY H    1 1 
        6  5669 1 1 24 GLY HA2  H -11.190  -3.040  -6.186 1.00 . A A . 24 GLY HA2  1 1 
        6  5670 1 1 24 GLY HA3  H  -9.975  -2.674  -7.401 1.00 . A A . 24 GLY HA3  1 1 
        6  5671 1 1 24 GLY N    N  -9.291  -2.682  -5.448 1.00 . A A . 24 GLY N    1 1 
        6  5672 1 1 24 GLY O    O -10.860  -5.381  -7.191 1.00 . A A . 24 GLY O    1 1 
        6  5673 1 1 25 VAL C    C  -9.013  -7.432  -5.443 1.00 . A A . 25 VAL C    1 1 
        6  5674 1 1 25 VAL CA   C  -8.442  -6.587  -6.577 1.00 . A A . 25 VAL CA   1 1 
        6  5675 1 1 25 VAL CB   C  -6.920  -6.808  -6.649 1.00 . A A . 25 VAL CB   1 1 
        6  5676 1 1 25 VAL CG1  C  -6.364  -6.282  -7.963 1.00 . A A . 25 VAL CG1  1 1 
        6  5677 1 1 25 VAL CG2  C  -6.228  -6.148  -5.466 1.00 . A A . 25 VAL CG2  1 1 
        6  5678 1 1 25 VAL H    H  -8.087  -4.576  -6.023 1.00 . A A . 25 VAL H    1 1 
        6  5679 1 1 25 VAL HA   H  -8.878  -6.913  -7.511 1.00 . A A . 25 VAL HA   1 1 
        6  5680 1 1 25 VAL HB   H  -6.728  -7.870  -6.604 1.00 . A A . 25 VAL HB   1 1 
        6  5681 1 1 25 VAL HG11 H  -6.754  -5.292  -8.147 1.00 . A A . 25 VAL HG11 1 1 
        6  5682 1 1 25 VAL HG12 H  -6.659  -6.940  -8.768 1.00 . A A . 25 VAL HG12 1 1 
        6  5683 1 1 25 VAL HG13 H  -5.286  -6.240  -7.909 1.00 . A A . 25 VAL HG13 1 1 
        6  5684 1 1 25 VAL HG21 H  -6.946  -5.977  -4.678 1.00 . A A . 25 VAL HG21 1 1 
        6  5685 1 1 25 VAL HG22 H  -5.805  -5.205  -5.777 1.00 . A A . 25 VAL HG22 1 1 
        6  5686 1 1 25 VAL HG23 H  -5.441  -6.794  -5.103 1.00 . A A . 25 VAL HG23 1 1 
        6  5687 1 1 25 VAL N    N  -8.766  -5.178  -6.395 1.00 . A A . 25 VAL N    1 1 
        6  5688 1 1 25 VAL O    O  -9.652  -6.910  -4.530 1.00 . A A . 25 VAL O    1 1 
        6  5689 1 1 26 GLN C    C  -8.186  -9.948  -3.456 1.00 . A A . 26 GLN C    1 1 
        6  5690 1 1 26 GLN CA   C  -9.270  -9.654  -4.487 1.00 . A A . 26 GLN CA   1 1 
        6  5691 1 1 26 GLN CB   C  -9.748 -10.958  -5.128 1.00 . A A . 26 GLN CB   1 1 
        6  5692 1 1 26 GLN CD   C  -8.888 -11.764  -7.364 1.00 . A A . 26 GLN CD   1 1 
        6  5693 1 1 26 GLN CG   C  -8.652 -11.709  -5.867 1.00 . A A . 26 GLN CG   1 1 
        6  5694 1 1 26 GLN H    H  -8.262  -9.094  -6.261 1.00 . A A . 26 GLN H    1 1 
        6  5695 1 1 26 GLN HA   H -10.100  -9.180  -3.990 1.00 . A A . 26 GLN HA   1 1 
        6  5696 1 1 26 GLN HB2  H -10.130 -11.603  -4.354 1.00 . A A . 26 GLN HB2  1 1 
        6  5697 1 1 26 GLN HB3  H -10.530 -10.733  -5.828 1.00 . A A . 26 GLN HB3  1 1 
        6  5698 1 1 26 GLN HE21 H  -6.950 -11.483  -7.705 1.00 . A A . 26 GLN HE21 1 1 
        6  5699 1 1 26 GLN HE22 H  -7.943 -11.647  -9.109 1.00 . A A . 26 GLN HE22 1 1 
        6  5700 1 1 26 GLN HG2  H  -7.709 -11.216  -5.686 1.00 . A A . 26 GLN HG2  1 1 
        6  5701 1 1 26 GLN HG3  H  -8.607 -12.720  -5.487 1.00 . A A . 26 GLN HG3  1 1 
        6  5702 1 1 26 GLN N    N  -8.779  -8.738  -5.508 1.00 . A A . 26 GLN N    1 1 
        6  5703 1 1 26 GLN NE2  N  -7.819 -11.616  -8.137 1.00 . A A . 26 GLN NE2  1 1 
        6  5704 1 1 26 GLN O    O  -7.041  -9.523  -3.606 1.00 . A A . 26 GLN O    1 1 
        6  5705 1 1 26 GLN OE1  O -10.010 -11.937  -7.820 1.00 . A A . 26 GLN OE1  1 1 
        6  5706 1 1 27 GLN C    C  -6.569 -12.022  -1.858 1.00 . A A . 27 GLN C    1 1 
        6  5707 1 1 27 GLN CA   C  -7.614 -11.033  -1.354 1.00 . A A . 27 GLN CA   1 1 
        6  5708 1 1 27 GLN CB   C  -8.358 -11.625  -0.156 1.00 . A A . 27 GLN CB   1 1 
        6  5709 1 1 27 GLN CD   C -10.830 -11.376   0.273 1.00 . A A . 27 GLN CD   1 1 
        6  5710 1 1 27 GLN CG   C  -9.469 -10.730   0.372 1.00 . A A . 27 GLN CG   1 1 
        6  5711 1 1 27 GLN H    H  -9.483 -10.990  -2.350 1.00 . A A . 27 GLN H    1 1 
        6  5712 1 1 27 GLN HA   H  -7.114 -10.130  -1.045 1.00 . A A . 27 GLN HA   1 1 
        6  5713 1 1 27 GLN HB2  H  -8.794 -12.570  -0.449 1.00 . A A . 27 GLN HB2  1 1 
        6  5714 1 1 27 GLN HB3  H  -7.653 -11.795   0.643 1.00 . A A . 27 GLN HB3  1 1 
        6  5715 1 1 27 GLN HE21 H -11.240 -10.848   2.146 1.00 . A A . 27 GLN HE21 1 1 
        6  5716 1 1 27 GLN HE22 H -12.490 -11.716   1.321 1.00 . A A . 27 GLN HE22 1 1 
        6  5717 1 1 27 GLN HG2  H  -9.270 -10.504   1.409 1.00 . A A . 27 GLN HG2  1 1 
        6  5718 1 1 27 GLN HG3  H  -9.478  -9.814  -0.198 1.00 . A A . 27 GLN HG3  1 1 
        6  5719 1 1 27 GLN N    N  -8.555 -10.679  -2.411 1.00 . A A . 27 GLN N    1 1 
        6  5720 1 1 27 GLN NE2  N -11.600 -11.307   1.356 1.00 . A A . 27 GLN NE2  1 1 
        6  5721 1 1 27 GLN O    O  -5.476 -12.122  -1.302 1.00 . A A . 27 GLN O    1 1 
        6  5722 1 1 27 GLN OE1  O -11.200 -11.932  -0.763 1.00 . A A . 27 GLN OE1  1 1 
        6  5723 1 1 28 SER C    C  -4.769 -13.054  -4.075 1.00 . A A . 28 SER C    1 1 
        6  5724 1 1 28 SER CA   C  -6.006 -13.731  -3.494 1.00 . A A . 28 SER CA   1 1 
        6  5725 1 1 28 SER CB   C  -6.720 -14.534  -4.583 1.00 . A A . 28 SER CB   1 1 
        6  5726 1 1 28 SER H    H  -7.797 -12.624  -3.311 1.00 . A A . 28 SER H    1 1 
        6  5727 1 1 28 SER HA   H  -5.698 -14.402  -2.707 1.00 . A A . 28 SER HA   1 1 
        6  5728 1 1 28 SER HB2  H  -6.676 -13.991  -5.515 1.00 . A A . 28 SER HB2  1 1 
        6  5729 1 1 28 SER HB3  H  -6.230 -15.490  -4.701 1.00 . A A . 28 SER HB3  1 1 
        6  5730 1 1 28 SER HG   H  -8.128 -15.247  -3.425 1.00 . A A . 28 SER HG   1 1 
        6  5731 1 1 28 SER N    N  -6.912 -12.749  -2.914 1.00 . A A . 28 SER N    1 1 
        6  5732 1 1 28 SER O    O  -3.682 -13.634  -4.094 1.00 . A A . 28 SER O    1 1 
        6  5733 1 1 28 SER OG   O  -8.078 -14.755  -4.247 1.00 . A A . 28 SER OG   1 1 
        6  5734 1 1 29 ALA C    C  -2.993 -10.403  -4.050 1.00 . A A . 29 ALA C    1 1 
        6  5735 1 1 29 ALA CA   C  -3.836 -11.070  -5.130 1.00 . A A . 29 ALA CA   1 1 
        6  5736 1 1 29 ALA CB   C  -4.365 -10.029  -6.107 1.00 . A A . 29 ALA CB   1 1 
        6  5737 1 1 29 ALA H    H  -5.828 -11.414  -4.505 1.00 . A A . 29 ALA H    1 1 
        6  5738 1 1 29 ALA HA   H  -3.214 -11.761  -5.680 1.00 . A A . 29 ALA HA   1 1 
        6  5739 1 1 29 ALA HB1  H  -3.693  -9.953  -6.950 1.00 . A A . 29 ALA HB1  1 1 
        6  5740 1 1 29 ALA HB2  H  -4.432  -9.073  -5.612 1.00 . A A . 29 ALA HB2  1 1 
        6  5741 1 1 29 ALA HB3  H  -5.344 -10.326  -6.452 1.00 . A A . 29 ALA HB3  1 1 
        6  5742 1 1 29 ALA N    N  -4.939 -11.823  -4.548 1.00 . A A . 29 ALA N    1 1 
        6  5743 1 1 29 ALA O    O  -1.764 -10.423  -4.108 1.00 . A A . 29 ALA O    1 1 
        6  5744 1 1 30 ILE C    C  -2.028 -10.111  -1.251 1.00 . A A . 30 ILE C    1 1 
        6  5745 1 1 30 ILE CA   C  -2.964  -9.146  -1.967 1.00 . A A . 30 ILE CA   1 1 
        6  5746 1 1 30 ILE CB   C  -3.953  -8.549  -0.946 1.00 . A A . 30 ILE CB   1 1 
        6  5747 1 1 30 ILE CD1  C  -4.416  -6.606  -2.528 1.00 . A A . 30 ILE CD1  1 1 
        6  5748 1 1 30 ILE CG1  C  -5.005  -7.693  -1.655 1.00 . A A . 30 ILE CG1  1 1 
        6  5749 1 1 30 ILE CG2  C  -3.209  -7.725   0.095 1.00 . A A . 30 ILE CG2  1 1 
        6  5750 1 1 30 ILE H    H  -4.639  -9.832  -3.067 1.00 . A A . 30 ILE H    1 1 
        6  5751 1 1 30 ILE HA   H  -2.379  -8.341  -2.387 1.00 . A A . 30 ILE HA   1 1 
        6  5752 1 1 30 ILE HB   H  -4.446  -9.364  -0.438 1.00 . A A . 30 ILE HB   1 1 
        6  5753 1 1 30 ILE HD11 H  -3.778  -7.052  -3.277 1.00 . A A . 30 ILE HD11 1 1 
        6  5754 1 1 30 ILE HD12 H  -3.836  -5.929  -1.918 1.00 . A A . 30 ILE HD12 1 1 
        6  5755 1 1 30 ILE HD13 H  -5.213  -6.062  -3.013 1.00 . A A . 30 ILE HD13 1 1 
        6  5756 1 1 30 ILE HG12 H  -5.613  -8.327  -2.282 1.00 . A A . 30 ILE HG12 1 1 
        6  5757 1 1 30 ILE HG13 H  -5.634  -7.219  -0.914 1.00 . A A . 30 ILE HG13 1 1 
        6  5758 1 1 30 ILE HG21 H  -2.808  -8.381   0.854 1.00 . A A . 30 ILE HG21 1 1 
        6  5759 1 1 30 ILE HG22 H  -3.889  -7.019   0.549 1.00 . A A . 30 ILE HG22 1 1 
        6  5760 1 1 30 ILE HG23 H  -2.400  -7.190  -0.381 1.00 . A A . 30 ILE HG23 1 1 
        6  5761 1 1 30 ILE N    N  -3.659  -9.815  -3.061 1.00 . A A . 30 ILE N    1 1 
        6  5762 1 1 30 ILE O    O  -0.849  -9.817  -1.054 1.00 . A A . 30 ILE O    1 1 
        6  5763 1 1 31 ASN C    C  -0.608 -12.730  -1.075 1.00 . A A . 31 ASN C    1 1 
        6  5764 1 1 31 ASN CA   C  -1.762 -12.279  -0.189 1.00 . A A . 31 ASN CA   1 1 
        6  5765 1 1 31 ASN CB   C  -2.634 -13.478   0.189 1.00 . A A . 31 ASN CB   1 1 
        6  5766 1 1 31 ASN CG   C  -3.407 -13.248   1.473 1.00 . A A . 31 ASN CG   1 1 
        6  5767 1 1 31 ASN H    H  -3.501 -11.450  -1.062 1.00 . A A . 31 ASN H    1 1 
        6  5768 1 1 31 ASN HA   H  -1.361 -11.836   0.711 1.00 . A A . 31 ASN HA   1 1 
        6  5769 1 1 31 ASN HB2  H  -3.341 -13.666  -0.606 1.00 . A A . 31 ASN HB2  1 1 
        6  5770 1 1 31 ASN HB3  H  -2.004 -14.347   0.319 1.00 . A A . 31 ASN HB3  1 1 
        6  5771 1 1 31 ASN HD21 H  -2.271 -14.581   2.420 1.00 . A A . 31 ASN HD21 1 1 
        6  5772 1 1 31 ASN HD22 H  -3.510 -13.827   3.376 1.00 . A A . 31 ASN HD22 1 1 
        6  5773 1 1 31 ASN N    N  -2.557 -11.268  -0.871 1.00 . A A . 31 ASN N    1 1 
        6  5774 1 1 31 ASN ND2  N  -3.024 -13.957   2.529 1.00 . A A . 31 ASN ND2  1 1 
        6  5775 1 1 31 ASN O    O   0.488 -13.007  -0.592 1.00 . A A . 31 ASN O    1 1 
        6  5776 1 1 31 ASN OD1  O  -4.338 -12.444   1.515 1.00 . A A . 31 ASN OD1  1 1 
        6  5777 1 1 32 LYS C    C   1.285 -12.204  -3.400 1.00 . A A . 32 LYS C    1 1 
        6  5778 1 1 32 LYS CA   C   0.139 -13.207  -3.343 1.00 . A A . 32 LYS CA   1 1 
        6  5779 1 1 32 LYS CB   C  -0.490 -13.357  -4.730 1.00 . A A . 32 LYS CB   1 1 
        6  5780 1 1 32 LYS CD   C  -1.558 -15.004  -6.298 1.00 . A A . 32 LYS CD   1 1 
        6  5781 1 1 32 LYS CE   C  -1.406 -16.353  -6.982 1.00 . A A . 32 LYS CE   1 1 
        6  5782 1 1 32 LYS CG   C  -0.476 -14.781  -5.253 1.00 . A A . 32 LYS CG   1 1 
        6  5783 1 1 32 LYS H    H  -1.763 -12.560  -2.699 1.00 . A A . 32 LYS H    1 1 
        6  5784 1 1 32 LYS HA   H   0.528 -14.156  -3.028 1.00 . A A . 32 LYS HA   1 1 
        6  5785 1 1 32 LYS HB2  H  -1.517 -13.026  -4.682 1.00 . A A . 32 LYS HB2  1 1 
        6  5786 1 1 32 LYS HB3  H   0.047 -12.733  -5.430 1.00 . A A . 32 LYS HB3  1 1 
        6  5787 1 1 32 LYS HD2  H  -2.523 -14.964  -5.816 1.00 . A A . 32 LYS HD2  1 1 
        6  5788 1 1 32 LYS HD3  H  -1.493 -14.223  -7.041 1.00 . A A . 32 LYS HD3  1 1 
        6  5789 1 1 32 LYS HE2  H  -0.461 -16.787  -6.692 1.00 . A A . 32 LYS HE2  1 1 
        6  5790 1 1 32 LYS HE3  H  -2.211 -16.998  -6.660 1.00 . A A . 32 LYS HE3  1 1 
        6  5791 1 1 32 LYS HG2  H   0.487 -14.978  -5.699 1.00 . A A . 32 LYS HG2  1 1 
        6  5792 1 1 32 LYS HG3  H  -0.639 -15.457  -4.427 1.00 . A A . 32 LYS HG3  1 1 
        6  5793 1 1 32 LYS HZ1  H  -1.117 -15.289  -8.756 1.00 . A A . 32 LYS HZ1  1 1 
        6  5794 1 1 32 LYS HZ2  H  -2.419 -16.366  -8.810 1.00 . A A . 32 LYS HZ2  1 1 
        6  5795 1 1 32 LYS HZ3  H  -0.834 -16.951  -8.900 1.00 . A A . 32 LYS HZ3  1 1 
        6  5796 1 1 32 LYS N    N  -0.869 -12.795  -2.378 1.00 . A A . 32 LYS N    1 1 
        6  5797 1 1 32 LYS NZ   N  -1.447 -16.232  -8.465 1.00 . A A . 32 LYS NZ   1 1 
        6  5798 1 1 32 LYS O    O   2.433 -12.568  -3.651 1.00 . A A . 32 LYS O    1 1 
        6  5799 1 1 33 TRP C    C   2.897  -9.978  -2.024 1.00 . A A . 33 TRP C    1 1 
        6  5800 1 1 33 TRP CA   C   1.936  -9.878  -3.203 1.00 . A A . 33 TRP CA   1 1 
        6  5801 1 1 33 TRP CB   C   1.194  -8.554  -3.188 1.00 . A A . 33 TRP CB   1 1 
        6  5802 1 1 33 TRP CD1  C   0.569  -9.003  -5.592 1.00 . A A . 33 TRP CD1  1 1 
        6  5803 1 1 33 TRP CD2  C  -0.581  -7.337  -4.668 1.00 . A A . 33 TRP CD2  1 1 
        6  5804 1 1 33 TRP CE2  C  -1.011  -7.487  -5.998 1.00 . A A . 33 TRP CE2  1 1 
        6  5805 1 1 33 TRP CE3  C  -1.164  -6.353  -3.876 1.00 . A A . 33 TRP CE3  1 1 
        6  5806 1 1 33 TRP CG   C   0.435  -8.311  -4.442 1.00 . A A . 33 TRP CG   1 1 
        6  5807 1 1 33 TRP CH2  C  -2.558  -5.723  -5.758 1.00 . A A . 33 TRP CH2  1 1 
        6  5808 1 1 33 TRP CZ2  C  -1.999  -6.685  -6.555 1.00 . A A . 33 TRP CZ2  1 1 
        6  5809 1 1 33 TRP CZ3  C  -2.150  -5.553  -4.427 1.00 . A A . 33 TRP CZ3  1 1 
        6  5810 1 1 33 TRP H    H   0.023 -10.714  -2.985 1.00 . A A . 33 TRP H    1 1 
        6  5811 1 1 33 TRP HA   H   2.492  -9.959  -4.125 1.00 . A A . 33 TRP HA   1 1 
        6  5812 1 1 33 TRP HB2  H   0.486  -8.568  -2.387 1.00 . A A . 33 TRP HB2  1 1 
        6  5813 1 1 33 TRP HB3  H   1.893  -7.750  -3.049 1.00 . A A . 33 TRP HB3  1 1 
        6  5814 1 1 33 TRP HD1  H   1.261  -9.812  -5.714 1.00 . A A . 33 TRP HD1  1 1 
        6  5815 1 1 33 TRP HE1  H  -0.372  -8.851  -7.459 1.00 . A A . 33 TRP HE1  1 1 
        6  5816 1 1 33 TRP HE3  H  -0.862  -6.218  -2.850 1.00 . A A . 33 TRP HE3  1 1 
        6  5817 1 1 33 TRP HH2  H  -3.330  -5.075  -6.148 1.00 . A A . 33 TRP HH2  1 1 
        6  5818 1 1 33 TRP HZ2  H  -2.322  -6.806  -7.579 1.00 . A A . 33 TRP HZ2  1 1 
        6  5819 1 1 33 TRP HZ3  H  -2.615  -4.782  -3.829 1.00 . A A . 33 TRP HZ3  1 1 
        6  5820 1 1 33 TRP N    N   0.957 -10.943  -3.173 1.00 . A A . 33 TRP N    1 1 
        6  5821 1 1 33 TRP NE1  N  -0.290  -8.517  -6.544 1.00 . A A . 33 TRP NE1  1 1 
        6  5822 1 1 33 TRP O    O   4.113  -9.898  -2.192 1.00 . A A . 33 TRP O    1 1 
        6  5823 1 1 34 ILE C    C   3.750 -11.680   0.496 1.00 . A A . 34 ILE C    1 1 
        6  5824 1 1 34 ILE CA   C   3.150 -10.281   0.376 1.00 . A A . 34 ILE CA   1 1 
        6  5825 1 1 34 ILE CB   C   2.320  -9.979   1.640 1.00 . A A . 34 ILE CB   1 1 
        6  5826 1 1 34 ILE CD1  C   0.141  -8.711   1.990 1.00 . A A . 34 ILE CD1  1 1 
        6  5827 1 1 34 ILE CG1  C   1.564  -8.657   1.481 1.00 . A A . 34 ILE CG1  1 1 
        6  5828 1 1 34 ILE CG2  C   3.218  -9.940   2.870 1.00 . A A . 34 ILE CG2  1 1 
        6  5829 1 1 34 ILE H    H   1.367 -10.222  -0.762 1.00 . A A . 34 ILE H    1 1 
        6  5830 1 1 34 ILE HA   H   3.951  -9.558   0.315 1.00 . A A . 34 ILE HA   1 1 
        6  5831 1 1 34 ILE HB   H   1.607 -10.779   1.773 1.00 . A A . 34 ILE HB   1 1 
        6  5832 1 1 34 ILE HD11 H  -0.540  -8.722   1.152 1.00 . A A . 34 ILE HD11 1 1 
        6  5833 1 1 34 ILE HD12 H  -0.056  -7.841   2.601 1.00 . A A . 34 ILE HD12 1 1 
        6  5834 1 1 34 ILE HD13 H   0.002  -9.603   2.580 1.00 . A A . 34 ILE HD13 1 1 
        6  5835 1 1 34 ILE HG12 H   2.083  -7.886   2.031 1.00 . A A . 34 ILE HG12 1 1 
        6  5836 1 1 34 ILE HG13 H   1.534  -8.389   0.435 1.00 . A A . 34 ILE HG13 1 1 
        6  5837 1 1 34 ILE HG21 H   3.210  -8.946   3.291 1.00 . A A . 34 ILE HG21 1 1 
        6  5838 1 1 34 ILE HG22 H   4.227 -10.204   2.590 1.00 . A A . 34 ILE HG22 1 1 
        6  5839 1 1 34 ILE HG23 H   2.854 -10.644   3.605 1.00 . A A . 34 ILE HG23 1 1 
        6  5840 1 1 34 ILE N    N   2.342 -10.161  -0.832 1.00 . A A . 34 ILE N    1 1 
        6  5841 1 1 34 ILE O    O   4.741 -11.881   1.197 1.00 . A A . 34 ILE O    1 1 
        6  5842 1 1 35 HIS C    C   4.953 -14.156  -0.879 1.00 . A A . 35 HIS C    1 1 
        6  5843 1 1 35 HIS CA   C   3.617 -14.023  -0.164 1.00 . A A . 35 HIS CA   1 1 
        6  5844 1 1 35 HIS CB   C   2.588 -14.943  -0.820 1.00 . A A . 35 HIS CB   1 1 
        6  5845 1 1 35 HIS CD2  C   0.867 -16.700  -0.015 1.00 . A A . 35 HIS CD2  1 1 
        6  5846 1 1 35 HIS CE1  C   0.749 -16.100   2.091 1.00 . A A . 35 HIS CE1  1 1 
        6  5847 1 1 35 HIS CG   C   1.702 -15.651   0.155 1.00 . A A . 35 HIS CG   1 1 
        6  5848 1 1 35 HIS H    H   2.358 -12.424  -0.734 1.00 . A A . 35 HIS H    1 1 
        6  5849 1 1 35 HIS HA   H   3.744 -14.308   0.863 1.00 . A A . 35 HIS HA   1 1 
        6  5850 1 1 35 HIS HB2  H   1.959 -14.359  -1.474 1.00 . A A . 35 HIS HB2  1 1 
        6  5851 1 1 35 HIS HB3  H   3.104 -15.690  -1.404 1.00 . A A . 35 HIS HB3  1 1 
        6  5852 1 1 35 HIS HD1  H   2.093 -14.565   1.921 1.00 . A A . 35 HIS HD1  1 1 
        6  5853 1 1 35 HIS HD2  H   0.689 -17.234  -0.938 1.00 . A A . 35 HIS HD2  1 1 
        6  5854 1 1 35 HIS HE1  H   0.475 -16.060   3.135 1.00 . A A . 35 HIS HE1  1 1 
        6  5855 1 1 35 HIS HE2  H  -0.293 -17.724   1.405 1.00 . A A . 35 HIS HE2  1 1 
        6  5856 1 1 35 HIS N    N   3.143 -12.643  -0.193 1.00 . A A . 35 HIS N    1 1 
        6  5857 1 1 35 HIS ND1  N   1.607 -15.297   1.485 1.00 . A A . 35 HIS ND1  1 1 
        6  5858 1 1 35 HIS NE2  N   0.287 -16.960   1.204 1.00 . A A . 35 HIS NE2  1 1 
        6  5859 1 1 35 HIS O    O   5.811 -14.945  -0.482 1.00 . A A . 35 HIS O    1 1 
        6  5860 1 1 36 ALA C    C   7.269 -12.253  -2.351 1.00 . A A . 36 ALA C    1 1 
        6  5861 1 1 36 ALA CA   C   6.340 -13.404  -2.726 1.00 . A A . 36 ALA CA   1 1 
        6  5862 1 1 36 ALA CB   C   6.004 -13.356  -4.209 1.00 . A A . 36 ALA CB   1 1 
        6  5863 1 1 36 ALA H    H   4.389 -12.780  -2.197 1.00 . A A . 36 ALA H    1 1 
        6  5864 1 1 36 ALA HA   H   6.844 -14.336  -2.527 1.00 . A A . 36 ALA HA   1 1 
        6  5865 1 1 36 ALA HB1  H   6.804 -13.812  -4.773 1.00 . A A . 36 ALA HB1  1 1 
        6  5866 1 1 36 ALA HB2  H   5.883 -12.329  -4.518 1.00 . A A . 36 ALA HB2  1 1 
        6  5867 1 1 36 ALA HB3  H   5.085 -13.897  -4.386 1.00 . A A . 36 ALA HB3  1 1 
        6  5868 1 1 36 ALA N    N   5.116 -13.381  -1.937 1.00 . A A . 36 ALA N    1 1 
        6  5869 1 1 36 ALA O    O   8.460 -12.281  -2.657 1.00 . A A . 36 ALA O    1 1 
        6  5870 1 1 37 GLY C    C   7.486  -8.975  -2.291 1.00 . A A . 37 GLY C    1 1 
        6  5871 1 1 37 GLY CA   C   7.520 -10.102  -1.277 1.00 . A A . 37 GLY CA   1 1 
        6  5872 1 1 37 GLY H    H   5.767 -11.273  -1.463 1.00 . A A . 37 GLY H    1 1 
        6  5873 1 1 37 GLY HA2  H   7.147  -9.733  -0.334 1.00 . A A . 37 GLY HA2  1 1 
        6  5874 1 1 37 GLY HA3  H   8.543 -10.423  -1.147 1.00 . A A . 37 GLY HA3  1 1 
        6  5875 1 1 37 GLY N    N   6.720 -11.243  -1.683 1.00 . A A . 37 GLY N    1 1 
        6  5876 1 1 37 GLY O    O   8.428  -8.188  -2.385 1.00 . A A . 37 GLY O    1 1 
        6  5877 1 1 38 ARG C    C   6.142  -6.479  -3.407 1.00 . A A . 38 ARG C    1 1 
        6  5878 1 1 38 ARG CA   C   6.247  -7.854  -4.059 1.00 . A A . 38 ARG CA   1 1 
        6  5879 1 1 38 ARG CB   C   5.008  -8.122  -4.916 1.00 . A A . 38 ARG CB   1 1 
        6  5880 1 1 38 ARG CD   C   3.781  -7.677  -7.064 1.00 . A A . 38 ARG CD   1 1 
        6  5881 1 1 38 ARG CG   C   5.088  -7.509  -6.305 1.00 . A A . 38 ARG CG   1 1 
        6  5882 1 1 38 ARG CZ   C   2.742  -6.722  -9.084 1.00 . A A . 38 ARG CZ   1 1 
        6  5883 1 1 38 ARG H    H   5.680  -9.551  -2.927 1.00 . A A . 38 ARG H    1 1 
        6  5884 1 1 38 ARG HA   H   7.122  -7.876  -4.690 1.00 . A A . 38 ARG HA   1 1 
        6  5885 1 1 38 ARG HB2  H   4.881  -9.189  -5.023 1.00 . A A . 38 ARG HB2  1 1 
        6  5886 1 1 38 ARG HB3  H   4.143  -7.713  -4.416 1.00 . A A . 38 ARG HB3  1 1 
        6  5887 1 1 38 ARG HD2  H   3.589  -8.731  -7.195 1.00 . A A . 38 ARG HD2  1 1 
        6  5888 1 1 38 ARG HD3  H   2.983  -7.235  -6.484 1.00 . A A . 38 ARG HD3  1 1 
        6  5889 1 1 38 ARG HE   H   4.707  -6.832  -8.751 1.00 . A A . 38 ARG HE   1 1 
        6  5890 1 1 38 ARG HG2  H   5.305  -6.455  -6.212 1.00 . A A . 38 ARG HG2  1 1 
        6  5891 1 1 38 ARG HG3  H   5.880  -7.995  -6.856 1.00 . A A . 38 ARG HG3  1 1 
        6  5892 1 1 38 ARG HH11 H   1.427  -7.421  -7.716 1.00 . A A . 38 ARG HH11 1 1 
        6  5893 1 1 38 ARG HH12 H   0.722  -6.744  -9.146 1.00 . A A . 38 ARG HH12 1 1 
        6  5894 1 1 38 ARG HH21 H   3.781  -5.941 -10.632 1.00 . A A . 38 ARG HH21 1 1 
        6  5895 1 1 38 ARG HH22 H   2.059  -5.904 -10.802 1.00 . A A . 38 ARG HH22 1 1 
        6  5896 1 1 38 ARG N    N   6.398  -8.896  -3.050 1.00 . A A . 38 ARG N    1 1 
        6  5897 1 1 38 ARG NE   N   3.825  -7.038  -8.376 1.00 . A A . 38 ARG NE   1 1 
        6  5898 1 1 38 ARG NH1  N   1.532  -6.984  -8.610 1.00 . A A . 38 ARG NH1  1 1 
        6  5899 1 1 38 ARG NH2  N   2.871  -6.140 -10.269 1.00 . A A . 38 ARG NH2  1 1 
        6  5900 1 1 38 ARG O    O   5.095  -6.112  -2.874 1.00 . A A . 38 ARG O    1 1 
        6  5901 1 1 39 LYS C    C   6.246  -3.477  -3.531 1.00 . A A . 39 LYS C    1 1 
        6  5902 1 1 39 LYS CA   C   7.267  -4.391  -2.863 1.00 . A A . 39 LYS CA   1 1 
        6  5903 1 1 39 LYS CB   C   8.670  -3.791  -2.986 1.00 . A A . 39 LYS CB   1 1 
        6  5904 1 1 39 LYS CD   C  10.846  -3.911  -1.734 1.00 . A A . 39 LYS CD   1 1 
        6  5905 1 1 39 LYS CE   C  11.668  -2.985  -0.852 1.00 . A A . 39 LYS CE   1 1 
        6  5906 1 1 39 LYS CG   C   9.363  -3.589  -1.648 1.00 . A A . 39 LYS CG   1 1 
        6  5907 1 1 39 LYS H    H   8.039  -6.074  -3.888 1.00 . A A . 39 LYS H    1 1 
        6  5908 1 1 39 LYS HA   H   7.017  -4.485  -1.816 1.00 . A A . 39 LYS HA   1 1 
        6  5909 1 1 39 LYS HB2  H   9.280  -4.450  -3.587 1.00 . A A . 39 LYS HB2  1 1 
        6  5910 1 1 39 LYS HB3  H   8.599  -2.832  -3.479 1.00 . A A . 39 LYS HB3  1 1 
        6  5911 1 1 39 LYS HD2  H  11.004  -4.930  -1.414 1.00 . A A . 39 LYS HD2  1 1 
        6  5912 1 1 39 LYS HD3  H  11.171  -3.800  -2.758 1.00 . A A . 39 LYS HD3  1 1 
        6  5913 1 1 39 LYS HE2  H  11.576  -1.976  -1.224 1.00 . A A . 39 LYS HE2  1 1 
        6  5914 1 1 39 LYS HE3  H  11.282  -3.034   0.156 1.00 . A A . 39 LYS HE3  1 1 
        6  5915 1 1 39 LYS HG2  H   9.247  -2.561  -1.344 1.00 . A A . 39 LYS HG2  1 1 
        6  5916 1 1 39 LYS HG3  H   8.905  -4.238  -0.915 1.00 . A A . 39 LYS HG3  1 1 
        6  5917 1 1 39 LYS HZ1  H  13.273  -4.119  -0.142 1.00 . A A . 39 LYS HZ1  1 1 
        6  5918 1 1 39 LYS HZ2  H  13.692  -2.542  -0.584 1.00 . A A . 39 LYS HZ2  1 1 
        6  5919 1 1 39 LYS HZ3  H  13.397  -3.704  -1.777 1.00 . A A . 39 LYS HZ3  1 1 
        6  5920 1 1 39 LYS N    N   7.236  -5.725  -3.451 1.00 . A A . 39 LYS N    1 1 
        6  5921 1 1 39 LYS NZ   N  13.109  -3.364  -0.838 1.00 . A A . 39 LYS NZ   1 1 
        6  5922 1 1 39 LYS O    O   6.250  -3.310  -4.751 1.00 . A A . 39 LYS O    1 1 
        6  5923 1 1 40 ILE C    C   3.967  -0.935  -2.201 1.00 . A A . 40 ILE C    1 1 
        6  5924 1 1 40 ILE CA   C   4.342  -1.989  -3.238 1.00 . A A . 40 ILE CA   1 1 
        6  5925 1 1 40 ILE CB   C   3.075  -2.764  -3.650 1.00 . A A . 40 ILE CB   1 1 
        6  5926 1 1 40 ILE CD1  C   2.230  -4.639  -5.154 1.00 . A A . 40 ILE CD1  1 1 
        6  5927 1 1 40 ILE CG1  C   3.431  -3.876  -4.639 1.00 . A A . 40 ILE CG1  1 1 
        6  5928 1 1 40 ILE CG2  C   2.045  -1.819  -4.257 1.00 . A A . 40 ILE CG2  1 1 
        6  5929 1 1 40 ILE H    H   5.417  -3.059  -1.760 1.00 . A A . 40 ILE H    1 1 
        6  5930 1 1 40 ILE HA   H   4.739  -1.494  -4.112 1.00 . A A . 40 ILE HA   1 1 
        6  5931 1 1 40 ILE HB   H   2.644  -3.204  -2.765 1.00 . A A . 40 ILE HB   1 1 
        6  5932 1 1 40 ILE HD11 H   1.552  -3.954  -5.639 1.00 . A A . 40 ILE HD11 1 1 
        6  5933 1 1 40 ILE HD12 H   1.727  -5.117  -4.325 1.00 . A A . 40 ILE HD12 1 1 
        6  5934 1 1 40 ILE HD13 H   2.554  -5.388  -5.860 1.00 . A A . 40 ILE HD13 1 1 
        6  5935 1 1 40 ILE HG12 H   3.937  -3.444  -5.490 1.00 . A A . 40 ILE HG12 1 1 
        6  5936 1 1 40 ILE HG13 H   4.092  -4.581  -4.155 1.00 . A A . 40 ILE HG13 1 1 
        6  5937 1 1 40 ILE HG21 H   1.661  -1.165  -3.488 1.00 . A A . 40 ILE HG21 1 1 
        6  5938 1 1 40 ILE HG22 H   1.234  -2.394  -4.679 1.00 . A A . 40 ILE HG22 1 1 
        6  5939 1 1 40 ILE HG23 H   2.511  -1.229  -5.033 1.00 . A A . 40 ILE HG23 1 1 
        6  5940 1 1 40 ILE N    N   5.370  -2.887  -2.724 1.00 . A A . 40 ILE N    1 1 
        6  5941 1 1 40 ILE O    O   4.183  -1.120  -1.003 1.00 . A A . 40 ILE O    1 1 
        6  5942 1 1 41 PHE C    C   1.686   1.880  -2.275 1.00 . A A . 41 PHE C    1 1 
        6  5943 1 1 41 PHE CA   C   2.990   1.256  -1.790 1.00 . A A . 41 PHE CA   1 1 
        6  5944 1 1 41 PHE CB   C   4.083   2.325  -1.716 1.00 . A A . 41 PHE CB   1 1 
        6  5945 1 1 41 PHE CD1  C   6.266   1.089  -1.694 1.00 . A A . 41 PHE CD1  1 1 
        6  5946 1 1 41 PHE CD2  C   5.569   2.194   0.301 1.00 . A A . 41 PHE CD2  1 1 
        6  5947 1 1 41 PHE CE1  C   7.416   0.661  -1.060 1.00 . A A . 41 PHE CE1  1 1 
        6  5948 1 1 41 PHE CE2  C   6.717   1.767   0.942 1.00 . A A . 41 PHE CE2  1 1 
        6  5949 1 1 41 PHE CG   C   5.332   1.859  -1.023 1.00 . A A . 41 PHE CG   1 1 
        6  5950 1 1 41 PHE CZ   C   7.642   1.001   0.260 1.00 . A A . 41 PHE CZ   1 1 
        6  5951 1 1 41 PHE H    H   3.254   0.257  -3.637 1.00 . A A . 41 PHE H    1 1 
        6  5952 1 1 41 PHE HA   H   2.834   0.843  -0.805 1.00 . A A . 41 PHE HA   1 1 
        6  5953 1 1 41 PHE HB2  H   4.352   2.624  -2.718 1.00 . A A . 41 PHE HB2  1 1 
        6  5954 1 1 41 PHE HB3  H   3.701   3.181  -1.180 1.00 . A A . 41 PHE HB3  1 1 
        6  5955 1 1 41 PHE HD1  H   6.091   0.823  -2.727 1.00 . A A . 41 PHE HD1  1 1 
        6  5956 1 1 41 PHE HD2  H   4.846   2.794   0.834 1.00 . A A . 41 PHE HD2  1 1 
        6  5957 1 1 41 PHE HE1  H   8.138   0.060  -1.593 1.00 . A A . 41 PHE HE1  1 1 
        6  5958 1 1 41 PHE HE2  H   6.891   2.035   1.973 1.00 . A A . 41 PHE HE2  1 1 
        6  5959 1 1 41 PHE HZ   H   8.540   0.666   0.759 1.00 . A A . 41 PHE HZ   1 1 
        6  5960 1 1 41 PHE N    N   3.401   0.170  -2.672 1.00 . A A . 41 PHE N    1 1 
        6  5961 1 1 41 PHE O    O   1.627   2.447  -3.368 1.00 . A A . 41 PHE O    1 1 
        6  5962 1 1 42 LEU C    C  -0.796   3.757  -1.314 1.00 . A A . 42 LEU C    1 1 
        6  5963 1 1 42 LEU CA   C  -0.657   2.324  -1.812 1.00 . A A . 42 LEU CA   1 1 
        6  5964 1 1 42 LEU CB   C  -1.781   1.458  -1.234 1.00 . A A . 42 LEU CB   1 1 
        6  5965 1 1 42 LEU CD1  C  -0.622  -0.320   0.123 1.00 . A A . 42 LEU CD1  1 1 
        6  5966 1 1 42 LEU CD2  C  -0.972   1.969   1.094 1.00 . A A . 42 LEU CD2  1 1 
        6  5967 1 1 42 LEU CG   C  -1.535   0.896   0.171 1.00 . A A . 42 LEU CG   1 1 
        6  5968 1 1 42 LEU H    H   0.747   1.309  -0.605 1.00 . A A . 42 LEU H    1 1 
        6  5969 1 1 42 LEU HA   H  -0.734   2.323  -2.888 1.00 . A A . 42 LEU HA   1 1 
        6  5970 1 1 42 LEU HB2  H  -2.681   2.052  -1.207 1.00 . A A . 42 LEU HB2  1 1 
        6  5971 1 1 42 LEU HB3  H  -1.942   0.626  -1.904 1.00 . A A . 42 LEU HB3  1 1 
        6  5972 1 1 42 LEU HD11 H  -1.190  -1.206   0.364 1.00 . A A . 42 LEU HD11 1 1 
        6  5973 1 1 42 LEU HD12 H   0.177  -0.200   0.839 1.00 . A A . 42 LEU HD12 1 1 
        6  5974 1 1 42 LEU HD13 H  -0.205  -0.419  -0.868 1.00 . A A . 42 LEU HD13 1 1 
        6  5975 1 1 42 LEU HD21 H  -1.103   1.662   2.122 1.00 . A A . 42 LEU HD21 1 1 
        6  5976 1 1 42 LEU HD22 H  -1.496   2.899   0.928 1.00 . A A . 42 LEU HD22 1 1 
        6  5977 1 1 42 LEU HD23 H   0.078   2.108   0.893 1.00 . A A . 42 LEU HD23 1 1 
        6  5978 1 1 42 LEU HG   H  -2.476   0.576   0.578 1.00 . A A . 42 LEU HG   1 1 
        6  5979 1 1 42 LEU N    N   0.642   1.771  -1.461 1.00 . A A . 42 LEU N    1 1 
        6  5980 1 1 42 LEU O    O  -0.158   4.152  -0.336 1.00 . A A . 42 LEU O    1 1 
        6  5981 1 1 43 THR C    C  -3.302   6.133  -1.168 1.00 . A A . 43 THR C    1 1 
        6  5982 1 1 43 THR CA   C  -1.860   5.924  -1.618 1.00 . A A . 43 THR CA   1 1 
        6  5983 1 1 43 THR CB   C  -1.538   6.853  -2.789 1.00 . A A . 43 THR CB   1 1 
        6  5984 1 1 43 THR CG2  C  -1.395   8.303  -2.379 1.00 . A A . 43 THR CG2  1 1 
        6  5985 1 1 43 THR H    H  -2.115   4.162  -2.761 1.00 . A A . 43 THR H    1 1 
        6  5986 1 1 43 THR HA   H  -1.203   6.155  -0.794 1.00 . A A . 43 THR HA   1 1 
        6  5987 1 1 43 THR HB   H  -2.336   6.790  -3.515 1.00 . A A . 43 THR HB   1 1 
        6  5988 1 1 43 THR HG1  H  -0.136   7.067  -4.140 1.00 . A A . 43 THR HG1  1 1 
        6  5989 1 1 43 THR HG21 H  -2.234   8.868  -2.759 1.00 . A A . 43 THR HG21 1 1 
        6  5990 1 1 43 THR HG22 H  -0.478   8.704  -2.783 1.00 . A A . 43 THR HG22 1 1 
        6  5991 1 1 43 THR HG23 H  -1.373   8.372  -1.300 1.00 . A A . 43 THR HG23 1 1 
        6  5992 1 1 43 THR N    N  -1.634   4.534  -1.992 1.00 . A A . 43 THR N    1 1 
        6  5993 1 1 43 THR O    O  -4.238   5.956  -1.949 1.00 . A A . 43 THR O    1 1 
        6  5994 1 1 43 THR OG1  O  -0.330   6.464  -3.418 1.00 . A A . 43 THR OG1  1 1 
        6  5995 1 1 44 ILE C    C  -5.256   8.175   0.407 1.00 . A A . 44 ILE C    1 1 
        6  5996 1 1 44 ILE CA   C  -4.800   6.741   0.650 1.00 . A A . 44 ILE CA   1 1 
        6  5997 1 1 44 ILE CB   C  -4.836   6.452   2.162 1.00 . A A . 44 ILE CB   1 1 
        6  5998 1 1 44 ILE CD1  C  -4.165   4.752   3.934 1.00 . A A . 44 ILE CD1  1 1 
        6  5999 1 1 44 ILE CG1  C  -4.223   5.082   2.459 1.00 . A A . 44 ILE CG1  1 1 
        6  6000 1 1 44 ILE CG2  C  -6.265   6.521   2.681 1.00 . A A . 44 ILE CG2  1 1 
        6  6001 1 1 44 ILE H    H  -2.685   6.633   0.668 1.00 . A A . 44 ILE H    1 1 
        6  6002 1 1 44 ILE HA   H  -5.488   6.067   0.159 1.00 . A A . 44 ILE HA   1 1 
        6  6003 1 1 44 ILE HB   H  -4.260   7.214   2.666 1.00 . A A . 44 ILE HB   1 1 
        6  6004 1 1 44 ILE HD11 H  -3.520   5.458   4.436 1.00 . A A . 44 ILE HD11 1 1 
        6  6005 1 1 44 ILE HD12 H  -3.776   3.753   4.064 1.00 . A A . 44 ILE HD12 1 1 
        6  6006 1 1 44 ILE HD13 H  -5.158   4.809   4.355 1.00 . A A . 44 ILE HD13 1 1 
        6  6007 1 1 44 ILE HG12 H  -4.810   4.319   1.971 1.00 . A A . 44 ILE HG12 1 1 
        6  6008 1 1 44 ILE HG13 H  -3.215   5.055   2.072 1.00 . A A . 44 ILE HG13 1 1 
        6  6009 1 1 44 ILE HG21 H  -6.267   6.943   3.676 1.00 . A A . 44 ILE HG21 1 1 
        6  6010 1 1 44 ILE HG22 H  -6.686   5.527   2.711 1.00 . A A . 44 ILE HG22 1 1 
        6  6011 1 1 44 ILE HG23 H  -6.857   7.144   2.025 1.00 . A A . 44 ILE HG23 1 1 
        6  6012 1 1 44 ILE N    N  -3.473   6.509   0.095 1.00 . A A . 44 ILE N    1 1 
        6  6013 1 1 44 ILE O    O  -4.654   9.122   0.913 1.00 . A A . 44 ILE O    1 1 
        6  6014 1 1 45 ASN C    C  -7.864  10.084   0.395 1.00 . A A . 45 ASN C    1 1 
        6  6015 1 1 45 ASN CA   C  -6.866   9.644  -0.673 1.00 . A A . 45 ASN CA   1 1 
        6  6016 1 1 45 ASN CB   C  -7.544   9.636  -2.045 1.00 . A A . 45 ASN CB   1 1 
        6  6017 1 1 45 ASN CG   C  -6.654   9.048  -3.123 1.00 . A A . 45 ASN CG   1 1 
        6  6018 1 1 45 ASN H    H  -6.763   7.532  -0.738 1.00 . A A . 45 ASN H    1 1 
        6  6019 1 1 45 ASN HA   H  -6.043  10.344  -0.691 1.00 . A A . 45 ASN HA   1 1 
        6  6020 1 1 45 ASN HB2  H  -8.447   9.049  -1.991 1.00 . A A . 45 ASN HB2  1 1 
        6  6021 1 1 45 ASN HB3  H  -7.792  10.649  -2.323 1.00 . A A . 45 ASN HB3  1 1 
        6  6022 1 1 45 ASN HD21 H  -8.255   8.541  -4.195 1.00 . A A . 45 ASN HD21 1 1 
        6  6023 1 1 45 ASN HD22 H  -6.717   8.132  -4.890 1.00 . A A . 45 ASN HD22 1 1 
        6  6024 1 1 45 ASN N    N  -6.326   8.326  -0.367 1.00 . A A . 45 ASN N    1 1 
        6  6025 1 1 45 ASN ND2  N  -7.271   8.521  -4.175 1.00 . A A . 45 ASN ND2  1 1 
        6  6026 1 1 45 ASN O    O  -8.220   9.308   1.281 1.00 . A A . 45 ASN O    1 1 
        6  6027 1 1 45 ASN OD1  O  -5.428   9.067  -3.013 1.00 . A A . 45 ASN OD1  1 1 
        6  6028 1 1 46 ALA C    C -10.700  11.570   0.849 1.00 . A A . 46 ALA C    1 1 
        6  6029 1 1 46 ALA CA   C  -9.266  11.875   1.263 1.00 . A A . 46 ALA CA   1 1 
        6  6030 1 1 46 ALA CB   C  -9.067  13.374   1.410 1.00 . A A . 46 ALA CB   1 1 
        6  6031 1 1 46 ALA H    H  -7.988  11.904  -0.426 1.00 . A A . 46 ALA H    1 1 
        6  6032 1 1 46 ALA HA   H  -9.073  11.415   2.220 1.00 . A A . 46 ALA HA   1 1 
        6  6033 1 1 46 ALA HB1  H -10.010  13.843   1.627 1.00 . A A . 46 ALA HB1  1 1 
        6  6034 1 1 46 ALA HB2  H  -8.669  13.776   0.490 1.00 . A A . 46 ALA HB2  1 1 
        6  6035 1 1 46 ALA HB3  H  -8.376  13.568   2.216 1.00 . A A . 46 ALA HB3  1 1 
        6  6036 1 1 46 ALA N    N  -8.309  11.333   0.304 1.00 . A A . 46 ALA N    1 1 
        6  6037 1 1 46 ALA O    O -11.650  12.043   1.479 1.00 . A A . 46 ALA O    1 1 
        6  6038 1 1 47 ASP C    C -12.500   8.958  -0.384 1.00 . A A . 47 ASP C    1 1 
        6  6039 1 1 47 ASP CA   C -12.180  10.415  -0.700 1.00 . A A . 47 ASP CA   1 1 
        6  6040 1 1 47 ASP CB   C -12.280  10.652  -2.212 1.00 . A A . 47 ASP CB   1 1 
        6  6041 1 1 47 ASP CG   C -10.930  10.707  -2.899 1.00 . A A . 47 ASP CG   1 1 
        6  6042 1 1 47 ASP H    H -10.080  10.431  -0.671 1.00 . A A . 47 ASP H    1 1 
        6  6043 1 1 47 ASP HA   H -12.900  11.044  -0.200 1.00 . A A . 47 ASP HA   1 1 
        6  6044 1 1 47 ASP HB2  H -12.850   9.848  -2.654 1.00 . A A . 47 ASP HB2  1 1 
        6  6045 1 1 47 ASP HB3  H -12.790  11.589  -2.389 1.00 . A A . 47 ASP HB3  1 1 
        6  6046 1 1 47 ASP N    N -10.860  10.779  -0.209 1.00 . A A . 47 ASP N    1 1 
        6  6047 1 1 47 ASP O    O -13.660   8.548  -0.407 1.00 . A A . 47 ASP O    1 1 
        6  6048 1 1 47 ASP OD1  O -10.310  11.792  -2.901 1.00 . A A . 47 ASP OD1  1 1 
        6  6049 1 1 47 ASP OD2  O -10.490   9.666  -3.434 1.00 . A A . 47 ASP OD2  1 1 
        6  6050 1 1 48 GLY C    C -11.130   5.864  -0.879 1.00 . A A . 48 GLY C    1 1 
        6  6051 1 1 48 GLY CA   C -11.660   6.774   0.214 1.00 . A A . 48 GLY CA   1 1 
        6  6052 1 1 48 GLY H    H -10.570   8.558  -0.096 1.00 . A A . 48 GLY H    1 1 
        6  6053 1 1 48 GLY HA2  H -11.140   6.546   1.138 1.00 . A A . 48 GLY HA2  1 1 
        6  6054 1 1 48 GLY HA3  H -12.720   6.584   0.344 1.00 . A A . 48 GLY HA3  1 1 
        6  6055 1 1 48 GLY N    N -11.470   8.177  -0.094 1.00 . A A . 48 GLY N    1 1 
        6  6056 1 1 48 GLY O    O -11.430   4.669  -0.898 1.00 . A A . 48 GLY O    1 1 
        6  6057 1 1 49 SER C    C  -8.300   5.371  -2.639 1.00 . A A . 49 SER C    1 1 
        6  6058 1 1 49 SER CA   C  -9.776   5.659  -2.889 1.00 . A A . 49 SER CA   1 1 
        6  6059 1 1 49 SER CB   C  -9.949   6.408  -4.208 1.00 . A A . 49 SER CB   1 1 
        6  6060 1 1 49 SER H    H -10.140   7.385  -1.724 1.00 . A A . 49 SER H    1 1 
        6  6061 1 1 49 SER HA   H -10.300   4.726  -2.950 1.00 . A A . 49 SER HA   1 1 
        6  6062 1 1 49 SER HB2  H -10.420   7.355  -4.018 1.00 . A A . 49 SER HB2  1 1 
        6  6063 1 1 49 SER HB3  H  -8.981   6.573  -4.654 1.00 . A A . 49 SER HB3  1 1 
        6  6064 1 1 49 SER HG   H -10.220   5.438  -5.887 1.00 . A A . 49 SER HG   1 1 
        6  6065 1 1 49 SER N    N -10.340   6.430  -1.791 1.00 . A A . 49 SER N    1 1 
        6  6066 1 1 49 SER O    O  -7.500   6.288  -2.451 1.00 . A A . 49 SER O    1 1 
        6  6067 1 1 49 SER OG   O -10.740   5.669  -5.113 1.00 . A A . 49 SER OG   1 1 
        6  6068 1 1 50 VAL C    C  -6.004   2.955  -3.626 1.00 . A A . 50 VAL C    1 1 
        6  6069 1 1 50 VAL CA   C  -6.565   3.682  -2.410 1.00 . A A . 50 VAL CA   1 1 
        6  6070 1 1 50 VAL CB   C  -6.442   2.762  -1.176 1.00 . A A . 50 VAL CB   1 1 
        6  6071 1 1 50 VAL CG1  C  -5.014   2.761  -0.657 1.00 . A A . 50 VAL CG1  1 1 
        6  6072 1 1 50 VAL CG2  C  -7.411   3.189  -0.083 1.00 . A A . 50 VAL CG2  1 1 
        6  6073 1 1 50 VAL H    H  -8.628   3.407  -2.793 1.00 . A A . 50 VAL H    1 1 
        6  6074 1 1 50 VAL HA   H  -5.977   4.569  -2.230 1.00 . A A . 50 VAL HA   1 1 
        6  6075 1 1 50 VAL HB   H  -6.692   1.756  -1.477 1.00 . A A . 50 VAL HB   1 1 
        6  6076 1 1 50 VAL HG11 H  -4.739   1.759  -0.361 1.00 . A A . 50 VAL HG11 1 1 
        6  6077 1 1 50 VAL HG12 H  -4.941   3.421   0.195 1.00 . A A . 50 VAL HG12 1 1 
        6  6078 1 1 50 VAL HG13 H  -4.348   3.102  -1.434 1.00 . A A . 50 VAL HG13 1 1 
        6  6079 1 1 50 VAL HG21 H  -7.219   2.616   0.813 1.00 . A A . 50 VAL HG21 1 1 
        6  6080 1 1 50 VAL HG22 H  -8.424   3.013  -0.411 1.00 . A A . 50 VAL HG22 1 1 
        6  6081 1 1 50 VAL HG23 H  -7.278   4.240   0.127 1.00 . A A . 50 VAL HG23 1 1 
        6  6082 1 1 50 VAL N    N  -7.946   4.092  -2.637 1.00 . A A . 50 VAL N    1 1 
        6  6083 1 1 50 VAL O    O  -6.513   1.907  -4.026 1.00 . A A . 50 VAL O    1 1 
        6  6084 1 1 51 TYR C    C  -2.888   2.494  -5.082 1.00 . A A . 51 TYR C    1 1 
        6  6085 1 1 51 TYR CA   C  -4.322   2.917  -5.387 1.00 . A A . 51 TYR CA   1 1 
        6  6086 1 1 51 TYR CB   C  -4.346   3.898  -6.563 1.00 . A A . 51 TYR CB   1 1 
        6  6087 1 1 51 TYR CD1  C  -2.035   4.908  -6.668 1.00 . A A . 51 TYR CD1  1 1 
        6  6088 1 1 51 TYR CD2  C  -3.845   6.310  -6.008 1.00 . A A . 51 TYR CD2  1 1 
        6  6089 1 1 51 TYR CE1  C  -1.157   5.967  -6.531 1.00 . A A . 51 TYR CE1  1 1 
        6  6090 1 1 51 TYR CE2  C  -2.974   7.375  -5.868 1.00 . A A . 51 TYR CE2  1 1 
        6  6091 1 1 51 TYR CG   C  -3.390   5.061  -6.409 1.00 . A A . 51 TYR CG   1 1 
        6  6092 1 1 51 TYR CZ   C  -1.633   7.198  -6.131 1.00 . A A . 51 TYR CZ   1 1 
        6  6093 1 1 51 TYR H    H  -4.588   4.351  -3.850 1.00 . A A . 51 TYR H    1 1 
        6  6094 1 1 51 TYR HA   H  -4.893   2.038  -5.654 1.00 . A A . 51 TYR HA   1 1 
        6  6095 1 1 51 TYR HB2  H  -4.081   3.370  -7.467 1.00 . A A . 51 TYR HB2  1 1 
        6  6096 1 1 51 TYR HB3  H  -5.343   4.300  -6.666 1.00 . A A . 51 TYR HB3  1 1 
        6  6097 1 1 51 TYR HD1  H  -1.665   3.943  -6.983 1.00 . A A . 51 TYR HD1  1 1 
        6  6098 1 1 51 TYR HD2  H  -4.897   6.445  -5.801 1.00 . A A . 51 TYR HD2  1 1 
        6  6099 1 1 51 TYR HE1  H  -0.106   5.828  -6.737 1.00 . A A . 51 TYR HE1  1 1 
        6  6100 1 1 51 TYR HE2  H  -3.346   8.339  -5.553 1.00 . A A . 51 TYR HE2  1 1 
        6  6101 1 1 51 TYR HH   H  -0.889   8.665  -5.134 1.00 . A A . 51 TYR HH   1 1 
        6  6102 1 1 51 TYR N    N  -4.951   3.515  -4.213 1.00 . A A . 51 TYR N    1 1 
        6  6103 1 1 51 TYR O    O  -2.173   3.176  -4.349 1.00 . A A . 51 TYR O    1 1 
        6  6104 1 1 51 TYR OH   O  -0.763   8.255  -5.993 1.00 . A A . 51 TYR OH   1 1 
        6  6105 1 1 52 ALA C    C  -0.246   1.092  -6.658 1.00 . A A . 52 ALA C    1 1 
        6  6106 1 1 52 ALA CA   C  -1.128   0.850  -5.438 1.00 . A A . 52 ALA CA   1 1 
        6  6107 1 1 52 ALA CB   C  -1.175  -0.632  -5.106 1.00 . A A . 52 ALA CB   1 1 
        6  6108 1 1 52 ALA H    H  -3.094   0.864  -6.224 1.00 . A A . 52 ALA H    1 1 
        6  6109 1 1 52 ALA HA   H  -0.702   1.370  -4.592 1.00 . A A . 52 ALA HA   1 1 
        6  6110 1 1 52 ALA HB1  H  -1.893  -1.124  -5.747 1.00 . A A . 52 ALA HB1  1 1 
        6  6111 1 1 52 ALA HB2  H  -1.467  -0.761  -4.074 1.00 . A A . 52 ALA HB2  1 1 
        6  6112 1 1 52 ALA HB3  H  -0.198  -1.068  -5.261 1.00 . A A . 52 ALA HB3  1 1 
        6  6113 1 1 52 ALA N    N  -2.476   1.364  -5.650 1.00 . A A . 52 ALA N    1 1 
        6  6114 1 1 52 ALA O    O  -0.741   1.266  -7.771 1.00 . A A . 52 ALA O    1 1 
        6  6115 1 1 53 GLU C    C   3.383   0.730  -7.162 1.00 . A A . 53 GLU C    1 1 
        6  6116 1 1 53 GLU CA   C   2.021   1.320  -7.518 1.00 . A A . 53 GLU CA   1 1 
        6  6117 1 1 53 GLU CB   C   2.157   2.815  -7.812 1.00 . A A . 53 GLU CB   1 1 
        6  6118 1 1 53 GLU CD   C   2.789   5.099  -6.938 1.00 . A A . 53 GLU CD   1 1 
        6  6119 1 1 53 GLU CG   C   2.789   3.605  -6.678 1.00 . A A . 53 GLU CG   1 1 
        6  6120 1 1 53 GLU H    H   1.397   0.954  -5.528 1.00 . A A . 53 GLU H    1 1 
        6  6121 1 1 53 GLU HA   H   1.645   0.821  -8.399 1.00 . A A . 53 GLU HA   1 1 
        6  6122 1 1 53 GLU HB2  H   2.767   2.942  -8.694 1.00 . A A . 53 GLU HB2  1 1 
        6  6123 1 1 53 GLU HB3  H   1.176   3.224  -8.003 1.00 . A A . 53 GLU HB3  1 1 
        6  6124 1 1 53 GLU HG2  H   2.235   3.414  -5.772 1.00 . A A . 53 GLU HG2  1 1 
        6  6125 1 1 53 GLU HG3  H   3.810   3.276  -6.554 1.00 . A A . 53 GLU HG3  1 1 
        6  6126 1 1 53 GLU N    N   1.064   1.101  -6.439 1.00 . A A . 53 GLU N    1 1 
        6  6127 1 1 53 GLU O    O   3.655   0.431  -6.000 1.00 . A A . 53 GLU O    1 1 
        6  6128 1 1 53 GLU OE1  O   1.984   5.556  -7.777 1.00 . A A . 53 GLU OE1  1 1 
        6  6129 1 1 53 GLU OE2  O   3.594   5.812  -6.304 1.00 . A A . 53 GLU OE2  1 1 
        6  6130 1 1 54 GLU C    C   6.643   1.053  -8.244 1.00 . A A . 54 GLU C    1 1 
        6  6131 1 1 54 GLU CA   C   5.566   0.011  -7.960 1.00 . A A . 54 GLU CA   1 1 
        6  6132 1 1 54 GLU CB   C   5.777  -1.213  -8.853 1.00 . A A . 54 GLU CB   1 1 
        6  6133 1 1 54 GLU CD   C   8.179  -1.895  -8.466 1.00 . A A . 54 GLU CD   1 1 
        6  6134 1 1 54 GLU CG   C   6.719  -2.247  -8.255 1.00 . A A . 54 GLU CG   1 1 
        6  6135 1 1 54 GLU H    H   3.959   0.823  -9.074 1.00 . A A . 54 GLU H    1 1 
        6  6136 1 1 54 GLU HA   H   5.641  -0.292  -6.926 1.00 . A A . 54 GLU HA   1 1 
        6  6137 1 1 54 GLU HB2  H   4.823  -1.686  -9.027 1.00 . A A . 54 GLU HB2  1 1 
        6  6138 1 1 54 GLU HB3  H   6.187  -0.889  -9.798 1.00 . A A . 54 GLU HB3  1 1 
        6  6139 1 1 54 GLU HG2  H   6.531  -2.316  -7.194 1.00 . A A . 54 GLU HG2  1 1 
        6  6140 1 1 54 GLU HG3  H   6.523  -3.203  -8.718 1.00 . A A . 54 GLU HG3  1 1 
        6  6141 1 1 54 GLU N    N   4.234   0.566  -8.169 1.00 . A A . 54 GLU N    1 1 
        6  6142 1 1 54 GLU O    O   6.501   1.878  -9.147 1.00 . A A . 54 GLU O    1 1 
        6  6143 1 1 54 GLU OE1  O   8.474  -1.123  -9.402 1.00 . A A . 54 GLU OE1  1 1 
        6  6144 1 1 54 GLU OE2  O   9.025  -2.393  -7.695 1.00 . A A . 54 GLU OE2  1 1 
        6  6145 1 1 55 VAL C    C  10.048   1.252  -8.226 1.00 . A A . 55 VAL C    1 1 
        6  6146 1 1 55 VAL CA   C   8.824   1.945  -7.636 1.00 . A A . 55 VAL CA   1 1 
        6  6147 1 1 55 VAL CB   C   9.217   2.597  -6.297 1.00 . A A . 55 VAL CB   1 1 
        6  6148 1 1 55 VAL CG1  C  10.220   3.718  -6.522 1.00 . A A . 55 VAL CG1  1 1 
        6  6149 1 1 55 VAL CG2  C   7.983   3.115  -5.573 1.00 . A A . 55 VAL CG2  1 1 
        6  6150 1 1 55 VAL H    H   7.777   0.325  -6.767 1.00 . A A . 55 VAL H    1 1 
        6  6151 1 1 55 VAL HA   H   8.502   2.723  -8.313 1.00 . A A . 55 VAL HA   1 1 
        6  6152 1 1 55 VAL HB   H   9.683   1.846  -5.677 1.00 . A A . 55 VAL HB   1 1 
        6  6153 1 1 55 VAL HG11 H  10.742   3.924  -5.599 1.00 . A A . 55 VAL HG11 1 1 
        6  6154 1 1 55 VAL HG12 H   9.700   4.606  -6.849 1.00 . A A . 55 VAL HG12 1 1 
        6  6155 1 1 55 VAL HG13 H  10.930   3.419  -7.279 1.00 . A A . 55 VAL HG13 1 1 
        6  6156 1 1 55 VAL HG21 H   8.283   3.783  -4.781 1.00 . A A . 55 VAL HG21 1 1 
        6  6157 1 1 55 VAL HG22 H   7.437   2.281  -5.153 1.00 . A A . 55 VAL HG22 1 1 
        6  6158 1 1 55 VAL HG23 H   7.350   3.642  -6.270 1.00 . A A . 55 VAL HG23 1 1 
        6  6159 1 1 55 VAL N    N   7.722   1.007  -7.468 1.00 . A A . 55 VAL N    1 1 
        6  6160 1 1 55 VAL O    O  10.361   0.116  -7.868 1.00 . A A . 55 VAL O    1 1 
        6  6161 1 1 56 LYS C    C  13.095   2.368  -9.681 1.00 . A A . 56 LYS C    1 1 
        6  6162 1 1 56 LYS CA   C  11.925   1.388  -9.769 1.00 . A A . 56 LYS CA   1 1 
        6  6163 1 1 56 LYS CB   C  11.634   1.054 -11.234 1.00 . A A . 56 LYS CB   1 1 
        6  6164 1 1 56 LYS CD   C  12.102  -1.342 -11.831 1.00 . A A . 56 LYS CD   1 1 
        6  6165 1 1 56 LYS CE   C  12.789  -2.183 -10.767 1.00 . A A . 56 LYS CE   1 1 
        6  6166 1 1 56 LYS CG   C  12.630   0.083 -11.846 1.00 . A A . 56 LYS CG   1 1 
        6  6167 1 1 56 LYS H    H  10.436   2.841  -9.376 1.00 . A A . 56 LYS H    1 1 
        6  6168 1 1 56 LYS HA   H  12.186   0.480  -9.249 1.00 . A A . 56 LYS HA   1 1 
        6  6169 1 1 56 LYS HB2  H  10.650   0.619 -11.303 1.00 . A A . 56 LYS HB2  1 1 
        6  6170 1 1 56 LYS HB3  H  11.655   1.968 -11.810 1.00 . A A . 56 LYS HB3  1 1 
        6  6171 1 1 56 LYS HD2  H  11.041  -1.322 -11.628 1.00 . A A . 56 LYS HD2  1 1 
        6  6172 1 1 56 LYS HD3  H  12.276  -1.791 -12.798 1.00 . A A . 56 LYS HD3  1 1 
        6  6173 1 1 56 LYS HE2  H  13.766  -1.765 -10.572 1.00 . A A . 56 LYS HE2  1 1 
        6  6174 1 1 56 LYS HE3  H  12.198  -2.150  -9.862 1.00 . A A . 56 LYS HE3  1 1 
        6  6175 1 1 56 LYS HG2  H  12.821   0.375 -12.868 1.00 . A A . 56 LYS HG2  1 1 
        6  6176 1 1 56 LYS HG3  H  13.551   0.123 -11.282 1.00 . A A . 56 LYS HG3  1 1 
        6  6177 1 1 56 LYS HZ1  H  12.969  -3.661 -12.231 1.00 . A A . 56 LYS HZ1  1 1 
        6  6178 1 1 56 LYS HZ2  H  12.149  -4.170 -10.842 1.00 . A A . 56 LYS HZ2  1 1 
        6  6179 1 1 56 LYS HZ3  H  13.831  -3.992 -10.812 1.00 . A A . 56 LYS HZ3  1 1 
        6  6180 1 1 56 LYS N    N  10.736   1.940  -9.131 1.00 . A A . 56 LYS N    1 1 
        6  6181 1 1 56 LYS NZ   N  12.946  -3.600 -11.194 1.00 . A A . 56 LYS NZ   1 1 
        6  6182 1 1 56 LYS O    O  12.967   3.530 -10.067 1.00 . A A . 56 LYS O    1 1 
        6  6183 1 1 57 PRO C    C  16.087   3.069 -10.389 1.00 . A A . 57 PRO C    1 1 
        6  6184 1 1 57 PRO CA   C  15.443   2.762  -9.042 1.00 . A A . 57 PRO CA   1 1 
        6  6185 1 1 57 PRO CB   C  16.385   1.924  -8.177 1.00 . A A . 57 PRO CB   1 1 
        6  6186 1 1 57 PRO CD   C  14.502   0.542  -8.688 1.00 . A A . 57 PRO CD   1 1 
        6  6187 1 1 57 PRO CG   C  15.987   0.515  -8.446 1.00 . A A . 57 PRO CG   1 1 
        6  6188 1 1 57 PRO HA   H  15.213   3.689  -8.534 1.00 . A A . 57 PRO HA   1 1 
        6  6189 1 1 57 PRO HB2  H  17.408   2.110  -8.470 1.00 . A A . 57 PRO HB2  1 1 
        6  6190 1 1 57 PRO HB3  H  16.250   2.180  -7.138 1.00 . A A . 57 PRO HB3  1 1 
        6  6191 1 1 57 PRO HD2  H  14.230  -0.188  -9.438 1.00 . A A . 57 PRO HD2  1 1 
        6  6192 1 1 57 PRO HD3  H  13.967   0.355  -7.769 1.00 . A A . 57 PRO HD3  1 1 
        6  6193 1 1 57 PRO HG2  H  16.502   0.147  -9.321 1.00 . A A . 57 PRO HG2  1 1 
        6  6194 1 1 57 PRO HG3  H  16.215  -0.102  -7.588 1.00 . A A . 57 PRO HG3  1 1 
        6  6195 1 1 57 PRO N    N  14.255   1.912  -9.172 1.00 . A A . 57 PRO N    1 1 
        6  6196 1 1 57 PRO O    O  15.504   2.807 -11.441 1.00 . A A . 57 PRO O    1 1 
        6  6197 1 1 58 ASP C    C  19.357   3.232 -11.629 1.00 . A A . 58 ASP C    1 1 
        6  6198 1 1 58 ASP CA   C  18.018   3.965 -11.570 1.00 . A A . 58 ASP CA   1 1 
        6  6199 1 1 58 ASP CB   C  18.242   5.479 -11.647 1.00 . A A . 58 ASP CB   1 1 
        6  6200 1 1 58 ASP CG   C  17.520   6.110 -12.821 1.00 . A A . 58 ASP CG   1 1 
        6  6201 1 1 58 ASP H    H  17.707   3.808  -9.482 1.00 . A A . 58 ASP H    1 1 
        6  6202 1 1 58 ASP HA   H  17.415   3.657 -12.411 1.00 . A A . 58 ASP HA   1 1 
        6  6203 1 1 58 ASP HB2  H  17.879   5.937 -10.738 1.00 . A A . 58 ASP HB2  1 1 
        6  6204 1 1 58 ASP HB3  H  19.301   5.676 -11.751 1.00 . A A . 58 ASP HB3  1 1 
        6  6205 1 1 58 ASP N    N  17.294   3.624 -10.350 1.00 . A A . 58 ASP N    1 1 
        6  6206 1 1 58 ASP O    O  19.969   2.956 -10.598 1.00 . A A . 58 ASP O    1 1 
        6  6207 1 1 58 ASP OD1  O  16.347   5.753 -13.059 1.00 . A A . 58 ASP OD1  1 1 
        6  6208 1 1 58 ASP OD2  O  18.127   6.960 -13.505 1.00 . A A . 58 ASP OD2  1 1 
        6  6209 1 1 59 PRO C    C  22.305   3.084 -12.700 1.00 . A A . 59 PRO C    1 1 
        6  6210 1 1 59 PRO CA   C  21.104   2.205 -13.034 1.00 . A A . 59 PRO CA   1 1 
        6  6211 1 1 59 PRO CB   C  21.097   1.850 -14.523 1.00 . A A . 59 PRO CB   1 1 
        6  6212 1 1 59 PRO CD   C  19.166   3.202 -14.129 1.00 . A A . 59 PRO CD   1 1 
        6  6213 1 1 59 PRO CG   C  20.218   2.876 -15.151 1.00 . A A . 59 PRO CG   1 1 
        6  6214 1 1 59 PRO HA   H  21.147   1.299 -12.445 1.00 . A A . 59 PRO HA   1 1 
        6  6215 1 1 59 PRO HB2  H  22.104   1.900 -14.911 1.00 . A A . 59 PRO HB2  1 1 
        6  6216 1 1 59 PRO HB3  H  20.701   0.856 -14.657 1.00 . A A . 59 PRO HB3  1 1 
        6  6217 1 1 59 PRO HD2  H  18.889   4.244 -14.191 1.00 . A A . 59 PRO HD2  1 1 
        6  6218 1 1 59 PRO HD3  H  18.298   2.572 -14.265 1.00 . A A . 59 PRO HD3  1 1 
        6  6219 1 1 59 PRO HG2  H  20.794   3.756 -15.391 1.00 . A A . 59 PRO HG2  1 1 
        6  6220 1 1 59 PRO HG3  H  19.761   2.471 -16.043 1.00 . A A . 59 PRO HG3  1 1 
        6  6221 1 1 59 PRO N    N  19.831   2.908 -12.846 1.00 . A A . 59 PRO N    1 1 
        6  6222 1 1 59 PRO O    O  22.775   3.853 -13.537 1.00 . A A . 59 PRO O    1 1 
        6  6223 1 1 60 SER C    C  24.359   3.350  -9.613 1.00 . A A . 60 SER C    1 1 
        6  6224 1 1 60 SER CA   C  23.947   3.742 -11.029 1.00 . A A . 60 SER CA   1 1 
        6  6225 1 1 60 SER CB   C  23.623   5.236 -11.084 1.00 . A A . 60 SER CB   1 1 
        6  6226 1 1 60 SER H    H  22.382   2.328 -10.850 1.00 . A A . 60 SER H    1 1 
        6  6227 1 1 60 SER HA   H  24.768   3.535 -11.699 1.00 . A A . 60 SER HA   1 1 
        6  6228 1 1 60 SER HB2  H  22.801   5.400 -11.763 1.00 . A A . 60 SER HB2  1 1 
        6  6229 1 1 60 SER HB3  H  23.349   5.580 -10.097 1.00 . A A . 60 SER HB3  1 1 
        6  6230 1 1 60 SER HG   H  24.882   5.816 -12.467 1.00 . A A . 60 SER HG   1 1 
        6  6231 1 1 60 SER N    N  22.800   2.960 -11.472 1.00 . A A . 60 SER N    1 1 
        6  6232 1 1 60 SER O    O  25.547   3.257  -9.306 1.00 . A A . 60 SER O    1 1 
        6  6233 1 1 60 SER OG   O  24.741   5.984 -11.533 1.00 . A A . 60 SER OG   1 1 
        6  6234 1 1 61 ASN C    C  23.691   1.224  -7.229 1.00 . A A . 61 ASN C    1 1 
        6  6235 1 1 61 ASN CA   C  23.629   2.742  -7.372 1.00 . A A . 61 ASN CA   1 1 
        6  6236 1 1 61 ASN CB   C  22.547   3.310  -6.453 1.00 . A A . 61 ASN CB   1 1 
        6  6237 1 1 61 ASN CG   C  23.047   3.538  -5.042 1.00 . A A . 61 ASN CG   1 1 
        6  6238 1 1 61 ASN H    H  22.443   3.215  -9.060 1.00 . A A . 61 ASN H    1 1 
        6  6239 1 1 61 ASN HA   H  24.585   3.157  -7.088 1.00 . A A . 61 ASN HA   1 1 
        6  6240 1 1 61 ASN HB2  H  22.204   4.254  -6.850 1.00 . A A . 61 ASN HB2  1 1 
        6  6241 1 1 61 ASN HB3  H  21.717   2.619  -6.414 1.00 . A A . 61 ASN HB3  1 1 
        6  6242 1 1 61 ASN HD21 H  23.935   5.228  -5.607 1.00 . A A . 61 ASN HD21 1 1 
        6  6243 1 1 61 ASN HD22 H  24.107   4.807  -3.932 1.00 . A A . 61 ASN HD22 1 1 
        6  6244 1 1 61 ASN N    N  23.370   3.124  -8.756 1.00 . A A . 61 ASN N    1 1 
        6  6245 1 1 61 ASN ND2  N  23.769   4.635  -4.839 1.00 . A A . 61 ASN ND2  1 1 
        6  6246 1 1 61 ASN O    O  22.709   0.588  -6.846 1.00 . A A . 61 ASN O    1 1 
        6  6247 1 1 61 ASN OD1  O  22.789   2.740  -4.141 1.00 . A A . 61 ASN OD1  1 1 
        6  6248 1 1 62 LYS C    C  26.266  -1.125  -6.600 1.00 . A A . 62 LYS C    1 1 
        6  6249 1 1 62 LYS CA   C  25.039  -0.792  -7.443 1.00 . A A . 62 LYS CA   1 1 
        6  6250 1 1 62 LYS CB   C  25.183  -1.401  -8.839 1.00 . A A . 62 LYS CB   1 1 
        6  6251 1 1 62 LYS CD   C  24.274  -1.258 -11.176 1.00 . A A . 62 LYS CD   1 1 
        6  6252 1 1 62 LYS CE   C  24.581  -2.657 -11.689 1.00 . A A . 62 LYS CE   1 1 
        6  6253 1 1 62 LYS CG   C  23.935  -1.268  -9.694 1.00 . A A . 62 LYS CG   1 1 
        6  6254 1 1 62 LYS H    H  25.595   1.213  -7.836 1.00 . A A . 62 LYS H    1 1 
        6  6255 1 1 62 LYS HA   H  24.166  -1.210  -6.965 1.00 . A A . 62 LYS HA   1 1 
        6  6256 1 1 62 LYS HB2  H  25.999  -0.909  -9.350 1.00 . A A . 62 LYS HB2  1 1 
        6  6257 1 1 62 LYS HB3  H  25.416  -2.451  -8.739 1.00 . A A . 62 LYS HB3  1 1 
        6  6258 1 1 62 LYS HD2  H  23.432  -0.862 -11.725 1.00 . A A . 62 LYS HD2  1 1 
        6  6259 1 1 62 LYS HD3  H  25.137  -0.629 -11.334 1.00 . A A . 62 LYS HD3  1 1 
        6  6260 1 1 62 LYS HE2  H  25.529  -2.635 -12.207 1.00 . A A . 62 LYS HE2  1 1 
        6  6261 1 1 62 LYS HE3  H  24.647  -3.330 -10.846 1.00 . A A . 62 LYS HE3  1 1 
        6  6262 1 1 62 LYS HG2  H  23.279  -2.102  -9.491 1.00 . A A . 62 LYS HG2  1 1 
        6  6263 1 1 62 LYS HG3  H  23.435  -0.344  -9.442 1.00 . A A . 62 LYS HG3  1 1 
        6  6264 1 1 62 LYS HZ1  H  23.403  -2.477 -13.404 1.00 . A A . 62 LYS HZ1  1 1 
        6  6265 1 1 62 LYS HZ2  H  22.627  -3.256 -12.119 1.00 . A A . 62 LYS HZ2  1 1 
        6  6266 1 1 62 LYS HZ3  H  23.807  -4.073 -13.014 1.00 . A A . 62 LYS HZ3  1 1 
        6  6267 1 1 62 LYS N    N  24.849   0.651  -7.538 1.00 . A A . 62 LYS N    1 1 
        6  6268 1 1 62 LYS NZ   N  23.531  -3.150 -12.622 1.00 . A A . 62 LYS NZ   1 1 
        6  6269 1 1 62 LYS O    O  27.013  -2.053  -6.911 1.00 . A A . 62 LYS O    1 1 
        6  6270 1 1 63 LYS C    C  27.241  -0.237  -3.201 1.00 . A A . 63 LYS C    1 1 
        6  6271 1 1 63 LYS CA   C  27.607  -0.572  -4.645 1.00 . A A . 63 LYS CA   1 1 
        6  6272 1 1 63 LYS CB   C  28.798   0.276  -5.099 1.00 . A A . 63 LYS CB   1 1 
        6  6273 1 1 63 LYS CD   C  30.823  -0.244  -6.498 1.00 . A A . 63 LYS CD   1 1 
        6  6274 1 1 63 LYS CE   C  32.302  -0.583  -6.398 1.00 . A A . 63 LYS CE   1 1 
        6  6275 1 1 63 LYS CG   C  30.102  -0.501  -5.183 1.00 . A A . 63 LYS CG   1 1 
        6  6276 1 1 63 LYS H    H  25.840   0.366  -5.337 1.00 . A A . 63 LYS H    1 1 
        6  6277 1 1 63 LYS HA   H  27.878  -1.615  -4.701 1.00 . A A . 63 LYS HA   1 1 
        6  6278 1 1 63 LYS HB2  H  28.583   0.684  -6.075 1.00 . A A . 63 LYS HB2  1 1 
        6  6279 1 1 63 LYS HB3  H  28.934   1.090  -4.402 1.00 . A A . 63 LYS HB3  1 1 
        6  6280 1 1 63 LYS HD2  H  30.376  -0.855  -7.267 1.00 . A A . 63 LYS HD2  1 1 
        6  6281 1 1 63 LYS HD3  H  30.716   0.799  -6.755 1.00 . A A . 63 LYS HD3  1 1 
        6  6282 1 1 63 LYS HE2  H  32.575  -0.644  -5.356 1.00 . A A . 63 LYS HE2  1 1 
        6  6283 1 1 63 LYS HE3  H  32.472  -1.538  -6.873 1.00 . A A . 63 LYS HE3  1 1 
        6  6284 1 1 63 LYS HG2  H  30.743  -0.200  -4.369 1.00 . A A . 63 LYS HG2  1 1 
        6  6285 1 1 63 LYS HG3  H  29.885  -1.558  -5.103 1.00 . A A . 63 LYS HG3  1 1 
        6  6286 1 1 63 LYS HZ1  H  34.064   0.526  -6.568 1.00 . A A . 63 LYS HZ1  1 1 
        6  6287 1 1 63 LYS HZ2  H  32.676   1.371  -7.037 1.00 . A A . 63 LYS HZ2  1 1 
        6  6288 1 1 63 LYS HZ3  H  33.325   0.183  -8.051 1.00 . A A . 63 LYS HZ3  1 1 
        6  6289 1 1 63 LYS N    N  26.470  -0.359  -5.533 1.00 . A A . 63 LYS N    1 1 
        6  6290 1 1 63 LYS NZ   N  33.152   0.446  -7.061 1.00 . A A . 63 LYS NZ   1 1 
        6  6291 1 1 63 LYS O    O  28.001   0.424  -2.494 1.00 . A A . 63 LYS O    1 1 
        6  6292 1 1 64 THR C    C  26.258  -1.405  -0.427 1.00 . A A . 64 THR C    1 1 
        6  6293 1 1 64 THR CA   C  25.602  -0.447  -1.413 1.00 . A A . 64 THR CA   1 1 
        6  6294 1 1 64 THR CB   C  24.080  -0.585  -1.340 1.00 . A A . 64 THR CB   1 1 
        6  6295 1 1 64 THR CG2  C  23.343   0.627  -1.869 1.00 . A A . 64 THR CG2  1 1 
        6  6296 1 1 64 THR H    H  25.507  -1.217  -3.383 1.00 . A A . 64 THR H    1 1 
        6  6297 1 1 64 THR HA   H  25.876   0.565  -1.151 1.00 . A A . 64 THR HA   1 1 
        6  6298 1 1 64 THR HB   H  23.791  -0.722  -0.307 1.00 . A A . 64 THR HB   1 1 
        6  6299 1 1 64 THR HG1  H  23.279  -2.366  -1.477 1.00 . A A . 64 THR HG1  1 1 
        6  6300 1 1 64 THR HG21 H  23.197   0.522  -2.934 1.00 . A A . 64 THR HG21 1 1 
        6  6301 1 1 64 THR HG22 H  23.923   1.516  -1.671 1.00 . A A . 64 THR HG22 1 1 
        6  6302 1 1 64 THR HG23 H  22.383   0.705  -1.380 1.00 . A A . 64 THR HG23 1 1 
        6  6303 1 1 64 THR N    N  26.069  -0.698  -2.772 1.00 . A A . 64 THR N    1 1 
        6  6304 1 1 64 THR O    O  26.642  -2.518  -0.789 1.00 . A A . 64 THR O    1 1 
        6  6305 1 1 64 THR OG1  O  23.642  -1.712  -2.078 1.00 . A A . 64 THR OG1  1 1 
        6  6306 1 1 65 THR C    C  25.935  -2.537   2.653 1.00 . A A . 65 THR C    1 1 
        6  6307 1 1 65 THR CA   C  26.997  -1.785   1.860 1.00 . A A . 65 THR CA   1 1 
        6  6308 1 1 65 THR CB   C  27.830  -0.912   2.802 1.00 . A A . 65 THR CB   1 1 
        6  6309 1 1 65 THR CG2  C  28.711  -1.711   3.735 1.00 . A A . 65 THR CG2  1 1 
        6  6310 1 1 65 THR H    H  26.062  -0.071   1.047 1.00 . A A . 65 THR H    1 1 
        6  6311 1 1 65 THR HA   H  27.647  -2.501   1.380 1.00 . A A . 65 THR HA   1 1 
        6  6312 1 1 65 THR HB   H  27.162  -0.315   3.406 1.00 . A A . 65 THR HB   1 1 
        6  6313 1 1 65 THR HG1  H  29.169  -0.542   1.422 1.00 . A A . 65 THR HG1  1 1 
        6  6314 1 1 65 THR HG21 H  28.510  -1.422   4.757 1.00 . A A . 65 THR HG21 1 1 
        6  6315 1 1 65 THR HG22 H  29.748  -1.519   3.505 1.00 . A A . 65 THR HG22 1 1 
        6  6316 1 1 65 THR HG23 H  28.504  -2.765   3.614 1.00 . A A . 65 THR HG23 1 1 
        6  6317 1 1 65 THR N    N  26.387  -0.966   0.820 1.00 . A A . 65 THR N    1 1 
        6  6318 1 1 65 THR O    O  26.168  -3.653   3.119 1.00 . A A . 65 THR O    1 1 
        6  6319 1 1 65 THR OG1  O  28.665  -0.038   2.065 1.00 . A A . 65 THR OG1  1 1 
        6  6320 1 1 66 ALA C    C  23.051  -3.682   2.747 1.00 . A A . 66 ALA C    1 1 
        6  6321 1 1 66 ALA CA   C  23.668  -2.533   3.538 1.00 . A A . 66 ALA CA   1 1 
        6  6322 1 1 66 ALA CB   C  22.612  -1.490   3.871 1.00 . A A . 66 ALA CB   1 1 
        6  6323 1 1 66 ALA H    H  24.643  -1.034   2.407 1.00 . A A . 66 ALA H    1 1 
        6  6324 1 1 66 ALA HA   H  24.063  -2.919   4.466 1.00 . A A . 66 ALA HA   1 1 
        6  6325 1 1 66 ALA HB1  H  22.074  -1.794   4.756 1.00 . A A . 66 ALA HB1  1 1 
        6  6326 1 1 66 ALA HB2  H  21.923  -1.400   3.045 1.00 . A A . 66 ALA HB2  1 1 
        6  6327 1 1 66 ALA HB3  H  23.089  -0.538   4.048 1.00 . A A . 66 ALA HB3  1 1 
        6  6328 1 1 66 ALA N    N  24.768  -1.921   2.802 1.00 . A A . 66 ALA N    1 1 
        6  6329 1 1 66 ALA O    O  21.942  -4.122   3.114 1.00 . A A . 66 ALA O    1 1 
        6  6330 1 1 66 ALA OXT  O  23.682  -4.130   1.767 1.00 . A A . 66 ALA OXT  1 1 
        7  6331 1 1  1 MET C    C   0.628  14.165   1.112 1.00 . A A .  1 MET C    1 1 
        7  6332 1 1  1 MET CA   C   0.583  15.574   1.693 1.00 . A A .  1 MET CA   1 1 
        7  6333 1 1  1 MET CB   C   1.669  16.443   1.056 1.00 . A A .  1 MET CB   1 1 
        7  6334 1 1  1 MET CE   C   0.811  19.244  -1.271 1.00 . A A .  1 MET CE   1 1 
        7  6335 1 1  1 MET CG   C   1.461  16.685  -0.429 1.00 . A A .  1 MET CG   1 1 
        7  6336 1 1  1 MET H1   H   0.221  14.784   3.558 1.00 . A A .  1 MET H1   1 1 
        7  6337 1 1  1 MET H2   H   0.495  16.478   3.539 1.00 . A A .  1 MET H2   1 1 
        7  6338 1 1  1 MET H3   H   1.808  15.393   3.336 1.00 . A A .  1 MET H3   1 1 
        7  6339 1 1  1 MET HA   H  -0.384  16.009   1.492 1.00 . A A .  1 MET HA   1 1 
        7  6340 1 1  1 MET HB2  H   1.687  17.400   1.556 1.00 . A A .  1 MET HB2  1 1 
        7  6341 1 1  1 MET HB3  H   2.625  15.960   1.189 1.00 . A A .  1 MET HB3  1 1 
        7  6342 1 1  1 MET HE1  H   0.064  18.693  -1.821 1.00 . A A .  1 MET HE1  1 1 
        7  6343 1 1  1 MET HE2  H   1.101  20.119  -1.835 1.00 . A A .  1 MET HE2  1 1 
        7  6344 1 1  1 MET HE3  H   0.403  19.551  -0.318 1.00 . A A .  1 MET HE3  1 1 
        7  6345 1 1  1 MET HG2  H   1.879  15.854  -0.978 1.00 . A A .  1 MET HG2  1 1 
        7  6346 1 1  1 MET HG3  H   0.401  16.748  -0.625 1.00 . A A .  1 MET HG3  1 1 
        7  6347 1 1  1 MET N    N   0.795  15.556   3.165 1.00 . A A .  1 MET N    1 1 
        7  6348 1 1  1 MET O    O  -0.376  13.655   0.615 1.00 . A A .  1 MET O    1 1 
        7  6349 1 1  1 MET SD   S   2.245  18.205  -1.002 1.00 . A A .  1 MET SD   1 1 
        7  6350 1 1  2 GLU C    C   1.297  11.165   1.560 1.00 . A A .  2 GLU C    1 1 
        7  6351 1 1  2 GLU CA   C   1.975  12.190   0.657 1.00 . A A .  2 GLU CA   1 1 
        7  6352 1 1  2 GLU CB   C   3.464  11.863   0.522 1.00 . A A .  2 GLU CB   1 1 
        7  6353 1 1  2 GLU CD   C   5.453  13.083  -0.450 1.00 . A A .  2 GLU CD   1 1 
        7  6354 1 1  2 GLU CG   C   4.104  12.447  -0.728 1.00 . A A .  2 GLU CG   1 1 
        7  6355 1 1  2 GLU H    H   2.564  13.999   1.585 1.00 . A A .  2 GLU H    1 1 
        7  6356 1 1  2 GLU HA   H   1.517  12.148  -0.321 1.00 . A A .  2 GLU HA   1 1 
        7  6357 1 1  2 GLU HB2  H   3.987  12.253   1.383 1.00 . A A .  2 GLU HB2  1 1 
        7  6358 1 1  2 GLU HB3  H   3.584  10.790   0.494 1.00 . A A .  2 GLU HB3  1 1 
        7  6359 1 1  2 GLU HG2  H   4.239  11.656  -1.450 1.00 . A A .  2 GLU HG2  1 1 
        7  6360 1 1  2 GLU HG3  H   3.445  13.199  -1.136 1.00 . A A .  2 GLU HG3  1 1 
        7  6361 1 1  2 GLU N    N   1.799  13.541   1.176 1.00 . A A .  2 GLU N    1 1 
        7  6362 1 1  2 GLU O    O   1.345  11.274   2.785 1.00 . A A .  2 GLU O    1 1 
        7  6363 1 1  2 GLU OE1  O   5.650  13.587   0.675 1.00 . A A .  2 GLU OE1  1 1 
        7  6364 1 1  2 GLU OE2  O   6.310  13.076  -1.357 1.00 . A A .  2 GLU OE2  1 1 
        7  6365 1 1  3 GLN C    C   0.389   7.739   1.200 1.00 . A A .  3 GLN C    1 1 
        7  6366 1 1  3 GLN CA   C  -0.019   9.122   1.697 1.00 . A A .  3 GLN CA   1 1 
        7  6367 1 1  3 GLN CB   C  -1.534   9.295   1.581 1.00 . A A .  3 GLN CB   1 1 
        7  6368 1 1  3 GLN CD   C  -1.809   9.148   4.089 1.00 . A A .  3 GLN CD   1 1 
        7  6369 1 1  3 GLN CG   C  -2.310   8.683   2.736 1.00 . A A .  3 GLN CG   1 1 
        7  6370 1 1  3 GLN H    H   0.666  10.133  -0.032 1.00 . A A .  3 GLN H    1 1 
        7  6371 1 1  3 GLN HA   H   0.268   9.215   2.733 1.00 . A A .  3 GLN HA   1 1 
        7  6372 1 1  3 GLN HB2  H  -1.759  10.347   1.540 1.00 . A A .  3 GLN HB2  1 1 
        7  6373 1 1  3 GLN HB3  H  -1.867   8.829   0.664 1.00 . A A .  3 GLN HB3  1 1 
        7  6374 1 1  3 GLN HE21 H  -0.686   7.513   4.259 1.00 . A A .  3 GLN HE21 1 1 
        7  6375 1 1  3 GLN HE22 H  -0.606   8.628   5.588 1.00 . A A .  3 GLN HE22 1 1 
        7  6376 1 1  3 GLN HG2  H  -3.350   8.960   2.640 1.00 . A A .  3 GLN HG2  1 1 
        7  6377 1 1  3 GLN HG3  H  -2.219   7.607   2.684 1.00 . A A .  3 GLN HG3  1 1 
        7  6378 1 1  3 GLN N    N   0.668  10.166   0.948 1.00 . A A .  3 GLN N    1 1 
        7  6379 1 1  3 GLN NE2  N  -0.949   8.349   4.708 1.00 . A A .  3 GLN NE2  1 1 
        7  6380 1 1  3 GLN O    O  -0.432   6.824   1.131 1.00 . A A .  3 GLN O    1 1 
        7  6381 1 1  3 GLN OE1  O  -2.193  10.212   4.573 1.00 . A A .  3 GLN OE1  1 1 
        7  6382 1 1  4 ARG C    C   2.742   5.494   1.511 1.00 . A A .  4 ARG C    1 1 
        7  6383 1 1  4 ARG CA   C   2.194   6.333   0.368 1.00 . A A .  4 ARG CA   1 1 
        7  6384 1 1  4 ARG CB   C   3.287   6.577  -0.675 1.00 . A A .  4 ARG CB   1 1 
        7  6385 1 1  4 ARG CD   C   5.536   7.590  -1.149 1.00 . A A .  4 ARG CD   1 1 
        7  6386 1 1  4 ARG CG   C   4.308   7.622  -0.256 1.00 . A A .  4 ARG CG   1 1 
        7  6387 1 1  4 ARG CZ   C   7.517   8.990  -1.580 1.00 . A A .  4 ARG CZ   1 1 
        7  6388 1 1  4 ARG H    H   2.263   8.371   0.940 1.00 . A A .  4 ARG H    1 1 
        7  6389 1 1  4 ARG HA   H   1.385   5.788  -0.094 1.00 . A A .  4 ARG HA   1 1 
        7  6390 1 1  4 ARG HB2  H   3.809   5.648  -0.857 1.00 . A A .  4 ARG HB2  1 1 
        7  6391 1 1  4 ARG HB3  H   2.824   6.906  -1.593 1.00 . A A .  4 ARG HB3  1 1 
        7  6392 1 1  4 ARG HD2  H   6.025   6.636  -1.033 1.00 . A A .  4 ARG HD2  1 1 
        7  6393 1 1  4 ARG HD3  H   5.223   7.711  -2.175 1.00 . A A .  4 ARG HD3  1 1 
        7  6394 1 1  4 ARG HE   H   6.343   9.137   0.025 1.00 . A A .  4 ARG HE   1 1 
        7  6395 1 1  4 ARG HG2  H   3.853   8.600  -0.318 1.00 . A A .  4 ARG HG2  1 1 
        7  6396 1 1  4 ARG HG3  H   4.609   7.428   0.764 1.00 . A A .  4 ARG HG3  1 1 
        7  6397 1 1  4 ARG HH11 H   7.130   7.620  -3.018 1.00 . A A .  4 ARG HH11 1 1 
        7  6398 1 1  4 ARG HH12 H   8.518   8.617  -3.298 1.00 . A A .  4 ARG HH12 1 1 
        7  6399 1 1  4 ARG HH21 H   8.168  10.447  -0.340 1.00 . A A .  4 ARG HH21 1 1 
        7  6400 1 1  4 ARG HH22 H   9.109  10.221  -1.776 1.00 . A A .  4 ARG HH22 1 1 
        7  6401 1 1  4 ARG N    N   1.663   7.600   0.858 1.00 . A A .  4 ARG N    1 1 
        7  6402 1 1  4 ARG NE   N   6.484   8.652  -0.815 1.00 . A A .  4 ARG NE   1 1 
        7  6403 1 1  4 ARG NH1  N   7.740   8.356  -2.725 1.00 . A A .  4 ARG NH1  1 1 
        7  6404 1 1  4 ARG NH2  N   8.332   9.966  -1.201 1.00 . A A .  4 ARG NH2  1 1 
        7  6405 1 1  4 ARG O    O   3.812   5.774   2.051 1.00 . A A .  4 ARG O    1 1 
        7  6406 1 1  5 ILE C    C   2.811   2.214   2.388 1.00 . A A .  5 ILE C    1 1 
        7  6407 1 1  5 ILE CA   C   2.389   3.564   2.945 1.00 . A A .  5 ILE CA   1 1 
        7  6408 1 1  5 ILE CB   C   1.246   3.347   3.957 1.00 . A A .  5 ILE CB   1 1 
        7  6409 1 1  5 ILE CD1  C  -0.909   4.352   4.854 1.00 . A A .  5 ILE CD1  1 1 
        7  6410 1 1  5 ILE CG1  C   0.279   4.524   3.932 1.00 . A A .  5 ILE CG1  1 1 
        7  6411 1 1  5 ILE CG2  C   1.797   3.143   5.362 1.00 . A A .  5 ILE CG2  1 1 
        7  6412 1 1  5 ILE H    H   1.154   4.292   1.396 1.00 . A A .  5 ILE H    1 1 
        7  6413 1 1  5 ILE HA   H   3.226   4.009   3.464 1.00 . A A .  5 ILE HA   1 1 
        7  6414 1 1  5 ILE HB   H   0.714   2.454   3.668 1.00 . A A .  5 ILE HB   1 1 
        7  6415 1 1  5 ILE HD11 H  -1.769   4.850   4.432 1.00 . A A .  5 ILE HD11 1 1 
        7  6416 1 1  5 ILE HD12 H  -0.682   4.782   5.819 1.00 . A A .  5 ILE HD12 1 1 
        7  6417 1 1  5 ILE HD13 H  -1.124   3.300   4.972 1.00 . A A .  5 ILE HD13 1 1 
        7  6418 1 1  5 ILE HG12 H   0.802   5.421   4.228 1.00 . A A .  5 ILE HG12 1 1 
        7  6419 1 1  5 ILE HG13 H  -0.091   4.640   2.929 1.00 . A A .  5 ILE HG13 1 1 
        7  6420 1 1  5 ILE HG21 H   1.218   3.723   6.066 1.00 . A A .  5 ILE HG21 1 1 
        7  6421 1 1  5 ILE HG22 H   2.829   3.464   5.394 1.00 . A A .  5 ILE HG22 1 1 
        7  6422 1 1  5 ILE HG23 H   1.738   2.096   5.623 1.00 . A A .  5 ILE HG23 1 1 
        7  6423 1 1  5 ILE N    N   1.994   4.459   1.869 1.00 . A A .  5 ILE N    1 1 
        7  6424 1 1  5 ILE O    O   2.865   2.020   1.174 1.00 . A A .  5 ILE O    1 1 
        7  6425 1 1  6 THR C    C   2.315  -0.985   2.767 1.00 . A A .  6 THR C    1 1 
        7  6426 1 1  6 THR CA   C   3.518  -0.057   2.893 1.00 . A A .  6 THR CA   1 1 
        7  6427 1 1  6 THR CB   C   4.512  -0.622   3.910 1.00 . A A .  6 THR CB   1 1 
        7  6428 1 1  6 THR CG2  C   5.949  -0.565   3.438 1.00 . A A .  6 THR CG2  1 1 
        7  6429 1 1  6 THR H    H   3.031   1.508   4.233 1.00 . A A .  6 THR H    1 1 
        7  6430 1 1  6 THR HA   H   4.004   0.015   1.932 1.00 . A A .  6 THR HA   1 1 
        7  6431 1 1  6 THR HB   H   4.269  -1.659   4.100 1.00 . A A .  6 THR HB   1 1 
        7  6432 1 1  6 THR HG1  H   5.001  -0.338   5.786 1.00 . A A .  6 THR HG1  1 1 
        7  6433 1 1  6 THR HG21 H   5.993  -0.057   2.485 1.00 . A A .  6 THR HG21 1 1 
        7  6434 1 1  6 THR HG22 H   6.333  -1.568   3.330 1.00 . A A .  6 THR HG22 1 1 
        7  6435 1 1  6 THR HG23 H   6.543  -0.026   4.160 1.00 . A A .  6 THR HG23 1 1 
        7  6436 1 1  6 THR N    N   3.103   1.286   3.284 1.00 . A A .  6 THR N    1 1 
        7  6437 1 1  6 THR O    O   1.329  -0.841   3.489 1.00 . A A .  6 THR O    1 1 
        7  6438 1 1  6 THR OG1  O   4.435   0.085   5.135 1.00 . A A .  6 THR OG1  1 1 
        7  6439 1 1  7 LEU C    C   1.216  -3.852   2.820 1.00 . A A .  7 LEU C    1 1 
        7  6440 1 1  7 LEU CA   C   1.327  -2.897   1.636 1.00 . A A .  7 LEU CA   1 1 
        7  6441 1 1  7 LEU CB   C   1.560  -3.687   0.347 1.00 . A A .  7 LEU CB   1 1 
        7  6442 1 1  7 LEU CD1  C  -0.775  -4.178  -0.421 1.00 . A A .  7 LEU CD1  1 1 
        7  6443 1 1  7 LEU CD2  C   1.076  -5.774  -0.955 1.00 . A A .  7 LEU CD2  1 1 
        7  6444 1 1  7 LEU CG   C   0.533  -4.784   0.065 1.00 . A A .  7 LEU CG   1 1 
        7  6445 1 1  7 LEU H    H   3.220  -2.009   1.306 1.00 . A A .  7 LEU H    1 1 
        7  6446 1 1  7 LEU HA   H   0.403  -2.343   1.548 1.00 . A A .  7 LEU HA   1 1 
        7  6447 1 1  7 LEU HB2  H   1.554  -2.994  -0.482 1.00 . A A .  7 LEU HB2  1 1 
        7  6448 1 1  7 LEU HB3  H   2.536  -4.146   0.402 1.00 . A A .  7 LEU HB3  1 1 
        7  6449 1 1  7 LEU HD11 H  -1.601  -4.786  -0.083 1.00 . A A .  7 LEU HD11 1 1 
        7  6450 1 1  7 LEU HD12 H  -0.774  -4.141  -1.501 1.00 . A A .  7 LEU HD12 1 1 
        7  6451 1 1  7 LEU HD13 H  -0.877  -3.178  -0.025 1.00 . A A .  7 LEU HD13 1 1 
        7  6452 1 1  7 LEU HD21 H   1.955  -6.258  -0.553 1.00 . A A .  7 LEU HD21 1 1 
        7  6453 1 1  7 LEU HD22 H   1.337  -5.249  -1.862 1.00 . A A .  7 LEU HD22 1 1 
        7  6454 1 1  7 LEU HD23 H   0.324  -6.516  -1.173 1.00 . A A .  7 LEU HD23 1 1 
        7  6455 1 1  7 LEU HG   H   0.331  -5.323   0.979 1.00 . A A .  7 LEU HG   1 1 
        7  6456 1 1  7 LEU N    N   2.406  -1.942   1.848 1.00 . A A .  7 LEU N    1 1 
        7  6457 1 1  7 LEU O    O   0.119  -4.243   3.217 1.00 . A A .  7 LEU O    1 1 
        7  6458 1 1  8 LYS C    C   1.735  -4.497   5.737 1.00 . A A .  8 LYS C    1 1 
        7  6459 1 1  8 LYS CA   C   2.403  -5.127   4.520 1.00 . A A .  8 LYS CA   1 1 
        7  6460 1 1  8 LYS CB   C   3.849  -5.498   4.852 1.00 . A A .  8 LYS CB   1 1 
        7  6461 1 1  8 LYS CD   C   5.417  -6.759   6.358 1.00 . A A .  8 LYS CD   1 1 
        7  6462 1 1  8 LYS CE   C   5.701  -8.207   6.721 1.00 . A A .  8 LYS CE   1 1 
        7  6463 1 1  8 LYS CG   C   3.972  -6.566   5.926 1.00 . A A .  8 LYS CG   1 1 
        7  6464 1 1  8 LYS H    H   3.205  -3.873   3.018 1.00 . A A .  8 LYS H    1 1 
        7  6465 1 1  8 LYS HA   H   1.865  -6.021   4.249 1.00 . A A .  8 LYS HA   1 1 
        7  6466 1 1  8 LYS HB2  H   4.331  -5.861   3.958 1.00 . A A .  8 LYS HB2  1 1 
        7  6467 1 1  8 LYS HB3  H   4.366  -4.613   5.195 1.00 . A A .  8 LYS HB3  1 1 
        7  6468 1 1  8 LYS HD2  H   6.067  -6.466   5.547 1.00 . A A .  8 LYS HD2  1 1 
        7  6469 1 1  8 LYS HD3  H   5.610  -6.135   7.220 1.00 . A A .  8 LYS HD3  1 1 
        7  6470 1 1  8 LYS HE2  H   5.442  -8.832   5.879 1.00 . A A .  8 LYS HE2  1 1 
        7  6471 1 1  8 LYS HE3  H   6.755  -8.311   6.935 1.00 . A A .  8 LYS HE3  1 1 
        7  6472 1 1  8 LYS HG2  H   3.386  -6.270   6.783 1.00 . A A .  8 LYS HG2  1 1 
        7  6473 1 1  8 LYS HG3  H   3.596  -7.500   5.535 1.00 . A A .  8 LYS HG3  1 1 
        7  6474 1 1  8 LYS HZ1  H   3.901  -8.623   7.693 1.00 . A A .  8 LYS HZ1  1 1 
        7  6475 1 1  8 LYS HZ2  H   5.104  -8.014   8.713 1.00 . A A .  8 LYS HZ2  1 1 
        7  6476 1 1  8 LYS HZ3  H   5.185  -9.614   8.175 1.00 . A A .  8 LYS HZ3  1 1 
        7  6477 1 1  8 LYS N    N   2.363  -4.220   3.380 1.00 . A A .  8 LYS N    1 1 
        7  6478 1 1  8 LYS NZ   N   4.918  -8.646   7.909 1.00 . A A .  8 LYS NZ   1 1 
        7  6479 1 1  8 LYS O    O   1.109  -5.186   6.541 1.00 . A A .  8 LYS O    1 1 
        7  6480 1 1  9 ASP C    C  -0.211  -2.251   6.775 1.00 . A A .  9 ASP C    1 1 
        7  6481 1 1  9 ASP CA   C   1.285  -2.457   6.985 1.00 . A A .  9 ASP CA   1 1 
        7  6482 1 1  9 ASP CB   C   1.973  -1.101   7.162 1.00 . A A .  9 ASP CB   1 1 
        7  6483 1 1  9 ASP CG   C   3.426  -1.241   7.572 1.00 . A A .  9 ASP CG   1 1 
        7  6484 1 1  9 ASP H    H   2.385  -2.686   5.192 1.00 . A A .  9 ASP H    1 1 
        7  6485 1 1  9 ASP HA   H   1.434  -3.044   7.877 1.00 . A A .  9 ASP HA   1 1 
        7  6486 1 1  9 ASP HB2  H   1.931  -0.560   6.227 1.00 . A A .  9 ASP HB2  1 1 
        7  6487 1 1  9 ASP HB3  H   1.454  -0.537   7.922 1.00 . A A .  9 ASP HB3  1 1 
        7  6488 1 1  9 ASP N    N   1.873  -3.182   5.866 1.00 . A A .  9 ASP N    1 1 
        7  6489 1 1  9 ASP O    O  -1.014  -2.502   7.672 1.00 . A A .  9 ASP O    1 1 
        7  6490 1 1  9 ASP OD1  O   4.219  -1.782   6.773 1.00 . A A .  9 ASP OD1  1 1 
        7  6491 1 1  9 ASP OD2  O   3.771  -0.808   8.692 1.00 . A A .  9 ASP OD2  1 1 
        7  6492 1 1 10 TYR C    C  -2.791  -2.844   5.322 1.00 . A A . 10 TYR C    1 1 
        7  6493 1 1 10 TYR CA   C  -1.979  -1.554   5.257 1.00 . A A . 10 TYR CA   1 1 
        7  6494 1 1 10 TYR CB   C  -2.098  -0.933   3.864 1.00 . A A . 10 TYR CB   1 1 
        7  6495 1 1 10 TYR CD1  C  -4.546  -1.151   3.288 1.00 . A A . 10 TYR CD1  1 1 
        7  6496 1 1 10 TYR CD2  C  -3.657   1.037   3.608 1.00 . A A . 10 TYR CD2  1 1 
        7  6497 1 1 10 TYR CE1  C  -5.792  -0.610   3.031 1.00 . A A . 10 TYR CE1  1 1 
        7  6498 1 1 10 TYR CE2  C  -4.899   1.585   3.353 1.00 . A A . 10 TYR CE2  1 1 
        7  6499 1 1 10 TYR CG   C  -3.459  -0.338   3.581 1.00 . A A . 10 TYR CG   1 1 
        7  6500 1 1 10 TYR CZ   C  -5.963   0.758   3.064 1.00 . A A . 10 TYR CZ   1 1 
        7  6501 1 1 10 TYR H    H   0.108  -1.612   4.910 1.00 . A A . 10 TYR H    1 1 
        7  6502 1 1 10 TYR HA   H  -2.372  -0.859   5.984 1.00 . A A . 10 TYR HA   1 1 
        7  6503 1 1 10 TYR HB2  H  -1.366  -0.146   3.764 1.00 . A A . 10 TYR HB2  1 1 
        7  6504 1 1 10 TYR HB3  H  -1.907  -1.694   3.121 1.00 . A A . 10 TYR HB3  1 1 
        7  6505 1 1 10 TYR HD1  H  -4.409  -2.222   3.263 1.00 . A A . 10 TYR HD1  1 1 
        7  6506 1 1 10 TYR HD2  H  -2.821   1.684   3.835 1.00 . A A . 10 TYR HD2  1 1 
        7  6507 1 1 10 TYR HE1  H  -6.626  -1.261   2.804 1.00 . A A . 10 TYR HE1  1 1 
        7  6508 1 1 10 TYR HE2  H  -5.033   2.656   3.378 1.00 . A A . 10 TYR HE2  1 1 
        7  6509 1 1 10 TYR HH   H  -7.655   0.772   2.147 1.00 . A A . 10 TYR HH   1 1 
        7  6510 1 1 10 TYR N    N  -0.578  -1.793   5.584 1.00 . A A . 10 TYR N    1 1 
        7  6511 1 1 10 TYR O    O  -4.018  -2.811   5.402 1.00 . A A . 10 TYR O    1 1 
        7  6512 1 1 10 TYR OH   O  -7.202   1.300   2.808 1.00 . A A . 10 TYR OH   1 1 
        7  6513 1 1 11 ALA C    C  -2.942  -5.767   6.766 1.00 . A A . 11 ALA C    1 1 
        7  6514 1 1 11 ALA CA   C  -2.784  -5.271   5.331 1.00 . A A . 11 ALA CA   1 1 
        7  6515 1 1 11 ALA CB   C  -2.030  -6.295   4.494 1.00 . A A . 11 ALA CB   1 1 
        7  6516 1 1 11 ALA H    H  -1.131  -3.956   5.209 1.00 . A A . 11 ALA H    1 1 
        7  6517 1 1 11 ALA HA   H  -3.765  -5.143   4.899 1.00 . A A . 11 ALA HA   1 1 
        7  6518 1 1 11 ALA HB1  H  -0.983  -6.033   4.464 1.00 . A A . 11 ALA HB1  1 1 
        7  6519 1 1 11 ALA HB2  H  -2.429  -6.303   3.491 1.00 . A A . 11 ALA HB2  1 1 
        7  6520 1 1 11 ALA HB3  H  -2.144  -7.273   4.934 1.00 . A A . 11 ALA HB3  1 1 
        7  6521 1 1 11 ALA N    N  -2.108  -3.982   5.281 1.00 . A A . 11 ALA N    1 1 
        7  6522 1 1 11 ALA O    O  -4.019  -6.208   7.163 1.00 . A A . 11 ALA O    1 1 
        7  6523 1 1 12 MET C    C  -2.404  -5.088   9.861 1.00 . A A . 12 MET C    1 1 
        7  6524 1 1 12 MET CA   C  -1.875  -6.162   8.916 1.00 . A A . 12 MET CA   1 1 
        7  6525 1 1 12 MET CB   C  -0.470  -6.593   9.348 1.00 . A A . 12 MET CB   1 1 
        7  6526 1 1 12 MET CE   C   2.391  -7.672   9.526 1.00 . A A . 12 MET CE   1 1 
        7  6527 1 1 12 MET CG   C  -0.349  -8.084   9.619 1.00 . A A . 12 MET CG   1 1 
        7  6528 1 1 12 MET H    H  -1.027  -5.356   7.160 1.00 . A A . 12 MET H    1 1 
        7  6529 1 1 12 MET HA   H  -2.528  -7.012   8.963 1.00 . A A . 12 MET HA   1 1 
        7  6530 1 1 12 MET HB2  H   0.228  -6.334   8.566 1.00 . A A . 12 MET HB2  1 1 
        7  6531 1 1 12 MET HB3  H  -0.202  -6.063  10.249 1.00 . A A . 12 MET HB3  1 1 
        7  6532 1 1 12 MET HE1  H   2.325  -6.606   9.689 1.00 . A A . 12 MET HE1  1 1 
        7  6533 1 1 12 MET HE2  H   2.219  -7.888   8.482 1.00 . A A . 12 MET HE2  1 1 
        7  6534 1 1 12 MET HE3  H   3.373  -8.019   9.809 1.00 . A A . 12 MET HE3  1 1 
        7  6535 1 1 12 MET HG2  H  -1.200  -8.402  10.202 1.00 . A A . 12 MET HG2  1 1 
        7  6536 1 1 12 MET HG3  H  -0.346  -8.609   8.674 1.00 . A A . 12 MET HG3  1 1 
        7  6537 1 1 12 MET N    N  -1.858  -5.705   7.533 1.00 . A A . 12 MET N    1 1 
        7  6538 1 1 12 MET O    O  -2.908  -5.392  10.942 1.00 . A A . 12 MET O    1 1 
        7  6539 1 1 12 MET SD   S   1.155  -8.505  10.519 1.00 . A A . 12 MET SD   1 1 
        7  6540 1 1 13 ARG C    C  -4.194  -2.364   9.966 1.00 . A A . 13 ARG C    1 1 
        7  6541 1 1 13 ARG CA   C  -2.741  -2.715  10.271 1.00 . A A . 13 ARG CA   1 1 
        7  6542 1 1 13 ARG CB   C  -1.852  -1.490  10.049 1.00 . A A . 13 ARG CB   1 1 
        7  6543 1 1 13 ARG CD   C  -3.074   0.274  11.362 1.00 . A A . 13 ARG CD   1 1 
        7  6544 1 1 13 ARG CG   C  -1.800  -0.549  11.243 1.00 . A A . 13 ARG CG   1 1 
        7  6545 1 1 13 ARG CZ   C  -3.727   2.632  11.659 1.00 . A A . 13 ARG CZ   1 1 
        7  6546 1 1 13 ARG H    H  -1.868  -3.653   8.585 1.00 . A A . 13 ARG H    1 1 
        7  6547 1 1 13 ARG HA   H  -2.669  -3.014  11.307 1.00 . A A . 13 ARG HA   1 1 
        7  6548 1 1 13 ARG HB2  H  -0.844  -1.825   9.839 1.00 . A A . 13 ARG HB2  1 1 
        7  6549 1 1 13 ARG HB3  H  -2.227  -0.937   9.197 1.00 . A A . 13 ARG HB3  1 1 
        7  6550 1 1 13 ARG HD2  H  -3.636   0.180  10.444 1.00 . A A . 13 ARG HD2  1 1 
        7  6551 1 1 13 ARG HD3  H  -3.661  -0.110  12.183 1.00 . A A . 13 ARG HD3  1 1 
        7  6552 1 1 13 ARG HE   H  -1.854   1.947  11.724 1.00 . A A . 13 ARG HE   1 1 
        7  6553 1 1 13 ARG HG2  H  -1.678  -1.134  12.143 1.00 . A A . 13 ARG HG2  1 1 
        7  6554 1 1 13 ARG HG3  H  -0.959   0.120  11.124 1.00 . A A . 13 ARG HG3  1 1 
        7  6555 1 1 13 ARG HH11 H  -5.273   1.369  11.330 1.00 . A A . 13 ARG HH11 1 1 
        7  6556 1 1 13 ARG HH12 H  -5.705   3.033  11.541 1.00 . A A . 13 ARG HH12 1 1 
        7  6557 1 1 13 ARG HH21 H  -2.422   4.135  12.003 1.00 . A A . 13 ARG HH21 1 1 
        7  6558 1 1 13 ARG HH22 H  -4.087   4.603  11.925 1.00 . A A . 13 ARG HH22 1 1 
        7  6559 1 1 13 ARG N    N  -2.282  -3.832   9.453 1.00 . A A . 13 ARG N    1 1 
        7  6560 1 1 13 ARG NE   N  -2.791   1.688  11.600 1.00 . A A . 13 ARG NE   1 1 
        7  6561 1 1 13 ARG NH1  N  -5.007   2.318  11.497 1.00 . A A . 13 ARG NH1  1 1 
        7  6562 1 1 13 ARG NH2  N  -3.384   3.893  11.880 1.00 . A A . 13 ARG NH2  1 1 
        7  6563 1 1 13 ARG O    O  -5.048  -2.393  10.851 1.00 . A A . 13 ARG O    1 1 
        7  6564 1 1 14 PHE C    C  -6.671  -2.901   8.065 1.00 . A A . 14 PHE C    1 1 
        7  6565 1 1 14 PHE CA   C  -5.810  -1.663   8.294 1.00 . A A . 14 PHE CA   1 1 
        7  6566 1 1 14 PHE CB   C  -5.741  -0.829   7.019 1.00 . A A . 14 PHE CB   1 1 
        7  6567 1 1 14 PHE CD1  C  -4.299   0.943   8.034 1.00 . A A . 14 PHE CD1  1 1 
        7  6568 1 1 14 PHE CD2  C  -6.165   1.625   6.728 1.00 . A A . 14 PHE CD2  1 1 
        7  6569 1 1 14 PHE CE1  C  -3.976   2.256   8.263 1.00 . A A . 14 PHE CE1  1 1 
        7  6570 1 1 14 PHE CE2  C  -5.845   2.941   6.954 1.00 . A A . 14 PHE CE2  1 1 
        7  6571 1 1 14 PHE CG   C  -5.395   0.608   7.264 1.00 . A A . 14 PHE CG   1 1 
        7  6572 1 1 14 PHE CZ   C  -4.751   3.251   7.722 1.00 . A A . 14 PHE CZ   1 1 
        7  6573 1 1 14 PHE H    H  -3.751  -2.013   8.046 1.00 . A A . 14 PHE H    1 1 
        7  6574 1 1 14 PHE HA   H  -6.250  -1.067   9.079 1.00 . A A . 14 PHE HA   1 1 
        7  6575 1 1 14 PHE HB2  H  -4.988  -1.242   6.369 1.00 . A A . 14 PHE HB2  1 1 
        7  6576 1 1 14 PHE HB3  H  -6.692  -0.868   6.526 1.00 . A A . 14 PHE HB3  1 1 
        7  6577 1 1 14 PHE HD1  H  -3.694   0.169   8.456 1.00 . A A . 14 PHE HD1  1 1 
        7  6578 1 1 14 PHE HD2  H  -7.018   1.385   6.129 1.00 . A A . 14 PHE HD2  1 1 
        7  6579 1 1 14 PHE HE1  H  -3.115   2.506   8.866 1.00 . A A . 14 PHE HE1  1 1 
        7  6580 1 1 14 PHE HE2  H  -6.451   3.727   6.531 1.00 . A A . 14 PHE HE2  1 1 
        7  6581 1 1 14 PHE HZ   H  -4.503   4.267   7.898 1.00 . A A . 14 PHE HZ   1 1 
        7  6582 1 1 14 PHE N    N  -4.468  -2.026   8.710 1.00 . A A . 14 PHE N    1 1 
        7  6583 1 1 14 PHE O    O  -7.850  -2.921   8.414 1.00 . A A . 14 PHE O    1 1 
        7  6584 1 1 15 GLY C    C  -6.514  -5.703   5.819 1.00 . A A . 15 GLY C    1 1 
        7  6585 1 1 15 GLY CA   C  -6.799  -5.157   7.205 1.00 . A A . 15 GLY CA   1 1 
        7  6586 1 1 15 GLY H    H  -5.130  -3.854   7.216 1.00 . A A . 15 GLY H    1 1 
        7  6587 1 1 15 GLY HA2  H  -6.516  -5.898   7.938 1.00 . A A . 15 GLY HA2  1 1 
        7  6588 1 1 15 GLY HA3  H  -7.857  -4.962   7.293 1.00 . A A . 15 GLY HA3  1 1 
        7  6589 1 1 15 GLY N    N  -6.073  -3.929   7.474 1.00 . A A . 15 GLY N    1 1 
        7  6590 1 1 15 GLY O    O  -5.991  -4.992   4.962 1.00 . A A . 15 GLY O    1 1 
        7  6591 1 1 16 GLN C    C  -7.835  -7.422   3.387 1.00 . A A . 16 GLN C    1 1 
        7  6592 1 1 16 GLN CA   C  -6.631  -7.605   4.307 1.00 . A A . 16 GLN CA   1 1 
        7  6593 1 1 16 GLN CB   C  -6.339  -9.096   4.494 1.00 . A A . 16 GLN CB   1 1 
        7  6594 1 1 16 GLN CD   C  -4.590 -10.917   4.603 1.00 . A A . 16 GLN CD   1 1 
        7  6595 1 1 16 GLN CG   C  -4.855  -9.425   4.531 1.00 . A A . 16 GLN CG   1 1 
        7  6596 1 1 16 GLN H    H  -7.270  -7.485   6.323 1.00 . A A . 16 GLN H    1 1 
        7  6597 1 1 16 GLN HA   H  -5.772  -7.135   3.853 1.00 . A A . 16 GLN HA   1 1 
        7  6598 1 1 16 GLN HB2  H  -6.782  -9.424   5.423 1.00 . A A . 16 GLN HB2  1 1 
        7  6599 1 1 16 GLN HB3  H  -6.788  -9.646   3.679 1.00 . A A . 16 GLN HB3  1 1 
        7  6600 1 1 16 GLN HE21 H  -5.406 -11.171   2.805 1.00 . A A . 16 GLN HE21 1 1 
        7  6601 1 1 16 GLN HE22 H  -4.813 -12.609   3.580 1.00 . A A . 16 GLN HE22 1 1 
        7  6602 1 1 16 GLN HG2  H  -4.393  -9.035   3.637 1.00 . A A . 16 GLN HG2  1 1 
        7  6603 1 1 16 GLN HG3  H  -4.418  -8.953   5.397 1.00 . A A . 16 GLN HG3  1 1 
        7  6604 1 1 16 GLN N    N  -6.858  -6.968   5.600 1.00 . A A . 16 GLN N    1 1 
        7  6605 1 1 16 GLN NE2  N  -4.975 -11.638   3.557 1.00 . A A . 16 GLN NE2  1 1 
        7  6606 1 1 16 GLN O    O  -7.690  -7.350   2.166 1.00 . A A . 16 GLN O    1 1 
        7  6607 1 1 16 GLN OE1  O  -4.044 -11.414   5.587 1.00 . A A . 16 GLN OE1  1 1 
        7  6608 1 1 17 THR C    C -10.420  -5.728   2.767 1.00 . A A . 17 THR C    1 1 
        7  6609 1 1 17 THR CA   C -10.250  -7.178   3.210 1.00 . A A . 17 THR CA   1 1 
        7  6610 1 1 17 THR CB   C -11.450  -7.616   4.040 1.00 . A A . 17 THR CB   1 1 
        7  6611 1 1 17 THR CG2  C -12.770  -7.451   3.314 1.00 . A A . 17 THR CG2  1 1 
        7  6612 1 1 17 THR H    H  -9.076  -7.415   4.956 1.00 . A A . 17 THR H    1 1 
        7  6613 1 1 17 THR HA   H -10.180  -7.803   2.334 1.00 . A A . 17 THR HA   1 1 
        7  6614 1 1 17 THR HB   H -11.500  -7.019   4.941 1.00 . A A . 17 THR HB   1 1 
        7  6615 1 1 17 THR HG1  H -10.810  -9.046   5.211 1.00 . A A . 17 THR HG1  1 1 
        7  6616 1 1 17 THR HG21 H -12.790  -8.100   2.451 1.00 . A A . 17 THR HG21 1 1 
        7  6617 1 1 17 THR HG22 H -12.880  -6.425   2.996 1.00 . A A . 17 THR HG22 1 1 
        7  6618 1 1 17 THR HG23 H -13.580  -7.709   3.978 1.00 . A A . 17 THR HG23 1 1 
        7  6619 1 1 17 THR N    N  -9.022  -7.349   3.979 1.00 . A A . 17 THR N    1 1 
        7  6620 1 1 17 THR O    O -10.760  -5.457   1.615 1.00 . A A . 17 THR O    1 1 
        7  6621 1 1 17 THR OG1  O -11.340  -8.977   4.414 1.00 . A A . 17 THR OG1  1 1 
        7  6622 1 1 18 LYS C    C  -9.467  -2.980   2.190 1.00 . A A . 18 LYS C    1 1 
        7  6623 1 1 18 LYS CA   C -10.310  -3.375   3.395 1.00 . A A . 18 LYS CA   1 1 
        7  6624 1 1 18 LYS CB   C  -9.909  -2.546   4.614 1.00 . A A . 18 LYS CB   1 1 
        7  6625 1 1 18 LYS CD   C  -9.795  -0.045   4.381 1.00 . A A . 18 LYS CD   1 1 
        7  6626 1 1 18 LYS CE   C -10.310   1.237   5.013 1.00 . A A . 18 LYS CE   1 1 
        7  6627 1 1 18 LYS CG   C -10.670  -1.236   4.740 1.00 . A A . 18 LYS CG   1 1 
        7  6628 1 1 18 LYS H    H  -9.917  -5.078   4.589 1.00 . A A . 18 LYS H    1 1 
        7  6629 1 1 18 LYS HA   H -11.350  -3.180   3.168 1.00 . A A . 18 LYS HA   1 1 
        7  6630 1 1 18 LYS HB2  H -10.080  -3.127   5.507 1.00 . A A . 18 LYS HB2  1 1 
        7  6631 1 1 18 LYS HB3  H  -8.854  -2.321   4.546 1.00 . A A . 18 LYS HB3  1 1 
        7  6632 1 1 18 LYS HD2  H  -8.791  -0.227   4.732 1.00 . A A . 18 LYS HD2  1 1 
        7  6633 1 1 18 LYS HD3  H  -9.788   0.071   3.307 1.00 . A A . 18 LYS HD3  1 1 
        7  6634 1 1 18 LYS HE2  H -10.170   1.178   6.081 1.00 . A A . 18 LYS HE2  1 1 
        7  6635 1 1 18 LYS HE3  H  -9.748   2.070   4.621 1.00 . A A . 18 LYS HE3  1 1 
        7  6636 1 1 18 LYS HG2  H -11.520  -1.259   4.075 1.00 . A A . 18 LYS HG2  1 1 
        7  6637 1 1 18 LYS HG3  H -11.010  -1.125   5.759 1.00 . A A . 18 LYS HG3  1 1 
        7  6638 1 1 18 LYS HZ1  H -11.950   2.472   4.657 1.00 . A A . 18 LYS HZ1  1 1 
        7  6639 1 1 18 LYS HZ2  H -12.330   1.049   5.487 1.00 . A A . 18 LYS HZ2  1 1 
        7  6640 1 1 18 LYS HZ3  H -12.010   0.998   3.828 1.00 . A A . 18 LYS HZ3  1 1 
        7  6641 1 1 18 LYS N    N -10.180  -4.800   3.689 1.00 . A A . 18 LYS N    1 1 
        7  6642 1 1 18 LYS NZ   N -11.750   1.453   4.726 1.00 . A A . 18 LYS NZ   1 1 
        7  6643 1 1 18 LYS O    O  -9.927  -2.260   1.305 1.00 . A A . 18 LYS O    1 1 
        7  6644 1 1 19 THR C    C  -7.856  -3.660  -0.261 1.00 . A A . 19 THR C    1 1 
        7  6645 1 1 19 THR CA   C  -7.312  -3.145   1.067 1.00 . A A . 19 THR CA   1 1 
        7  6646 1 1 19 THR CB   C  -5.934  -3.755   1.337 1.00 . A A . 19 THR CB   1 1 
        7  6647 1 1 19 THR CG2  C  -4.792  -2.884   0.862 1.00 . A A . 19 THR CG2  1 1 
        7  6648 1 1 19 THR H    H  -7.913  -4.021   2.899 1.00 . A A . 19 THR H    1 1 
        7  6649 1 1 19 THR HA   H  -7.215  -2.072   1.011 1.00 . A A . 19 THR HA   1 1 
        7  6650 1 1 19 THR HB   H  -5.865  -4.701   0.820 1.00 . A A . 19 THR HB   1 1 
        7  6651 1 1 19 THR HG1  H  -6.099  -3.249   3.222 1.00 . A A . 19 THR HG1  1 1 
        7  6652 1 1 19 THR HG21 H  -3.935  -3.033   1.503 1.00 . A A . 19 THR HG21 1 1 
        7  6653 1 1 19 THR HG22 H  -5.092  -1.847   0.897 1.00 . A A . 19 THR HG22 1 1 
        7  6654 1 1 19 THR HG23 H  -4.534  -3.149  -0.152 1.00 . A A . 19 THR HG23 1 1 
        7  6655 1 1 19 THR N    N  -8.225  -3.453   2.163 1.00 . A A . 19 THR N    1 1 
        7  6656 1 1 19 THR O    O  -7.963  -2.910  -1.231 1.00 . A A . 19 THR O    1 1 
        7  6657 1 1 19 THR OG1  O  -5.749  -3.989   2.721 1.00 . A A . 19 THR OG1  1 1 
        7  6658 1 1 20 ALA C    C  -9.975  -4.842  -2.003 1.00 . A A . 20 ALA C    1 1 
        7  6659 1 1 20 ALA CA   C  -8.721  -5.561  -1.511 1.00 . A A . 20 ALA CA   1 1 
        7  6660 1 1 20 ALA CB   C  -9.018  -7.034  -1.266 1.00 . A A . 20 ALA CB   1 1 
        7  6661 1 1 20 ALA H    H  -8.082  -5.492   0.506 1.00 . A A . 20 ALA H    1 1 
        7  6662 1 1 20 ALA HA   H  -7.961  -5.496  -2.276 1.00 . A A . 20 ALA HA   1 1 
        7  6663 1 1 20 ALA HB1  H  -8.169  -7.627  -1.570 1.00 . A A . 20 ALA HB1  1 1 
        7  6664 1 1 20 ALA HB2  H  -9.886  -7.326  -1.837 1.00 . A A . 20 ALA HB2  1 1 
        7  6665 1 1 20 ALA HB3  H  -9.208  -7.190  -0.214 1.00 . A A . 20 ALA HB3  1 1 
        7  6666 1 1 20 ALA N    N  -8.194  -4.944  -0.300 1.00 . A A . 20 ALA N    1 1 
        7  6667 1 1 20 ALA O    O -10.190  -4.709  -3.207 1.00 . A A . 20 ALA O    1 1 
        7  6668 1 1 21 LYS C    C -11.740  -2.241  -1.817 1.00 . A A . 21 LYS C    1 1 
        7  6669 1 1 21 LYS CA   C -12.030  -3.684  -1.408 1.00 . A A . 21 LYS CA   1 1 
        7  6670 1 1 21 LYS CB   C -13.000  -3.714  -0.225 1.00 . A A . 21 LYS CB   1 1 
        7  6671 1 1 21 LYS CD   C -15.010  -3.671  -1.740 1.00 . A A . 21 LYS CD   1 1 
        7  6672 1 1 21 LYS CE   C -15.490  -4.682  -2.769 1.00 . A A . 21 LYS CE   1 1 
        7  6673 1 1 21 LYS CG   C -14.340  -4.353  -0.555 1.00 . A A . 21 LYS CG   1 1 
        7  6674 1 1 21 LYS H    H -10.570  -4.523  -0.121 1.00 . A A . 21 LYS H    1 1 
        7  6675 1 1 21 LYS HA   H -12.480  -4.198  -2.243 1.00 . A A . 21 LYS HA   1 1 
        7  6676 1 1 21 LYS HB2  H -12.550  -4.272   0.582 1.00 . A A . 21 LYS HB2  1 1 
        7  6677 1 1 21 LYS HB3  H -13.180  -2.702   0.108 1.00 . A A . 21 LYS HB3  1 1 
        7  6678 1 1 21 LYS HD2  H -15.850  -3.105  -1.385 1.00 . A A . 21 LYS HD2  1 1 
        7  6679 1 1 21 LYS HD3  H -14.290  -3.004  -2.207 1.00 . A A . 21 LYS HD3  1 1 
        7  6680 1 1 21 LYS HE2  H -16.040  -5.457  -2.261 1.00 . A A . 21 LYS HE2  1 1 
        7  6681 1 1 21 LYS HE3  H -16.130  -4.180  -3.476 1.00 . A A . 21 LYS HE3  1 1 
        7  6682 1 1 21 LYS HG2  H -14.180  -5.394  -0.793 1.00 . A A . 21 LYS HG2  1 1 
        7  6683 1 1 21 LYS HG3  H -14.980  -4.273   0.305 1.00 . A A . 21 LYS HG3  1 1 
        7  6684 1 1 21 LYS HZ1  H -14.700  -6.069  -4.120 1.00 . A A . 21 LYS HZ1  1 1 
        7  6685 1 1 21 LYS HZ2  H -13.670  -5.705  -2.834 1.00 . A A . 21 LYS HZ2  1 1 
        7  6686 1 1 21 LYS HZ3  H -13.870  -4.594  -4.092 1.00 . A A . 21 LYS HZ3  1 1 
        7  6687 1 1 21 LYS N    N -10.790  -4.385  -1.065 1.00 . A A . 21 LYS N    1 1 
        7  6688 1 1 21 LYS NZ   N -14.350  -5.306  -3.505 1.00 . A A . 21 LYS NZ   1 1 
        7  6689 1 1 21 LYS O    O -12.470  -1.659  -2.619 1.00 . A A . 21 LYS O    1 1 
        7  6690 1 1 22 ASP C    C  -9.480  -0.219  -2.842 1.00 . A A . 22 ASP C    1 1 
        7  6691 1 1 22 ASP CA   C -10.310  -0.292  -1.566 1.00 . A A . 22 ASP CA   1 1 
        7  6692 1 1 22 ASP CB   C  -9.535   0.316  -0.398 1.00 . A A . 22 ASP CB   1 1 
        7  6693 1 1 22 ASP CG   C -10.400   1.202   0.475 1.00 . A A . 22 ASP CG   1 1 
        7  6694 1 1 22 ASP H    H -10.140  -2.180  -0.625 1.00 . A A . 22 ASP H    1 1 
        7  6695 1 1 22 ASP HA   H -11.220   0.273  -1.712 1.00 . A A . 22 ASP HA   1 1 
        7  6696 1 1 22 ASP HB2  H  -9.136  -0.481   0.215 1.00 . A A . 22 ASP HB2  1 1 
        7  6697 1 1 22 ASP HB3  H  -8.721   0.912  -0.787 1.00 . A A . 22 ASP HB3  1 1 
        7  6698 1 1 22 ASP N    N -10.680  -1.667  -1.260 1.00 . A A . 22 ASP N    1 1 
        7  6699 1 1 22 ASP O    O  -9.564   0.752  -3.595 1.00 . A A . 22 ASP O    1 1 
        7  6700 1 1 22 ASP OD1  O -10.560   2.393   0.137 1.00 . A A . 22 ASP OD1  1 1 
        7  6701 1 1 22 ASP OD2  O -10.920   0.703   1.496 1.00 . A A . 22 ASP OD2  1 1 
        7  6702 1 1 23 LEU C    C  -8.621  -1.733  -5.492 1.00 . A A . 23 LEU C    1 1 
        7  6703 1 1 23 LEU CA   C  -7.826  -1.296  -4.263 1.00 . A A . 23 LEU CA   1 1 
        7  6704 1 1 23 LEU CB   C  -6.649  -2.250  -4.033 1.00 . A A . 23 LEU CB   1 1 
        7  6705 1 1 23 LEU CD1  C  -4.784  -2.015  -2.370 1.00 . A A . 23 LEU CD1  1 1 
        7  6706 1 1 23 LEU CD2  C  -4.297  -1.851  -4.818 1.00 . A A . 23 LEU CD2  1 1 
        7  6707 1 1 23 LEU CG   C  -5.314  -1.566  -3.723 1.00 . A A . 23 LEU CG   1 1 
        7  6708 1 1 23 LEU H    H  -8.650  -1.991  -2.442 1.00 . A A . 23 LEU H    1 1 
        7  6709 1 1 23 LEU HA   H  -7.440  -0.303  -4.434 1.00 . A A . 23 LEU HA   1 1 
        7  6710 1 1 23 LEU HB2  H  -6.901  -2.902  -3.209 1.00 . A A . 23 LEU HB2  1 1 
        7  6711 1 1 23 LEU HB3  H  -6.523  -2.854  -4.919 1.00 . A A . 23 LEU HB3  1 1 
        7  6712 1 1 23 LEU HD11 H  -4.761  -3.095  -2.333 1.00 . A A . 23 LEU HD11 1 1 
        7  6713 1 1 23 LEU HD12 H  -5.427  -1.641  -1.589 1.00 . A A . 23 LEU HD12 1 1 
        7  6714 1 1 23 LEU HD13 H  -3.785  -1.629  -2.229 1.00 . A A . 23 LEU HD13 1 1 
        7  6715 1 1 23 LEU HD21 H  -4.813  -2.126  -5.726 1.00 . A A . 23 LEU HD21 1 1 
        7  6716 1 1 23 LEU HD22 H  -3.654  -2.662  -4.510 1.00 . A A . 23 LEU HD22 1 1 
        7  6717 1 1 23 LEU HD23 H  -3.702  -0.969  -4.996 1.00 . A A . 23 LEU HD23 1 1 
        7  6718 1 1 23 LEU HG   H  -5.468  -0.496  -3.679 1.00 . A A . 23 LEU HG   1 1 
        7  6719 1 1 23 LEU N    N  -8.675  -1.248  -3.079 1.00 . A A . 23 LEU N    1 1 
        7  6720 1 1 23 LEU O    O  -8.263  -1.404  -6.623 1.00 . A A . 23 LEU O    1 1 
        7  6721 1 1 24 GLY C    C -10.140  -4.348  -6.803 1.00 . A A . 24 GLY C    1 1 
        7  6722 1 1 24 GLY CA   C -10.520  -2.947  -6.361 1.00 . A A . 24 GLY CA   1 1 
        7  6723 1 1 24 GLY H    H  -9.934  -2.712  -4.340 1.00 . A A . 24 GLY H    1 1 
        7  6724 1 1 24 GLY HA2  H -11.550  -2.944  -6.047 1.00 . A A . 24 GLY HA2  1 1 
        7  6725 1 1 24 GLY HA3  H -10.400  -2.273  -7.197 1.00 . A A . 24 GLY HA3  1 1 
        7  6726 1 1 24 GLY N    N  -9.697  -2.478  -5.262 1.00 . A A . 24 GLY N    1 1 
        7  6727 1 1 24 GLY O    O -10.370  -4.723  -7.954 1.00 . A A . 24 GLY O    1 1 
        7  6728 1 1 25 VAL C    C  -9.608  -7.442  -5.081 1.00 . A A . 25 VAL C    1 1 
        7  6729 1 1 25 VAL CA   C  -9.166  -6.487  -6.185 1.00 . A A . 25 VAL CA   1 1 
        7  6730 1 1 25 VAL CB   C  -7.640  -6.594  -6.357 1.00 . A A . 25 VAL CB   1 1 
        7  6731 1 1 25 VAL CG1  C  -7.200  -5.941  -7.659 1.00 . A A . 25 VAL CG1  1 1 
        7  6732 1 1 25 VAL CG2  C  -6.924  -5.965  -5.170 1.00 . A A . 25 VAL CG2  1 1 
        7  6733 1 1 25 VAL H    H  -9.421  -4.764  -4.989 1.00 . A A . 25 VAL H    1 1 
        7  6734 1 1 25 VAL HA   H  -9.634  -6.782  -7.113 1.00 . A A . 25 VAL HA   1 1 
        7  6735 1 1 25 VAL HB   H  -7.372  -7.639  -6.398 1.00 . A A . 25 VAL HB   1 1 
        7  6736 1 1 25 VAL HG11 H  -7.496  -4.902  -7.659 1.00 . A A . 25 VAL HG11 1 1 
        7  6737 1 1 25 VAL HG12 H  -7.668  -6.448  -8.491 1.00 . A A . 25 VAL HG12 1 1 
        7  6738 1 1 25 VAL HG13 H  -6.126  -6.010  -7.753 1.00 . A A . 25 VAL HG13 1 1 
        7  6739 1 1 25 VAL HG21 H  -7.594  -5.928  -4.324 1.00 . A A . 25 VAL HG21 1 1 
        7  6740 1 1 25 VAL HG22 H  -6.614  -4.962  -5.428 1.00 . A A . 25 VAL HG22 1 1 
        7  6741 1 1 25 VAL HG23 H  -6.057  -6.557  -4.918 1.00 . A A . 25 VAL HG23 1 1 
        7  6742 1 1 25 VAL N    N  -9.574  -5.122  -5.887 1.00 . A A . 25 VAL N    1 1 
        7  6743 1 1 25 VAL O    O -10.230  -7.030  -4.106 1.00 . A A . 25 VAL O    1 1 
        7  6744 1 1 26 GLN C    C  -8.508  -9.949  -3.263 1.00 . A A . 26 GLN C    1 1 
        7  6745 1 1 26 GLN CA   C  -9.643  -9.729  -4.257 1.00 . A A . 26 GLN CA   1 1 
        7  6746 1 1 26 GLN CB   C  -9.995 -11.045  -4.950 1.00 . A A . 26 GLN CB   1 1 
        7  6747 1 1 26 GLN CD   C -11.380 -12.195  -6.723 1.00 . A A . 26 GLN CD   1 1 
        7  6748 1 1 26 GLN CG   C -10.890 -10.872  -6.163 1.00 . A A . 26 GLN CG   1 1 
        7  6749 1 1 26 GLN H    H  -8.780  -8.989  -6.039 1.00 . A A . 26 GLN H    1 1 
        7  6750 1 1 26 GLN HA   H -10.510  -9.372  -3.721 1.00 . A A . 26 GLN HA   1 1 
        7  6751 1 1 26 GLN HB2  H  -9.082 -11.526  -5.271 1.00 . A A . 26 GLN HB2  1 1 
        7  6752 1 1 26 GLN HB3  H -10.500 -11.688  -4.244 1.00 . A A . 26 GLN HB3  1 1 
        7  6753 1 1 26 GLN HE21 H -13.230 -11.792  -6.124 1.00 . A A . 26 GLN HE21 1 1 
        7  6754 1 1 26 GLN HE22 H -13.010 -13.304  -6.930 1.00 . A A . 26 GLN HE22 1 1 
        7  6755 1 1 26 GLN HG2  H -11.750 -10.281  -5.879 1.00 . A A . 26 GLN HG2  1 1 
        7  6756 1 1 26 GLN HG3  H -10.330 -10.355  -6.934 1.00 . A A . 26 GLN HG3  1 1 
        7  6757 1 1 26 GLN N    N  -9.279  -8.719  -5.242 1.00 . A A . 26 GLN N    1 1 
        7  6758 1 1 26 GLN NE2  N -12.670 -12.456  -6.577 1.00 . A A . 26 GLN NE2  1 1 
        7  6759 1 1 26 GLN O    O  -7.418  -9.396  -3.416 1.00 . A A . 26 GLN O    1 1 
        7  6760 1 1 26 GLN OE1  O -10.600 -12.971  -7.279 1.00 . A A . 26 GLN OE1  1 1 
        7  6761 1 1 27 GLN C    C  -6.663 -11.944  -1.782 1.00 . A A . 27 GLN C    1 1 
        7  6762 1 1 27 GLN CA   C  -7.770 -11.054  -1.225 1.00 . A A . 27 GLN CA   1 1 
        7  6763 1 1 27 GLN CB   C  -8.425 -11.730  -0.019 1.00 . A A . 27 GLN CB   1 1 
        7  6764 1 1 27 GLN CD   C -10.430 -11.614   1.508 1.00 . A A . 27 GLN CD   1 1 
        7  6765 1 1 27 GLN CG   C  -9.397 -10.830   0.728 1.00 . A A . 27 GLN CG   1 1 
        7  6766 1 1 27 GLN H    H  -9.657 -11.169  -2.178 1.00 . A A . 27 GLN H    1 1 
        7  6767 1 1 27 GLN HA   H  -7.336 -10.119  -0.910 1.00 . A A . 27 GLN HA   1 1 
        7  6768 1 1 27 GLN HB2  H  -8.965 -12.602  -0.359 1.00 . A A . 27 GLN HB2  1 1 
        7  6769 1 1 27 GLN HB3  H  -7.654 -12.040   0.669 1.00 . A A . 27 GLN HB3  1 1 
        7  6770 1 1 27 GLN HE21 H -11.370 -12.099  -0.178 1.00 . A A . 27 GLN HE21 1 1 
        7  6771 1 1 27 GLN HE22 H -12.070 -12.715   1.276 1.00 . A A . 27 GLN HE22 1 1 
        7  6772 1 1 27 GLN HG2  H  -8.839 -10.215   1.418 1.00 . A A . 27 GLN HG2  1 1 
        7  6773 1 1 27 GLN HG3  H  -9.905 -10.199   0.015 1.00 . A A . 27 GLN HG3  1 1 
        7  6774 1 1 27 GLN N    N  -8.770 -10.759  -2.245 1.00 . A A . 27 GLN N    1 1 
        7  6775 1 1 27 GLN NE2  N -11.380 -12.202   0.797 1.00 . A A . 27 GLN NE2  1 1 
        7  6776 1 1 27 GLN O    O  -5.568 -12.011  -1.222 1.00 . A A . 27 GLN O    1 1 
        7  6777 1 1 27 GLN OE1  O -10.370 -11.689   2.735 1.00 . A A . 27 GLN OE1  1 1 
        7  6778 1 1 28 SER C    C  -4.752 -12.732  -3.976 1.00 . A A . 28 SER C    1 1 
        7  6779 1 1 28 SER CA   C  -5.981 -13.510  -3.516 1.00 . A A . 28 SER CA   1 1 
        7  6780 1 1 28 SER CB   C  -6.616 -14.233  -4.705 1.00 . A A . 28 SER CB   1 1 
        7  6781 1 1 28 SER H    H  -7.841 -12.531  -3.284 1.00 . A A . 28 SER H    1 1 
        7  6782 1 1 28 SER HA   H  -5.675 -14.242  -2.784 1.00 . A A . 28 SER HA   1 1 
        7  6783 1 1 28 SER HB2  H  -5.857 -14.441  -5.443 1.00 . A A . 28 SER HB2  1 1 
        7  6784 1 1 28 SER HB3  H  -7.054 -15.159  -4.367 1.00 . A A . 28 SER HB3  1 1 
        7  6785 1 1 28 SER HG   H  -7.231 -12.659  -5.697 1.00 . A A . 28 SER HG   1 1 
        7  6786 1 1 28 SER N    N  -6.952 -12.625  -2.884 1.00 . A A . 28 SER N    1 1 
        7  6787 1 1 28 SER O    O  -3.618 -13.115  -3.685 1.00 . A A . 28 SER O    1 1 
        7  6788 1 1 28 SER OG   O  -7.628 -13.439  -5.303 1.00 . A A . 28 SER OG   1 1 
        7  6789 1 1 29 ALA C    C  -3.066 -10.240  -4.053 1.00 . A A . 29 ALA C    1 1 
        7  6790 1 1 29 ALA CA   C  -3.896 -10.809  -5.198 1.00 . A A . 29 ALA CA   1 1 
        7  6791 1 1 29 ALA CB   C  -4.445  -9.687  -6.064 1.00 . A A . 29 ALA CB   1 1 
        7  6792 1 1 29 ALA H    H  -5.910 -11.387  -4.896 1.00 . A A . 29 ALA H    1 1 
        7  6793 1 1 29 ALA HA   H  -3.261 -11.430  -5.813 1.00 . A A . 29 ALA HA   1 1 
        7  6794 1 1 29 ALA HB1  H  -4.653  -8.825  -5.449 1.00 . A A . 29 ALA HB1  1 1 
        7  6795 1 1 29 ALA HB2  H  -5.357 -10.014  -6.543 1.00 . A A . 29 ALA HB2  1 1 
        7  6796 1 1 29 ALA HB3  H  -3.717  -9.424  -6.817 1.00 . A A . 29 ALA HB3  1 1 
        7  6797 1 1 29 ALA N    N  -4.984 -11.640  -4.697 1.00 . A A . 29 ALA N    1 1 
        7  6798 1 1 29 ALA O    O  -1.836 -10.231  -4.110 1.00 . A A . 29 ALA O    1 1 
        7  6799 1 1 30 ILE C    C  -2.132 -10.216  -1.218 1.00 . A A . 30 ILE C    1 1 
        7  6800 1 1 30 ILE CA   C  -3.065  -9.195  -1.856 1.00 . A A . 30 ILE CA   1 1 
        7  6801 1 1 30 ILE CB   C  -4.070  -8.701  -0.797 1.00 . A A . 30 ILE CB   1 1 
        7  6802 1 1 30 ILE CD1  C  -4.544  -6.635  -2.210 1.00 . A A . 30 ILE CD1  1 1 
        7  6803 1 1 30 ILE CG1  C  -5.128  -7.800  -1.441 1.00 . A A . 30 ILE CG1  1 1 
        7  6804 1 1 30 ILE CG2  C  -3.346  -7.961   0.318 1.00 . A A . 30 ILE CG2  1 1 
        7  6805 1 1 30 ILE H    H  -4.724  -9.800  -3.026 1.00 . A A . 30 ILE H    1 1 
        7  6806 1 1 30 ILE HA   H  -2.483  -8.352  -2.194 1.00 . A A . 30 ILE HA   1 1 
        7  6807 1 1 30 ILE HB   H  -4.556  -9.562  -0.365 1.00 . A A . 30 ILE HB   1 1 
        7  6808 1 1 30 ILE HD11 H  -3.492  -6.543  -1.982 1.00 . A A . 30 ILE HD11 1 1 
        7  6809 1 1 30 ILE HD12 H  -5.056  -5.725  -1.929 1.00 . A A . 30 ILE HD12 1 1 
        7  6810 1 1 30 ILE HD13 H  -4.669  -6.805  -3.269 1.00 . A A . 30 ILE HD13 1 1 
        7  6811 1 1 30 ILE HG12 H  -5.722  -8.384  -2.126 1.00 . A A . 30 ILE HG12 1 1 
        7  6812 1 1 30 ILE HG13 H  -5.767  -7.400  -0.667 1.00 . A A . 30 ILE HG13 1 1 
        7  6813 1 1 30 ILE HG21 H  -3.127  -6.953  -0.003 1.00 . A A . 30 ILE HG21 1 1 
        7  6814 1 1 30 ILE HG22 H  -2.424  -8.473   0.550 1.00 . A A . 30 ILE HG22 1 1 
        7  6815 1 1 30 ILE HG23 H  -3.973  -7.930   1.196 1.00 . A A . 30 ILE HG23 1 1 
        7  6816 1 1 30 ILE N    N  -3.745  -9.766  -3.014 1.00 . A A . 30 ILE N    1 1 
        7  6817 1 1 30 ILE O    O  -0.977  -9.915  -0.913 1.00 . A A . 30 ILE O    1 1 
        7  6818 1 1 31 ASN C    C  -0.669 -12.863  -1.310 1.00 . A A . 31 ASN C    1 1 
        7  6819 1 1 31 ASN CA   C  -1.850 -12.496  -0.419 1.00 . A A . 31 ASN CA   1 1 
        7  6820 1 1 31 ASN CB   C  -2.724 -13.728  -0.177 1.00 . A A . 31 ASN CB   1 1 
        7  6821 1 1 31 ASN CG   C  -2.220 -14.577   0.975 1.00 . A A . 31 ASN CG   1 1 
        7  6822 1 1 31 ASN H    H  -3.563 -11.608  -1.282 1.00 . A A . 31 ASN H    1 1 
        7  6823 1 1 31 ASN HA   H  -1.475 -12.140   0.527 1.00 . A A . 31 ASN HA   1 1 
        7  6824 1 1 31 ASN HB2  H  -3.731 -13.410   0.051 1.00 . A A . 31 ASN HB2  1 1 
        7  6825 1 1 31 ASN HB3  H  -2.735 -14.335  -1.070 1.00 . A A . 31 ASN HB3  1 1 
        7  6826 1 1 31 ASN HD21 H  -3.596 -15.961   0.586 1.00 . A A . 31 ASN HD21 1 1 
        7  6827 1 1 31 ASN HD22 H  -2.542 -16.297   1.923 1.00 . A A . 31 ASN HD22 1 1 
        7  6828 1 1 31 ASN N    N  -2.637 -11.428  -1.018 1.00 . A A . 31 ASN N    1 1 
        7  6829 1 1 31 ASN ND2  N  -2.849 -15.726   1.182 1.00 . A A . 31 ASN ND2  1 1 
        7  6830 1 1 31 ASN O    O   0.405 -13.212  -0.820 1.00 . A A . 31 ASN O    1 1 
        7  6831 1 1 31 ASN OD1  O  -1.275 -14.202   1.669 1.00 . A A . 31 ASN OD1  1 1 
        7  6832 1 1 32 LYS C    C   1.229 -12.014  -3.634 1.00 . A A . 32 LYS C    1 1 
        7  6833 1 1 32 LYS CA   C   0.170 -13.107  -3.580 1.00 . A A . 32 LYS CA   1 1 
        7  6834 1 1 32 LYS CB   C  -0.428 -13.316  -4.973 1.00 . A A . 32 LYS CB   1 1 
        7  6835 1 1 32 LYS CD   C  -1.094 -15.652  -5.621 1.00 . A A . 32 LYS CD   1 1 
        7  6836 1 1 32 LYS CE   C  -1.663 -16.847  -4.873 1.00 . A A . 32 LYS CE   1 1 
        7  6837 1 1 32 LYS CG   C  -1.553 -14.340  -5.004 1.00 . A A . 32 LYS CG   1 1 
        7  6838 1 1 32 LYS H    H  -1.751 -12.501  -2.951 1.00 . A A . 32 LYS H    1 1 
        7  6839 1 1 32 LYS HA   H   0.634 -14.020  -3.259 1.00 . A A . 32 LYS HA   1 1 
        7  6840 1 1 32 LYS HB2  H  -0.819 -12.372  -5.328 1.00 . A A . 32 LYS HB2  1 1 
        7  6841 1 1 32 LYS HB3  H   0.352 -13.647  -5.642 1.00 . A A . 32 LYS HB3  1 1 
        7  6842 1 1 32 LYS HD2  H  -1.427 -15.692  -6.647 1.00 . A A . 32 LYS HD2  1 1 
        7  6843 1 1 32 LYS HD3  H  -0.017 -15.698  -5.589 1.00 . A A . 32 LYS HD3  1 1 
        7  6844 1 1 32 LYS HE2  H  -0.934 -17.643  -4.884 1.00 . A A . 32 LYS HE2  1 1 
        7  6845 1 1 32 LYS HE3  H  -1.861 -16.557  -3.852 1.00 . A A . 32 LYS HE3  1 1 
        7  6846 1 1 32 LYS HG2  H  -1.886 -14.525  -3.995 1.00 . A A . 32 LYS HG2  1 1 
        7  6847 1 1 32 LYS HG3  H  -2.370 -13.943  -5.588 1.00 . A A . 32 LYS HG3  1 1 
        7  6848 1 1 32 LYS HZ1  H  -3.747 -16.954  -4.982 1.00 . A A . 32 LYS HZ1  1 1 
        7  6849 1 1 32 LYS HZ2  H  -2.964 -18.378  -5.446 1.00 . A A . 32 LYS HZ2  1 1 
        7  6850 1 1 32 LYS HZ3  H  -2.976 -17.045  -6.486 1.00 . A A . 32 LYS HZ3  1 1 
        7  6851 1 1 32 LYS N    N  -0.875 -12.782  -2.621 1.00 . A A . 32 LYS N    1 1 
        7  6852 1 1 32 LYS NZ   N  -2.926 -17.340  -5.491 1.00 . A A . 32 LYS NZ   1 1 
        7  6853 1 1 32 LYS O    O   2.389 -12.272  -3.956 1.00 . A A . 32 LYS O    1 1 
        7  6854 1 1 33 TRP C    C   2.756  -9.752  -2.237 1.00 . A A . 33 TRP C    1 1 
        7  6855 1 1 33 TRP CA   C   1.715  -9.655  -3.347 1.00 . A A . 33 TRP CA   1 1 
        7  6856 1 1 33 TRP CB   C   0.886  -8.391  -3.194 1.00 . A A . 33 TRP CB   1 1 
        7  6857 1 1 33 TRP CD1  C   0.284  -8.581  -5.645 1.00 . A A . 33 TRP CD1  1 1 
        7  6858 1 1 33 TRP CD2  C  -0.924  -7.081  -4.533 1.00 . A A . 33 TRP CD2  1 1 
        7  6859 1 1 33 TRP CE2  C  -1.347  -7.081  -5.873 1.00 . A A . 33 TRP CE2  1 1 
        7  6860 1 1 33 TRP CE3  C  -1.541  -6.224  -3.630 1.00 . A A . 33 TRP CE3  1 1 
        7  6861 1 1 33 TRP CG   C   0.125  -8.036  -4.421 1.00 . A A . 33 TRP CG   1 1 
        7  6862 1 1 33 TRP CH2  C  -2.955  -5.413  -5.425 1.00 . A A . 33 TRP CH2  1 1 
        7  6863 1 1 33 TRP CZ2  C  -2.363  -6.250  -6.334 1.00 . A A . 33 TRP CZ2  1 1 
        7  6864 1 1 33 TRP CZ3  C  -2.553  -5.396  -4.081 1.00 . A A . 33 TRP CZ3  1 1 
        7  6865 1 1 33 TRP H    H  -0.119 -10.643  -3.087 1.00 . A A . 33 TRP H    1 1 
        7  6866 1 1 33 TRP HA   H   2.215  -9.635  -4.304 1.00 . A A . 33 TRP HA   1 1 
        7  6867 1 1 33 TRP HB2  H   0.172  -8.548  -2.415 1.00 . A A . 33 TRP HB2  1 1 
        7  6868 1 1 33 TRP HB3  H   1.530  -7.567  -2.941 1.00 . A A . 33 TRP HB3  1 1 
        7  6869 1 1 33 TRP HD1  H   1.003  -9.345  -5.860 1.00 . A A . 33 TRP HD1  1 1 
        7  6870 1 1 33 TRP HE1  H  -0.660  -8.227  -7.489 1.00 . A A . 33 TRP HE1  1 1 
        7  6871 1 1 33 TRP HE3  H  -1.243  -6.207  -2.592 1.00 . A A . 33 TRP HE3  1 1 
        7  6872 1 1 33 TRP HH2  H  -3.749  -4.751  -5.737 1.00 . A A . 33 TRP HH2  1 1 
        7  6873 1 1 33 TRP HZ2  H  -2.680  -6.255  -7.365 1.00 . A A . 33 TRP HZ2  1 1 
        7  6874 1 1 33 TRP HZ3  H  -3.045  -4.721  -3.395 1.00 . A A . 33 TRP HZ3  1 1 
        7  6875 1 1 33 TRP N    N   0.819 -10.792  -3.329 1.00 . A A . 33 TRP N    1 1 
        7  6876 1 1 33 TRP NE1  N  -0.589  -8.008  -6.538 1.00 . A A . 33 TRP NE1  1 1 
        7  6877 1 1 33 TRP O    O   3.945  -9.528  -2.465 1.00 . A A . 33 TRP O    1 1 
        7  6878 1 1 34 ILE C    C   3.932 -11.555   0.082 1.00 . A A . 34 ILE C    1 1 
        7  6879 1 1 34 ILE CA   C   3.196 -10.221   0.111 1.00 . A A . 34 ILE CA   1 1 
        7  6880 1 1 34 ILE CB   C   2.428 -10.101   1.441 1.00 . A A . 34 ILE CB   1 1 
        7  6881 1 1 34 ILE CD1  C   0.652  -8.741   2.656 1.00 . A A . 34 ILE CD1  1 1 
        7  6882 1 1 34 ILE CG1  C   1.512  -8.876   1.419 1.00 . A A . 34 ILE CG1  1 1 
        7  6883 1 1 34 ILE CG2  C   3.399 -10.022   2.609 1.00 . A A . 34 ILE CG2  1 1 
        7  6884 1 1 34 ILE H    H   1.345 -10.260  -0.914 1.00 . A A . 34 ILE H    1 1 
        7  6885 1 1 34 ILE HA   H   3.919  -9.420   0.063 1.00 . A A . 34 ILE HA   1 1 
        7  6886 1 1 34 ILE HB   H   1.826 -10.988   1.565 1.00 . A A . 34 ILE HB   1 1 
        7  6887 1 1 34 ILE HD11 H   0.611  -7.704   2.955 1.00 . A A . 34 ILE HD11 1 1 
        7  6888 1 1 34 ILE HD12 H   1.078  -9.330   3.456 1.00 . A A . 34 ILE HD12 1 1 
        7  6889 1 1 34 ILE HD13 H  -0.346  -9.094   2.441 1.00 . A A . 34 ILE HD13 1 1 
        7  6890 1 1 34 ILE HG12 H   2.115  -7.984   1.337 1.00 . A A . 34 ILE HG12 1 1 
        7  6891 1 1 34 ILE HG13 H   0.856  -8.941   0.563 1.00 . A A . 34 ILE HG13 1 1 
        7  6892 1 1 34 ILE HG21 H   2.853  -9.816   3.518 1.00 . A A . 34 ILE HG21 1 1 
        7  6893 1 1 34 ILE HG22 H   4.112  -9.232   2.430 1.00 . A A . 34 ILE HG22 1 1 
        7  6894 1 1 34 ILE HG23 H   3.921 -10.962   2.708 1.00 . A A . 34 ILE HG23 1 1 
        7  6895 1 1 34 ILE N    N   2.302 -10.091  -1.034 1.00 . A A . 34 ILE N    1 1 
        7  6896 1 1 34 ILE O    O   5.053 -11.669   0.576 1.00 . A A . 34 ILE O    1 1 
        7  6897 1 1 35 HIS C    C   5.145 -13.864  -1.451 1.00 . A A . 35 HIS C    1 1 
        7  6898 1 1 35 HIS CA   C   3.882 -13.892  -0.604 1.00 . A A . 35 HIS CA   1 1 
        7  6899 1 1 35 HIS CB   C   2.871 -14.870  -1.205 1.00 . A A . 35 HIS CB   1 1 
        7  6900 1 1 35 HIS CD2  C   1.388 -16.815  -0.348 1.00 . A A . 35 HIS CD2  1 1 
        7  6901 1 1 35 HIS CE1  C   1.577 -16.447   1.805 1.00 . A A . 35 HIS CE1  1 1 
        7  6902 1 1 35 HIS CG   C   2.187 -15.735  -0.191 1.00 . A A . 35 HIS CG   1 1 
        7  6903 1 1 35 HIS H    H   2.403 -12.409  -0.881 1.00 . A A . 35 HIS H    1 1 
        7  6904 1 1 35 HIS HA   H   4.140 -14.215   0.384 1.00 . A A . 35 HIS HA   1 1 
        7  6905 1 1 35 HIS HB2  H   2.110 -14.311  -1.730 1.00 . A A . 35 HIS HB2  1 1 
        7  6906 1 1 35 HIS HB3  H   3.379 -15.517  -1.905 1.00 . A A . 35 HIS HB3  1 1 
        7  6907 1 1 35 HIS HD1  H   2.797 -14.816   1.607 1.00 . A A . 35 HIS HD1  1 1 
        7  6908 1 1 35 HIS HD2  H   1.089 -17.260  -1.287 1.00 . A A . 35 HIS HD2  1 1 
        7  6909 1 1 35 HIS HE1  H   1.470 -16.534   2.875 1.00 . A A . 35 HIS HE1  1 1 
        7  6910 1 1 35 HIS HE2  H   0.527 -18.060   1.106 1.00 . A A . 35 HIS HE2  1 1 
        7  6911 1 1 35 HIS N    N   3.293 -12.563  -0.505 1.00 . A A . 35 HIS N    1 1 
        7  6912 1 1 35 HIS ND1  N   2.286 -15.528   1.169 1.00 . A A . 35 HIS ND1  1 1 
        7  6913 1 1 35 HIS NE2  N   1.022 -17.238   0.905 1.00 . A A . 35 HIS NE2  1 1 
        7  6914 1 1 35 HIS O    O   6.230 -14.224  -0.993 1.00 . A A . 35 HIS O    1 1 
        7  6915 1 1 36 ALA C    C   7.158 -12.355  -3.148 1.00 . A A . 36 ALA C    1 1 
        7  6916 1 1 36 ALA CA   C   6.102 -13.350  -3.625 1.00 . A A . 36 ALA CA   1 1 
        7  6917 1 1 36 ALA CB   C   5.599 -12.967  -5.008 1.00 . A A . 36 ALA CB   1 1 
        7  6918 1 1 36 ALA H    H   4.095 -13.166  -2.979 1.00 . A A . 36 ALA H    1 1 
        7  6919 1 1 36 ALA HA   H   6.552 -14.328  -3.692 1.00 . A A . 36 ALA HA   1 1 
        7  6920 1 1 36 ALA HB1  H   5.479 -11.895  -5.063 1.00 . A A . 36 ALA HB1  1 1 
        7  6921 1 1 36 ALA HB2  H   4.647 -13.445  -5.190 1.00 . A A . 36 ALA HB2  1 1 
        7  6922 1 1 36 ALA HB3  H   6.311 -13.288  -5.753 1.00 . A A . 36 ALA HB3  1 1 
        7  6923 1 1 36 ALA N    N   4.988 -13.433  -2.689 1.00 . A A . 36 ALA N    1 1 
        7  6924 1 1 36 ALA O    O   8.298 -12.379  -3.612 1.00 . A A . 36 ALA O    1 1 
        7  6925 1 1 37 GLY C    C   7.839  -9.291  -2.612 1.00 . A A . 37 GLY C    1 1 
        7  6926 1 1 37 GLY CA   C   7.702 -10.496  -1.702 1.00 . A A . 37 GLY CA   1 1 
        7  6927 1 1 37 GLY H    H   5.853 -11.510  -1.889 1.00 . A A . 37 GLY H    1 1 
        7  6928 1 1 37 GLY HA2  H   7.354 -10.166  -0.735 1.00 . A A . 37 GLY HA2  1 1 
        7  6929 1 1 37 GLY HA3  H   8.672 -10.958  -1.585 1.00 . A A . 37 GLY HA3  1 1 
        7  6930 1 1 37 GLY N    N   6.774 -11.483  -2.222 1.00 . A A . 37 GLY N    1 1 
        7  6931 1 1 37 GLY O    O   8.928  -8.737  -2.759 1.00 . A A . 37 GLY O    1 1 
        7  6932 1 1 38 ARG C    C   6.485  -6.444  -3.355 1.00 . A A . 38 ARG C    1 1 
        7  6933 1 1 38 ARG CA   C   6.732  -7.737  -4.124 1.00 . A A . 38 ARG CA   1 1 
        7  6934 1 1 38 ARG CB   C   5.667  -7.911  -5.207 1.00 . A A . 38 ARG CB   1 1 
        7  6935 1 1 38 ARG CD   C   5.076  -6.066  -6.814 1.00 . A A . 38 ARG CD   1 1 
        7  6936 1 1 38 ARG CG   C   6.016  -7.226  -6.520 1.00 . A A . 38 ARG CG   1 1 
        7  6937 1 1 38 ARG CZ   C   4.278  -6.463  -9.112 1.00 . A A . 38 ARG CZ   1 1 
        7  6938 1 1 38 ARG H    H   5.894  -9.368  -3.066 1.00 . A A . 38 ARG H    1 1 
        7  6939 1 1 38 ARG HA   H   7.705  -7.685  -4.591 1.00 . A A . 38 ARG HA   1 1 
        7  6940 1 1 38 ARG HB2  H   5.536  -8.966  -5.401 1.00 . A A . 38 ARG HB2  1 1 
        7  6941 1 1 38 ARG HB3  H   4.734  -7.502  -4.848 1.00 . A A . 38 ARG HB3  1 1 
        7  6942 1 1 38 ARG HD2  H   4.088  -6.323  -6.462 1.00 . A A . 38 ARG HD2  1 1 
        7  6943 1 1 38 ARG HD3  H   5.429  -5.192  -6.288 1.00 . A A . 38 ARG HD3  1 1 
        7  6944 1 1 38 ARG HE   H   5.531  -5.006  -8.570 1.00 . A A . 38 ARG HE   1 1 
        7  6945 1 1 38 ARG HG2  H   7.026  -6.850  -6.461 1.00 . A A . 38 ARG HG2  1 1 
        7  6946 1 1 38 ARG HG3  H   5.945  -7.948  -7.320 1.00 . A A . 38 ARG HG3  1 1 
        7  6947 1 1 38 ARG HH11 H   3.559  -7.763  -7.739 1.00 . A A . 38 ARG HH11 1 1 
        7  6948 1 1 38 ARG HH12 H   3.012  -8.019  -9.362 1.00 . A A . 38 ARG HH12 1 1 
        7  6949 1 1 38 ARG HH21 H   4.811  -5.339 -10.705 1.00 . A A . 38 ARG HH21 1 1 
        7  6950 1 1 38 ARG HH22 H   3.722  -6.643 -11.046 1.00 . A A . 38 ARG HH22 1 1 
        7  6951 1 1 38 ARG N    N   6.731  -8.885  -3.224 1.00 . A A . 38 ARG N    1 1 
        7  6952 1 1 38 ARG NE   N   5.006  -5.766  -8.241 1.00 . A A . 38 ARG NE   1 1 
        7  6953 1 1 38 ARG NH1  N   3.557  -7.500  -8.703 1.00 . A A . 38 ARG NH1  1 1 
        7  6954 1 1 38 ARG NH2  N   4.270  -6.120 -10.393 1.00 . A A . 38 ARG NH2  1 1 
        7  6955 1 1 38 ARG O    O   5.384  -6.206  -2.859 1.00 . A A . 38 ARG O    1 1 
        7  6956 1 1 39 LYS C    C   6.383  -3.434  -3.218 1.00 . A A . 39 LYS C    1 1 
        7  6957 1 1 39 LYS CA   C   7.410  -4.341  -2.549 1.00 . A A . 39 LYS CA   1 1 
        7  6958 1 1 39 LYS CB   C   8.773  -3.645  -2.499 1.00 . A A . 39 LYS CB   1 1 
        7  6959 1 1 39 LYS CD   C   9.987  -2.231  -0.809 1.00 . A A . 39 LYS CD   1 1 
        7  6960 1 1 39 LYS CE   C   9.715  -1.796   0.621 1.00 . A A . 39 LYS CE   1 1 
        7  6961 1 1 39 LYS CG   C   9.376  -3.593  -1.103 1.00 . A A . 39 LYS CG   1 1 
        7  6962 1 1 39 LYS H    H   8.369  -5.856  -3.673 1.00 . A A . 39 LYS H    1 1 
        7  6963 1 1 39 LYS HA   H   7.085  -4.551  -1.541 1.00 . A A . 39 LYS HA   1 1 
        7  6964 1 1 39 LYS HB2  H   9.459  -4.175  -3.143 1.00 . A A . 39 LYS HB2  1 1 
        7  6965 1 1 39 LYS HB3  H   8.663  -2.633  -2.859 1.00 . A A . 39 LYS HB3  1 1 
        7  6966 1 1 39 LYS HD2  H  11.055  -2.285  -0.961 1.00 . A A . 39 LYS HD2  1 1 
        7  6967 1 1 39 LYS HD3  H   9.562  -1.503  -1.485 1.00 . A A . 39 LYS HD3  1 1 
        7  6968 1 1 39 LYS HE2  H   8.679  -1.500   0.705 1.00 . A A . 39 LYS HE2  1 1 
        7  6969 1 1 39 LYS HE3  H   9.903  -2.630   1.281 1.00 . A A . 39 LYS HE3  1 1 
        7  6970 1 1 39 LYS HG2  H   8.601  -3.792  -0.378 1.00 . A A . 39 LYS HG2  1 1 
        7  6971 1 1 39 LYS HG3  H  10.146  -4.347  -1.026 1.00 . A A . 39 LYS HG3  1 1 
        7  6972 1 1 39 LYS HZ1  H  11.514  -0.997   1.317 1.00 . A A . 39 LYS HZ1  1 1 
        7  6973 1 1 39 LYS HZ2  H  10.146  -0.145   1.828 1.00 . A A . 39 LYS HZ2  1 1 
        7  6974 1 1 39 LYS HZ3  H  10.691   0.009   0.234 1.00 . A A . 39 LYS HZ3  1 1 
        7  6975 1 1 39 LYS N    N   7.518  -5.612  -3.258 1.00 . A A . 39 LYS N    1 1 
        7  6976 1 1 39 LYS NZ   N  10.577  -0.652   1.029 1.00 . A A . 39 LYS NZ   1 1 
        7  6977 1 1 39 LYS O    O   6.451  -3.184  -4.422 1.00 . A A . 39 LYS O    1 1 
        7  6978 1 1 40 ILE C    C   3.963  -1.039  -1.909 1.00 . A A . 40 ILE C    1 1 
        7  6979 1 1 40 ILE CA   C   4.387  -2.068  -2.949 1.00 . A A . 40 ILE CA   1 1 
        7  6980 1 1 40 ILE CB   C   3.147  -2.872  -3.393 1.00 . A A . 40 ILE CB   1 1 
        7  6981 1 1 40 ILE CD1  C   2.368  -4.725  -4.953 1.00 . A A . 40 ILE CD1  1 1 
        7  6982 1 1 40 ILE CG1  C   3.544  -3.941  -4.413 1.00 . A A . 40 ILE CG1  1 1 
        7  6983 1 1 40 ILE CG2  C   2.087  -1.945  -3.975 1.00 . A A . 40 ILE CG2  1 1 
        7  6984 1 1 40 ILE H    H   5.425  -3.182  -1.481 1.00 . A A . 40 ILE H    1 1 
        7  6985 1 1 40 ILE HA   H   4.783  -1.553  -3.812 1.00 . A A . 40 ILE HA   1 1 
        7  6986 1 1 40 ILE HB   H   2.729  -3.354  -2.524 1.00 . A A . 40 ILE HB   1 1 
        7  6987 1 1 40 ILE HD11 H   2.680  -5.732  -5.181 1.00 . A A . 40 ILE HD11 1 1 
        7  6988 1 1 40 ILE HD12 H   2.001  -4.248  -5.851 1.00 . A A . 40 ILE HD12 1 1 
        7  6989 1 1 40 ILE HD13 H   1.582  -4.749  -4.213 1.00 . A A . 40 ILE HD13 1 1 
        7  6990 1 1 40 ILE HG12 H   4.036  -3.467  -5.249 1.00 . A A . 40 ILE HG12 1 1 
        7  6991 1 1 40 ILE HG13 H   4.223  -4.639  -3.948 1.00 . A A . 40 ILE HG13 1 1 
        7  6992 1 1 40 ILE HG21 H   1.303  -2.534  -4.427 1.00 . A A . 40 ILE HG21 1 1 
        7  6993 1 1 40 ILE HG22 H   2.538  -1.310  -4.724 1.00 . A A . 40 ILE HG22 1 1 
        7  6994 1 1 40 ILE HG23 H   1.673  -1.334  -3.188 1.00 . A A . 40 ILE HG23 1 1 
        7  6995 1 1 40 ILE N    N   5.430  -2.946  -2.430 1.00 . A A . 40 ILE N    1 1 
        7  6996 1 1 40 ILE O    O   4.157  -1.234  -0.709 1.00 . A A . 40 ILE O    1 1 
        7  6997 1 1 41 PHE C    C   1.564   1.656  -1.958 1.00 . A A . 41 PHE C    1 1 
        7  6998 1 1 41 PHE CA   C   2.913   1.118  -1.493 1.00 . A A . 41 PHE CA   1 1 
        7  6999 1 1 41 PHE CB   C   3.933   2.259  -1.440 1.00 . A A . 41 PHE CB   1 1 
        7  7000 1 1 41 PHE CD1  C   6.088   0.989  -1.210 1.00 . A A . 41 PHE CD1  1 1 
        7  7001 1 1 41 PHE CD2  C   5.475   2.506   0.526 1.00 . A A . 41 PHE CD2  1 1 
        7  7002 1 1 41 PHE CE1  C   7.244   0.669  -0.526 1.00 . A A . 41 PHE CE1  1 1 
        7  7003 1 1 41 PHE CE2  C   6.631   2.187   1.216 1.00 . A A . 41 PHE CE2  1 1 
        7  7004 1 1 41 PHE CG   C   5.190   1.911  -0.693 1.00 . A A . 41 PHE CG   1 1 
        7  7005 1 1 41 PHE CZ   C   7.516   1.267   0.688 1.00 . A A . 41 PHE CZ   1 1 
        7  7006 1 1 41 PHE H    H   3.245   0.150  -3.347 1.00 . A A . 41 PHE H    1 1 
        7  7007 1 1 41 PHE HA   H   2.800   0.699  -0.506 1.00 . A A . 41 PHE HA   1 1 
        7  7008 1 1 41 PHE HB2  H   4.211   2.531  -2.447 1.00 . A A . 41 PHE HB2  1 1 
        7  7009 1 1 41 PHE HB3  H   3.482   3.114  -0.954 1.00 . A A . 41 PHE HB3  1 1 
        7  7010 1 1 41 PHE HD1  H   5.876   0.521  -2.160 1.00 . A A . 41 PHE HD1  1 1 
        7  7011 1 1 41 PHE HD2  H   4.783   3.225   0.939 1.00 . A A . 41 PHE HD2  1 1 
        7  7012 1 1 41 PHE HE1  H   7.935  -0.052  -0.940 1.00 . A A . 41 PHE HE1  1 1 
        7  7013 1 1 41 PHE HE2  H   6.841   2.659   2.164 1.00 . A A . 41 PHE HE2  1 1 
        7  7014 1 1 41 PHE HZ   H   8.420   1.018   1.225 1.00 . A A . 41 PHE HZ   1 1 
        7  7015 1 1 41 PHE N    N   3.376   0.056  -2.379 1.00 . A A . 41 PHE N    1 1 
        7  7016 1 1 41 PHE O    O   1.395   2.005  -3.126 1.00 . A A . 41 PHE O    1 1 
        7  7017 1 1 42 LEU C    C  -0.846   3.702  -1.061 1.00 . A A . 42 LEU C    1 1 
        7  7018 1 1 42 LEU CA   C  -0.722   2.216  -1.371 1.00 . A A . 42 LEU CA   1 1 
        7  7019 1 1 42 LEU CB   C  -1.790   1.435  -0.604 1.00 . A A . 42 LEU CB   1 1 
        7  7020 1 1 42 LEU CD1  C  -0.511  -0.118   0.908 1.00 . A A . 42 LEU CD1  1 1 
        7  7021 1 1 42 LEU CD2  C  -0.851   2.279   1.576 1.00 . A A . 42 LEU CD2  1 1 
        7  7022 1 1 42 LEU CG   C  -1.446   1.082   0.845 1.00 . A A . 42 LEU CG   1 1 
        7  7023 1 1 42 LEU H    H   0.792   1.430  -0.124 1.00 . A A . 42 LEU H    1 1 
        7  7024 1 1 42 LEU HA   H  -0.875   2.068  -2.427 1.00 . A A . 42 LEU HA   1 1 
        7  7025 1 1 42 LEU HB2  H  -2.694   2.023  -0.599 1.00 . A A . 42 LEU HB2  1 1 
        7  7026 1 1 42 LEU HB3  H  -1.982   0.516  -1.137 1.00 . A A . 42 LEU HB3  1 1 
        7  7027 1 1 42 LEU HD11 H  -0.140  -0.338  -0.082 1.00 . A A . 42 LEU HD11 1 1 
        7  7028 1 1 42 LEU HD12 H  -1.048  -0.974   1.290 1.00 . A A . 42 LEU HD12 1 1 
        7  7029 1 1 42 LEU HD13 H   0.320   0.106   1.562 1.00 . A A . 42 LEU HD13 1 1 
        7  7030 1 1 42 LEU HD21 H  -1.390   3.173   1.300 1.00 . A A . 42 LEU HD21 1 1 
        7  7031 1 1 42 LEU HD22 H   0.189   2.389   1.308 1.00 . A A . 42 LEU HD22 1 1 
        7  7032 1 1 42 LEU HD23 H  -0.931   2.126   2.641 1.00 . A A . 42 LEU HD23 1 1 
        7  7033 1 1 42 LEU HG   H  -2.352   0.809   1.351 1.00 . A A . 42 LEU HG   1 1 
        7  7034 1 1 42 LEU N    N   0.606   1.722  -1.040 1.00 . A A . 42 LEU N    1 1 
        7  7035 1 1 42 LEU O    O  -0.141   4.230  -0.204 1.00 . A A . 42 LEU O    1 1 
        7  7036 1 1 43 THR C    C  -3.429   6.065  -1.193 1.00 . A A . 43 THR C    1 1 
        7  7037 1 1 43 THR CA   C  -1.977   5.795  -1.570 1.00 . A A . 43 THR CA   1 1 
        7  7038 1 1 43 THR CB   C  -1.614   6.570  -2.835 1.00 . A A . 43 THR CB   1 1 
        7  7039 1 1 43 THR CG2  C  -1.405   8.050  -2.592 1.00 . A A . 43 THR CG2  1 1 
        7  7040 1 1 43 THR H    H  -2.287   3.890  -2.434 1.00 . A A . 43 THR H    1 1 
        7  7041 1 1 43 THR HA   H  -1.341   6.122  -0.761 1.00 . A A . 43 THR HA   1 1 
        7  7042 1 1 43 THR HB   H  -2.415   6.463  -3.552 1.00 . A A . 43 THR HB   1 1 
        7  7043 1 1 43 THR HG1  H  -0.568   5.147  -3.681 1.00 . A A . 43 THR HG1  1 1 
        7  7044 1 1 43 THR HG21 H  -0.421   8.336  -2.931 1.00 . A A . 43 THR HG21 1 1 
        7  7045 1 1 43 THR HG22 H  -1.497   8.257  -1.537 1.00 . A A . 43 THR HG22 1 1 
        7  7046 1 1 43 THR HG23 H  -2.151   8.612  -3.135 1.00 . A A . 43 THR HG23 1 1 
        7  7047 1 1 43 THR N    N  -1.754   4.369  -1.767 1.00 . A A . 43 THR N    1 1 
        7  7048 1 1 43 THR O    O  -4.331   5.916  -2.018 1.00 . A A . 43 THR O    1 1 
        7  7049 1 1 43 THR OG1  O  -0.426   6.057  -3.413 1.00 . A A . 43 THR OG1  1 1 
        7  7050 1 1 44 ILE C    C  -5.409   8.172   0.171 1.00 . A A . 44 ILE C    1 1 
        7  7051 1 1 44 ILE CA   C  -4.991   6.753   0.537 1.00 . A A . 44 ILE CA   1 1 
        7  7052 1 1 44 ILE CB   C  -5.096   6.580   2.064 1.00 . A A . 44 ILE CB   1 1 
        7  7053 1 1 44 ILE CD1  C  -4.524   5.014   3.986 1.00 . A A . 44 ILE CD1  1 1 
        7  7054 1 1 44 ILE CG1  C  -4.515   5.230   2.488 1.00 . A A . 44 ILE CG1  1 1 
        7  7055 1 1 44 ILE CG2  C  -6.546   6.705   2.513 1.00 . A A . 44 ILE CG2  1 1 
        7  7056 1 1 44 ILE H    H  -2.887   6.563   0.667 1.00 . A A . 44 ILE H    1 1 
        7  7057 1 1 44 ILE HA   H  -5.671   6.056   0.068 1.00 . A A . 44 ILE HA   1 1 
        7  7058 1 1 44 ILE HB   H  -4.530   7.371   2.533 1.00 . A A . 44 ILE HB   1 1 
        7  7059 1 1 44 ILE HD11 H  -4.427   5.964   4.488 1.00 . A A . 44 ILE HD11 1 1 
        7  7060 1 1 44 ILE HD12 H  -3.699   4.374   4.262 1.00 . A A . 44 ILE HD12 1 1 
        7  7061 1 1 44 ILE HD13 H  -5.453   4.547   4.276 1.00 . A A . 44 ILE HD13 1 1 
        7  7062 1 1 44 ILE HG12 H  -5.092   4.439   2.036 1.00 . A A . 44 ILE HG12 1 1 
        7  7063 1 1 44 ILE HG13 H  -3.491   5.165   2.149 1.00 . A A . 44 ILE HG13 1 1 
        7  7064 1 1 44 ILE HG21 H  -7.079   7.350   1.832 1.00 . A A . 44 ILE HG21 1 1 
        7  7065 1 1 44 ILE HG22 H  -6.580   7.124   3.508 1.00 . A A . 44 ILE HG22 1 1 
        7  7066 1 1 44 ILE HG23 H  -7.006   5.727   2.518 1.00 . A A . 44 ILE HG23 1 1 
        7  7067 1 1 44 ILE N    N  -3.647   6.463   0.055 1.00 . A A . 44 ILE N    1 1 
        7  7068 1 1 44 ILE O    O  -4.927   9.142   0.757 1.00 . A A . 44 ILE O    1 1 
        7  7069 1 1 45 ASN C    C  -7.852  10.129  -0.289 1.00 . A A . 45 ASN C    1 1 
        7  7070 1 1 45 ASN CA   C  -6.789   9.591  -1.242 1.00 . A A . 45 ASN CA   1 1 
        7  7071 1 1 45 ASN CB   C  -7.358   9.496  -2.658 1.00 . A A . 45 ASN CB   1 1 
        7  7072 1 1 45 ASN CG   C  -6.426   8.771  -3.609 1.00 . A A . 45 ASN CG   1 1 
        7  7073 1 1 45 ASN H    H  -6.656   7.476  -1.230 1.00 . A A . 45 ASN H    1 1 
        7  7074 1 1 45 ASN HA   H  -5.950  10.270  -1.244 1.00 . A A . 45 ASN HA   1 1 
        7  7075 1 1 45 ASN HB2  H  -8.296   8.963  -2.627 1.00 . A A . 45 ASN HB2  1 1 
        7  7076 1 1 45 ASN HB3  H  -7.527  10.493  -3.038 1.00 . A A . 45 ASN HB3  1 1 
        7  7077 1 1 45 ASN HD21 H  -7.972   7.831  -4.439 1.00 . A A . 45 ASN HD21 1 1 
        7  7078 1 1 45 ASN HD22 H  -6.411   7.448  -5.097 1.00 . A A . 45 ASN HD22 1 1 
        7  7079 1 1 45 ASN N    N  -6.308   8.288  -0.800 1.00 . A A . 45 ASN N    1 1 
        7  7080 1 1 45 ASN ND2  N  -6.993   7.931  -4.469 1.00 . A A . 45 ASN ND2  1 1 
        7  7081 1 1 45 ASN O    O  -8.254   9.450   0.657 1.00 . A A . 45 ASN O    1 1 
        7  7082 1 1 45 ASN OD1  O  -5.211   8.962  -3.572 1.00 . A A . 45 ASN OD1  1 1 
        7  7083 1 1 46 ALA C    C -10.730  11.628  -0.194 1.00 . A A . 46 ALA C    1 1 
        7  7084 1 1 46 ALA CA   C  -9.328  11.978   0.286 1.00 . A A . 46 ALA CA   1 1 
        7  7085 1 1 46 ALA CB   C  -9.135  13.487   0.301 1.00 . A A . 46 ALA CB   1 1 
        7  7086 1 1 46 ALA H    H  -7.950  11.842  -1.315 1.00 . A A . 46 ALA H    1 1 
        7  7087 1 1 46 ALA HA   H  -9.203  11.615   1.296 1.00 . A A . 46 ALA HA   1 1 
        7  7088 1 1 46 ALA HB1  H  -9.034  13.845  -0.713 1.00 . A A . 46 ALA HB1  1 1 
        7  7089 1 1 46 ALA HB2  H  -8.245  13.731   0.860 1.00 . A A . 46 ALA HB2  1 1 
        7  7090 1 1 46 ALA HB3  H  -9.993  13.954   0.763 1.00 . A A . 46 ALA HB3  1 1 
        7  7091 1 1 46 ALA N    N  -8.307  11.351  -0.546 1.00 . A A . 46 ALA N    1 1 
        7  7092 1 1 46 ALA O    O -11.720  12.177   0.294 1.00 . A A . 46 ALA O    1 1 
        7  7093 1 1 47 ASP C    C -12.440   8.872  -1.251 1.00 . A A . 47 ASP C    1 1 
        7  7094 1 1 47 ASP CA   C -12.100  10.289  -1.703 1.00 . A A . 47 ASP CA   1 1 
        7  7095 1 1 47 ASP CB   C -12.070  10.351  -3.235 1.00 . A A . 47 ASP CB   1 1 
        7  7096 1 1 47 ASP CG   C -10.670  10.340  -3.814 1.00 . A A . 47 ASP CG   1 1 
        7  7097 1 1 47 ASP H    H -10.000  10.309  -1.508 1.00 . A A . 47 ASP H    1 1 
        7  7098 1 1 47 ASP HA   H -12.850  10.965  -1.336 1.00 . A A . 47 ASP HA   1 1 
        7  7099 1 1 47 ASP HB2  H -12.600   9.496  -3.627 1.00 . A A . 47 ASP HB2  1 1 
        7  7100 1 1 47 ASP HB3  H -12.570  11.255  -3.557 1.00 . A A . 47 ASP HB3  1 1 
        7  7101 1 1 47 ASP N    N -10.810  10.712  -1.156 1.00 . A A . 47 ASP N    1 1 
        7  7102 1 1 47 ASP O    O -13.590   8.442  -1.354 1.00 . A A . 47 ASP O    1 1 
        7  7103 1 1 47 ASP OD1  O  -9.968  11.362  -3.679 1.00 . A A . 47 ASP OD1  1 1 
        7  7104 1 1 47 ASP OD2  O -10.280   9.310  -4.403 1.00 . A A . 47 ASP OD2  1 1 
        7  7105 1 1 48 GLY C    C -11.110   5.770  -1.289 1.00 . A A . 48 GLY C    1 1 
        7  7106 1 1 48 GLY CA   C -11.660   6.789  -0.312 1.00 . A A . 48 GLY CA   1 1 
        7  7107 1 1 48 GLY H    H -10.550   8.541  -0.707 1.00 . A A . 48 GLY H    1 1 
        7  7108 1 1 48 GLY HA2  H -11.180   6.654   0.646 1.00 . A A . 48 GLY HA2  1 1 
        7  7109 1 1 48 GLY HA3  H -12.720   6.625  -0.197 1.00 . A A . 48 GLY HA3  1 1 
        7  7110 1 1 48 GLY N    N -11.440   8.150  -0.760 1.00 . A A . 48 GLY N    1 1 
        7  7111 1 1 48 GLY O    O -11.470   4.594  -1.237 1.00 . A A . 48 GLY O    1 1 
        7  7112 1 1 49 SER C    C  -8.182   5.054  -2.830 1.00 . A A . 49 SER C    1 1 
        7  7113 1 1 49 SER CA   C  -9.637   5.342  -3.175 1.00 . A A . 49 SER CA   1 1 
        7  7114 1 1 49 SER CB   C  -9.734   5.962  -4.566 1.00 . A A . 49 SER CB   1 1 
        7  7115 1 1 49 SER H    H  -9.990   7.170  -2.176 1.00 . A A . 49 SER H    1 1 
        7  7116 1 1 49 SER HA   H -10.180   4.415  -3.171 1.00 . A A . 49 SER HA   1 1 
        7  7117 1 1 49 SER HB2  H -10.180   6.933  -4.488 1.00 . A A . 49 SER HB2  1 1 
        7  7118 1 1 49 SER HB3  H  -8.745   6.057  -4.984 1.00 . A A . 49 SER HB3  1 1 
        7  7119 1 1 49 SER HG   H -10.070   4.323  -5.587 1.00 . A A . 49 SER HG   1 1 
        7  7120 1 1 49 SER N    N -10.230   6.222  -2.184 1.00 . A A . 49 SER N    1 1 
        7  7121 1 1 49 SER O    O  -7.360   5.965  -2.738 1.00 . A A . 49 SER O    1 1 
        7  7122 1 1 49 SER OG   O -10.520   5.157  -5.430 1.00 . A A . 49 SER OG   1 1 
        7  7123 1 1 50 VAL C    C  -5.874   2.610  -3.456 1.00 . A A . 50 VAL C    1 1 
        7  7124 1 1 50 VAL CA   C  -6.519   3.360  -2.297 1.00 . A A . 50 VAL CA   1 1 
        7  7125 1 1 50 VAL CB   C  -6.506   2.462  -1.044 1.00 . A A . 50 VAL CB   1 1 
        7  7126 1 1 50 VAL CG1  C  -5.120   2.437  -0.425 1.00 . A A . 50 VAL CG1  1 1 
        7  7127 1 1 50 VAL CG2  C  -7.539   2.934  -0.031 1.00 . A A . 50 VAL CG2  1 1 
        7  7128 1 1 50 VAL H    H  -8.574   3.101  -2.724 1.00 . A A . 50 VAL H    1 1 
        7  7129 1 1 50 VAL HA   H  -5.936   4.244  -2.084 1.00 . A A . 50 VAL HA   1 1 
        7  7130 1 1 50 VAL HB   H  -6.760   1.456  -1.345 1.00 . A A . 50 VAL HB   1 1 
        7  7131 1 1 50 VAL HG11 H  -5.207   2.433   0.651 1.00 . A A . 50 VAL HG11 1 1 
        7  7132 1 1 50 VAL HG12 H  -4.571   3.315  -0.736 1.00 . A A . 50 VAL HG12 1 1 
        7  7133 1 1 50 VAL HG13 H  -4.597   1.550  -0.748 1.00 . A A . 50 VAL HG13 1 1 
        7  7134 1 1 50 VAL HG21 H  -7.255   3.905   0.347 1.00 . A A . 50 VAL HG21 1 1 
        7  7135 1 1 50 VAL HG22 H  -7.590   2.230   0.787 1.00 . A A . 50 VAL HG22 1 1 
        7  7136 1 1 50 VAL HG23 H  -8.505   3.002  -0.507 1.00 . A A . 50 VAL HG23 1 1 
        7  7137 1 1 50 VAL N    N  -7.872   3.779  -2.637 1.00 . A A . 50 VAL N    1 1 
        7  7138 1 1 50 VAL O    O  -6.299   1.512  -3.808 1.00 . A A . 50 VAL O    1 1 
        7  7139 1 1 51 TYR C    C  -2.703   2.263  -4.793 1.00 . A A . 51 TYR C    1 1 
        7  7140 1 1 51 TYR CA   C  -4.143   2.593  -5.169 1.00 . A A . 51 TYR CA   1 1 
        7  7141 1 1 51 TYR CB   C  -4.173   3.511  -6.393 1.00 . A A . 51 TYR CB   1 1 
        7  7142 1 1 51 TYR CD1  C  -2.024   4.822  -6.166 1.00 . A A . 51 TYR CD1  1 1 
        7  7143 1 1 51 TYR CD2  C  -4.085   6.016  -6.082 1.00 . A A . 51 TYR CD2  1 1 
        7  7144 1 1 51 TYR CE1  C  -1.326   6.003  -6.001 1.00 . A A . 51 TYR CE1  1 1 
        7  7145 1 1 51 TYR CE2  C  -3.395   7.202  -5.917 1.00 . A A . 51 TYR CE2  1 1 
        7  7146 1 1 51 TYR CG   C  -3.413   4.807  -6.209 1.00 . A A . 51 TYR CG   1 1 
        7  7147 1 1 51 TYR CZ   C  -2.016   7.190  -5.877 1.00 . A A . 51 TYR CZ   1 1 
        7  7148 1 1 51 TYR H    H  -4.550   4.088  -3.723 1.00 . A A . 51 TYR H    1 1 
        7  7149 1 1 51 TYR HA   H  -4.656   1.673  -5.411 1.00 . A A . 51 TYR HA   1 1 
        7  7150 1 1 51 TYR HB2  H  -3.738   2.992  -7.233 1.00 . A A . 51 TYR HB2  1 1 
        7  7151 1 1 51 TYR HB3  H  -5.199   3.760  -6.622 1.00 . A A . 51 TYR HB3  1 1 
        7  7152 1 1 51 TYR HD1  H  -1.486   3.889  -6.263 1.00 . A A . 51 TYR HD1  1 1 
        7  7153 1 1 51 TYR HD2  H  -5.164   6.022  -6.112 1.00 . A A . 51 TYR HD2  1 1 
        7  7154 1 1 51 TYR HE1  H  -0.248   5.992  -5.970 1.00 . A A . 51 TYR HE1  1 1 
        7  7155 1 1 51 TYR HE2  H  -3.936   8.132  -5.820 1.00 . A A . 51 TYR HE2  1 1 
        7  7156 1 1 51 TYR HH   H  -1.785   8.924  -5.079 1.00 . A A . 51 TYR HH   1 1 
        7  7157 1 1 51 TYR N    N  -4.844   3.212  -4.048 1.00 . A A . 51 TYR N    1 1 
        7  7158 1 1 51 TYR O    O  -2.055   3.013  -4.062 1.00 . A A . 51 TYR O    1 1 
        7  7159 1 1 51 TYR OH   O  -1.326   8.368  -5.713 1.00 . A A . 51 TYR OH   1 1 
        7  7160 1 1 52 ALA C    C   0.100   1.034  -6.148 1.00 . A A . 52 ALA C    1 1 
        7  7161 1 1 52 ALA CA   C  -0.850   0.699  -5.003 1.00 . A A . 52 ALA CA   1 1 
        7  7162 1 1 52 ALA CB   C  -0.826  -0.796  -4.716 1.00 . A A . 52 ALA CB   1 1 
        7  7163 1 1 52 ALA H    H  -2.778   0.576  -5.864 1.00 . A A . 52 ALA H    1 1 
        7  7164 1 1 52 ALA HA   H  -0.518   1.214  -4.115 1.00 . A A . 52 ALA HA   1 1 
        7  7165 1 1 52 ALA HB1  H   0.022  -1.246  -5.211 1.00 . A A . 52 ALA HB1  1 1 
        7  7166 1 1 52 ALA HB2  H  -1.737  -1.246  -5.083 1.00 . A A . 52 ALA HB2  1 1 
        7  7167 1 1 52 ALA HB3  H  -0.749  -0.957  -3.650 1.00 . A A . 52 ALA HB3  1 1 
        7  7168 1 1 52 ALA N    N  -2.210   1.133  -5.292 1.00 . A A . 52 ALA N    1 1 
        7  7169 1 1 52 ALA O    O  -0.107   0.608  -7.284 1.00 . A A . 52 ALA O    1 1 
        7  7170 1 1 53 GLU C    C   3.367   1.295  -6.752 1.00 . A A . 53 GLU C    1 1 
        7  7171 1 1 53 GLU CA   C   2.132   2.186  -6.837 1.00 . A A . 53 GLU CA   1 1 
        7  7172 1 1 53 GLU CB   C   2.527   3.652  -6.648 1.00 . A A . 53 GLU CB   1 1 
        7  7173 1 1 53 GLU CD   C   2.783   5.359  -8.493 1.00 . A A . 53 GLU CD   1 1 
        7  7174 1 1 53 GLU CG   C   1.820   4.596  -7.605 1.00 . A A . 53 GLU CG   1 1 
        7  7175 1 1 53 GLU H    H   1.255   2.102  -4.913 1.00 . A A . 53 GLU H    1 1 
        7  7176 1 1 53 GLU HA   H   1.682   2.065  -7.812 1.00 . A A . 53 GLU HA   1 1 
        7  7177 1 1 53 GLU HB2  H   2.285   3.950  -5.639 1.00 . A A . 53 GLU HB2  1 1 
        7  7178 1 1 53 GLU HB3  H   3.592   3.751  -6.799 1.00 . A A . 53 GLU HB3  1 1 
        7  7179 1 1 53 GLU HG2  H   1.157   4.019  -8.234 1.00 . A A . 53 GLU HG2  1 1 
        7  7180 1 1 53 GLU HG3  H   1.244   5.305  -7.031 1.00 . A A . 53 GLU HG3  1 1 
        7  7181 1 1 53 GLU N    N   1.145   1.796  -5.838 1.00 . A A . 53 GLU N    1 1 
        7  7182 1 1 53 GLU O    O   3.517   0.512  -5.814 1.00 . A A . 53 GLU O    1 1 
        7  7183 1 1 53 GLU OE1  O   3.941   5.569  -8.072 1.00 . A A . 53 GLU OE1  1 1 
        7  7184 1 1 53 GLU OE2  O   2.381   5.748  -9.610 1.00 . A A . 53 GLU OE2  1 1 
        7  7185 1 1 54 GLU C    C   6.690   1.486  -7.464 1.00 . A A . 54 GLU C    1 1 
        7  7186 1 1 54 GLU CA   C   5.471   0.626  -7.776 1.00 . A A . 54 GLU CA   1 1 
        7  7187 1 1 54 GLU CB   C   5.633  -0.032  -9.148 1.00 . A A . 54 GLU CB   1 1 
        7  7188 1 1 54 GLU CD   C   7.218  -1.730 -10.142 1.00 . A A . 54 GLU CD   1 1 
        7  7189 1 1 54 GLU CG   C   6.171  -1.452  -9.082 1.00 . A A . 54 GLU CG   1 1 
        7  7190 1 1 54 GLU H    H   4.075   2.061  -8.457 1.00 . A A . 54 GLU H    1 1 
        7  7191 1 1 54 GLU HA   H   5.388  -0.145  -7.026 1.00 . A A . 54 GLU HA   1 1 
        7  7192 1 1 54 GLU HB2  H   4.671  -0.058  -9.638 1.00 . A A . 54 GLU HB2  1 1 
        7  7193 1 1 54 GLU HB3  H   6.313   0.560  -9.741 1.00 . A A . 54 GLU HB3  1 1 
        7  7194 1 1 54 GLU HG2  H   6.614  -1.611  -8.109 1.00 . A A . 54 GLU HG2  1 1 
        7  7195 1 1 54 GLU HG3  H   5.350  -2.141  -9.218 1.00 . A A . 54 GLU HG3  1 1 
        7  7196 1 1 54 GLU N    N   4.249   1.420  -7.738 1.00 . A A . 54 GLU N    1 1 
        7  7197 1 1 54 GLU O    O   6.711   2.683  -7.756 1.00 . A A . 54 GLU O    1 1 
        7  7198 1 1 54 GLU OE1  O   6.915  -1.545 -11.339 1.00 . A A . 54 GLU OE1  1 1 
        7  7199 1 1 54 GLU OE2  O   8.342  -2.133  -9.776 1.00 . A A . 54 GLU OE2  1 1 
        7  7200 1 1 55 VAL C    C  10.154   0.867  -7.096 1.00 . A A . 55 VAL C    1 1 
        7  7201 1 1 55 VAL CA   C   8.930   1.570  -6.515 1.00 . A A . 55 VAL CA   1 1 
        7  7202 1 1 55 VAL CB   C   9.093   1.681  -4.987 1.00 . A A . 55 VAL CB   1 1 
        7  7203 1 1 55 VAL CG1  C  10.240   2.617  -4.636 1.00 . A A . 55 VAL CG1  1 1 
        7  7204 1 1 55 VAL CG2  C   7.797   2.150  -4.344 1.00 . A A . 55 VAL CG2  1 1 
        7  7205 1 1 55 VAL H    H   7.624  -0.086  -6.665 1.00 . A A . 55 VAL H    1 1 
        7  7206 1 1 55 VAL HA   H   8.874   2.570  -6.924 1.00 . A A . 55 VAL HA   1 1 
        7  7207 1 1 55 VAL HB   H   9.329   0.701  -4.599 1.00 . A A . 55 VAL HB   1 1 
        7  7208 1 1 55 VAL HG11 H  10.158   3.522  -5.220 1.00 . A A . 55 VAL HG11 1 1 
        7  7209 1 1 55 VAL HG12 H  11.180   2.132  -4.853 1.00 . A A . 55 VAL HG12 1 1 
        7  7210 1 1 55 VAL HG13 H  10.196   2.862  -3.585 1.00 . A A . 55 VAL HG13 1 1 
        7  7211 1 1 55 VAL HG21 H   7.465   3.058  -4.824 1.00 . A A . 55 VAL HG21 1 1 
        7  7212 1 1 55 VAL HG22 H   7.964   2.339  -3.293 1.00 . A A . 55 VAL HG22 1 1 
        7  7213 1 1 55 VAL HG23 H   7.042   1.386  -4.455 1.00 . A A . 55 VAL HG23 1 1 
        7  7214 1 1 55 VAL N    N   7.704   0.868  -6.870 1.00 . A A . 55 VAL N    1 1 
        7  7215 1 1 55 VAL O    O  10.093  -0.309  -7.454 1.00 . A A . 55 VAL O    1 1 
        7  7216 1 1 56 LYS C    C  13.224   0.199  -6.679 1.00 . A A . 56 LYS C    1 1 
        7  7217 1 1 56 LYS CA   C  12.499   1.038  -7.729 1.00 . A A . 56 LYS CA   1 1 
        7  7218 1 1 56 LYS CB   C  13.414   2.160  -8.223 1.00 . A A . 56 LYS CB   1 1 
        7  7219 1 1 56 LYS CD   C  11.899   3.662  -9.551 1.00 . A A . 56 LYS CD   1 1 
        7  7220 1 1 56 LYS CE   C  11.261   3.855 -10.917 1.00 . A A . 56 LYS CE   1 1 
        7  7221 1 1 56 LYS CG   C  13.053   2.676  -9.608 1.00 . A A . 56 LYS CG   1 1 
        7  7222 1 1 56 LYS H    H  11.249   2.527  -6.891 1.00 . A A . 56 LYS H    1 1 
        7  7223 1 1 56 LYS HA   H  12.241   0.403  -8.563 1.00 . A A . 56 LYS HA   1 1 
        7  7224 1 1 56 LYS HB2  H  13.358   2.985  -7.529 1.00 . A A . 56 LYS HB2  1 1 
        7  7225 1 1 56 LYS HB3  H  14.429   1.793  -8.252 1.00 . A A . 56 LYS HB3  1 1 
        7  7226 1 1 56 LYS HD2  H  11.154   3.290  -8.865 1.00 . A A . 56 LYS HD2  1 1 
        7  7227 1 1 56 LYS HD3  H  12.270   4.614  -9.198 1.00 . A A . 56 LYS HD3  1 1 
        7  7228 1 1 56 LYS HE2  H  11.028   2.884 -11.330 1.00 . A A . 56 LYS HE2  1 1 
        7  7229 1 1 56 LYS HE3  H  10.349   4.421 -10.798 1.00 . A A . 56 LYS HE3  1 1 
        7  7230 1 1 56 LYS HG2  H  13.915   3.168 -10.033 1.00 . A A . 56 LYS HG2  1 1 
        7  7231 1 1 56 LYS HG3  H  12.770   1.839 -10.230 1.00 . A A . 56 LYS HG3  1 1 
        7  7232 1 1 56 LYS HZ1  H  13.154   4.345 -11.649 1.00 . A A . 56 LYS HZ1  1 1 
        7  7233 1 1 56 LYS HZ2  H  12.031   5.603 -11.758 1.00 . A A . 56 LYS HZ2  1 1 
        7  7234 1 1 56 LYS HZ3  H  11.949   4.305 -12.837 1.00 . A A . 56 LYS HZ3  1 1 
        7  7235 1 1 56 LYS N    N  11.263   1.594  -7.190 1.00 . A A . 56 LYS N    1 1 
        7  7236 1 1 56 LYS NZ   N  12.162   4.578 -11.855 1.00 . A A . 56 LYS NZ   1 1 
        7  7237 1 1 56 LYS O    O  12.985   0.349  -5.480 1.00 . A A . 56 LYS O    1 1 
        7  7238 1 1 57 PRO C    C  15.495  -0.792  -5.044 1.00 . A A . 57 PRO C    1 1 
        7  7239 1 1 57 PRO CA   C  14.887  -1.562  -6.213 1.00 . A A . 57 PRO CA   1 1 
        7  7240 1 1 57 PRO CB   C  15.989  -2.122  -7.112 1.00 . A A . 57 PRO CB   1 1 
        7  7241 1 1 57 PRO CD   C  14.468  -0.937  -8.533 1.00 . A A . 57 PRO CD   1 1 
        7  7242 1 1 57 PRO CG   C  15.395  -2.122  -8.478 1.00 . A A . 57 PRO CG   1 1 
        7  7243 1 1 57 PRO HA   H  14.281  -2.371  -5.833 1.00 . A A . 57 PRO HA   1 1 
        7  7244 1 1 57 PRO HB2  H  16.861  -1.487  -7.058 1.00 . A A . 57 PRO HB2  1 1 
        7  7245 1 1 57 PRO HB3  H  16.244  -3.123  -6.793 1.00 . A A . 57 PRO HB3  1 1 
        7  7246 1 1 57 PRO HD2  H  14.976  -0.081  -8.956 1.00 . A A . 57 PRO HD2  1 1 
        7  7247 1 1 57 PRO HD3  H  13.586  -1.176  -9.108 1.00 . A A . 57 PRO HD3  1 1 
        7  7248 1 1 57 PRO HG2  H  16.177  -2.020  -9.216 1.00 . A A . 57 PRO HG2  1 1 
        7  7249 1 1 57 PRO HG3  H  14.843  -3.036  -8.639 1.00 . A A . 57 PRO HG3  1 1 
        7  7250 1 1 57 PRO N    N  14.125  -0.697  -7.117 1.00 . A A . 57 PRO N    1 1 
        7  7251 1 1 57 PRO O    O  16.026   0.304  -5.218 1.00 . A A . 57 PRO O    1 1 
        7  7252 1 1 58 ASP C    C  17.458  -0.591  -2.746 1.00 . A A . 58 ASP C    1 1 
        7  7253 1 1 58 ASP CA   C  15.942  -0.754  -2.654 1.00 . A A . 58 ASP CA   1 1 
        7  7254 1 1 58 ASP CB   C  15.578  -1.598  -1.436 1.00 . A A . 58 ASP CB   1 1 
        7  7255 1 1 58 ASP CG   C  15.857  -3.075  -1.645 1.00 . A A . 58 ASP CG   1 1 
        7  7256 1 1 58 ASP H    H  14.974  -2.246  -3.773 1.00 . A A . 58 ASP H    1 1 
        7  7257 1 1 58 ASP HA   H  15.490   0.222  -2.554 1.00 . A A . 58 ASP HA   1 1 
        7  7258 1 1 58 ASP HB2  H  16.158  -1.263  -0.597 1.00 . A A . 58 ASP HB2  1 1 
        7  7259 1 1 58 ASP HB3  H  14.525  -1.476  -1.220 1.00 . A A . 58 ASP HB3  1 1 
        7  7260 1 1 58 ASP N    N  15.408  -1.373  -3.852 1.00 . A A . 58 ASP N    1 1 
        7  7261 1 1 58 ASP O    O  18.123  -1.317  -3.485 1.00 . A A . 58 ASP O    1 1 
        7  7262 1 1 58 ASP OD1  O  15.141  -3.706  -2.450 1.00 . A A . 58 ASP OD1  1 1 
        7  7263 1 1 58 ASP OD2  O  16.793  -3.599  -1.005 1.00 . A A . 58 ASP OD2  1 1 
        7  7264 1 1 59 PRO C    C  20.248  -0.466  -1.263 1.00 . A A . 59 PRO C    1 1 
        7  7265 1 1 59 PRO CA   C  19.466   0.624  -1.991 1.00 . A A . 59 PRO CA   1 1 
        7  7266 1 1 59 PRO CB   C  19.586   1.955  -1.251 1.00 . A A . 59 PRO CB   1 1 
        7  7267 1 1 59 PRO CD   C  17.299   1.277  -1.082 1.00 . A A . 59 PRO CD   1 1 
        7  7268 1 1 59 PRO CG   C  18.401   1.992  -0.349 1.00 . A A . 59 PRO CG   1 1 
        7  7269 1 1 59 PRO HA   H  19.850   0.730  -2.995 1.00 . A A . 59 PRO HA   1 1 
        7  7270 1 1 59 PRO HB2  H  20.511   1.979  -0.692 1.00 . A A . 59 PRO HB2  1 1 
        7  7271 1 1 59 PRO HB3  H  19.566   2.770  -1.960 1.00 . A A . 59 PRO HB3  1 1 
        7  7272 1 1 59 PRO HD2  H  16.684   0.720  -0.391 1.00 . A A . 59 PRO HD2  1 1 
        7  7273 1 1 59 PRO HD3  H  16.699   1.981  -1.639 1.00 . A A . 59 PRO HD3  1 1 
        7  7274 1 1 59 PRO HG2  H  18.629   1.482   0.576 1.00 . A A . 59 PRO HG2  1 1 
        7  7275 1 1 59 PRO HG3  H  18.119   3.015  -0.153 1.00 . A A . 59 PRO HG3  1 1 
        7  7276 1 1 59 PRO N    N  18.023   0.368  -1.993 1.00 . A A . 59 PRO N    1 1 
        7  7277 1 1 59 PRO O    O  20.915  -0.203  -0.262 1.00 . A A . 59 PRO O    1 1 
        7  7278 1 1 60 SER C    C  21.113  -3.915  -2.200 1.00 . A A . 60 SER C    1 1 
        7  7279 1 1 60 SER CA   C  20.859  -2.820  -1.169 1.00 . A A . 60 SER CA   1 1 
        7  7280 1 1 60 SER CB   C  20.050  -3.382   0.001 1.00 . A A . 60 SER CB   1 1 
        7  7281 1 1 60 SER H    H  19.612  -1.838  -2.572 1.00 . A A . 60 SER H    1 1 
        7  7282 1 1 60 SER HA   H  21.809  -2.462  -0.801 1.00 . A A . 60 SER HA   1 1 
        7  7283 1 1 60 SER HB2  H  19.257  -4.007  -0.380 1.00 . A A . 60 SER HB2  1 1 
        7  7284 1 1 60 SER HB3  H  20.700  -3.969   0.634 1.00 . A A . 60 SER HB3  1 1 
        7  7285 1 1 60 SER HG   H  20.173  -1.753   1.084 1.00 . A A . 60 SER HG   1 1 
        7  7286 1 1 60 SER N    N  20.160  -1.691  -1.773 1.00 . A A . 60 SER N    1 1 
        7  7287 1 1 60 SER O    O  22.259  -4.194  -2.554 1.00 . A A . 60 SER O    1 1 
        7  7288 1 1 60 SER OG   O  19.480  -2.341   0.774 1.00 . A A . 60 SER OG   1 1 
        7  7289 1 1 61 ASN C    C  19.228  -5.329  -4.858 1.00 . A A . 61 ASN C    1 1 
        7  7290 1 1 61 ASN CA   C  20.143  -5.598  -3.668 1.00 . A A . 61 ASN CA   1 1 
        7  7291 1 1 61 ASN CB   C  19.797  -6.947  -3.036 1.00 . A A . 61 ASN CB   1 1 
        7  7292 1 1 61 ASN CG   C  20.744  -8.050  -3.471 1.00 . A A . 61 ASN CG   1 1 
        7  7293 1 1 61 ASN H    H  19.151  -4.265  -2.357 1.00 . A A . 61 ASN H    1 1 
        7  7294 1 1 61 ASN HA   H  21.165  -5.625  -4.015 1.00 . A A . 61 ASN HA   1 1 
        7  7295 1 1 61 ASN HB2  H  19.850  -6.859  -1.961 1.00 . A A . 61 ASN HB2  1 1 
        7  7296 1 1 61 ASN HB3  H  18.794  -7.226  -3.322 1.00 . A A . 61 ASN HB3  1 1 
        7  7297 1 1 61 ASN HD21 H  21.123  -8.504  -1.570 1.00 . A A . 61 ASN HD21 1 1 
        7  7298 1 1 61 ASN HD22 H  21.952  -9.463  -2.758 1.00 . A A . 61 ASN HD22 1 1 
        7  7299 1 1 61 ASN N    N  20.037  -4.533  -2.677 1.00 . A A . 61 ASN N    1 1 
        7  7300 1 1 61 ASN ND2  N  21.333  -8.741  -2.502 1.00 . A A . 61 ASN ND2  1 1 
        7  7301 1 1 61 ASN O    O  18.074  -4.933  -4.690 1.00 . A A . 61 ASN O    1 1 
        7  7302 1 1 61 ASN OD1  O  20.946  -8.274  -4.665 1.00 . A A . 61 ASN OD1  1 1 
        7  7303 1 1 62 LYS C    C  18.176  -6.570  -7.646 1.00 . A A . 62 LYS C    1 1 
        7  7304 1 1 62 LYS CA   C  18.980  -5.326  -7.280 1.00 . A A . 62 LYS CA   1 1 
        7  7305 1 1 62 LYS CB   C  19.909  -4.946  -8.433 1.00 . A A . 62 LYS CB   1 1 
        7  7306 1 1 62 LYS CD   C  21.515  -3.084  -8.960 1.00 . A A . 62 LYS CD   1 1 
        7  7307 1 1 62 LYS CE   C  21.648  -1.612  -9.312 1.00 . A A . 62 LYS CE   1 1 
        7  7308 1 1 62 LYS CG   C  20.082  -3.445  -8.605 1.00 . A A . 62 LYS CG   1 1 
        7  7309 1 1 62 LYS H    H  20.676  -5.862  -6.131 1.00 . A A . 62 LYS H    1 1 
        7  7310 1 1 62 LYS HA   H  18.295  -4.512  -7.097 1.00 . A A . 62 LYS HA   1 1 
        7  7311 1 1 62 LYS HB2  H  20.881  -5.381  -8.256 1.00 . A A . 62 LYS HB2  1 1 
        7  7312 1 1 62 LYS HB3  H  19.508  -5.347  -9.352 1.00 . A A . 62 LYS HB3  1 1 
        7  7313 1 1 62 LYS HD2  H  22.149  -3.299  -8.114 1.00 . A A . 62 LYS HD2  1 1 
        7  7314 1 1 62 LYS HD3  H  21.826  -3.678  -9.806 1.00 . A A . 62 LYS HD3  1 1 
        7  7315 1 1 62 LYS HE2  H  21.066  -1.412 -10.200 1.00 . A A . 62 LYS HE2  1 1 
        7  7316 1 1 62 LYS HE3  H  21.264  -1.022  -8.492 1.00 . A A . 62 LYS HE3  1 1 
        7  7317 1 1 62 LYS HG2  H  19.429  -3.106  -9.396 1.00 . A A . 62 LYS HG2  1 1 
        7  7318 1 1 62 LYS HG3  H  19.814  -2.954  -7.681 1.00 . A A . 62 LYS HG3  1 1 
        7  7319 1 1 62 LYS HZ1  H  23.395  -1.651 -10.455 1.00 . A A . 62 LYS HZ1  1 1 
        7  7320 1 1 62 LYS HZ2  H  23.670  -1.558  -8.789 1.00 . A A . 62 LYS HZ2  1 1 
        7  7321 1 1 62 LYS HZ3  H  23.146  -0.191  -9.637 1.00 . A A . 62 LYS HZ3  1 1 
        7  7322 1 1 62 LYS N    N  19.749  -5.546  -6.061 1.00 . A A . 62 LYS N    1 1 
        7  7323 1 1 62 LYS NZ   N  23.064  -1.227  -9.566 1.00 . A A . 62 LYS NZ   1 1 
        7  7324 1 1 62 LYS O    O  16.966  -6.498  -7.857 1.00 . A A . 62 LYS O    1 1 
        7  7325 1 1 63 LYS C    C  18.687 -10.094  -7.155 1.00 . A A . 63 LYS C    1 1 
        7  7326 1 1 63 LYS CA   C  18.205  -8.968  -8.064 1.00 . A A . 63 LYS CA   1 1 
        7  7327 1 1 63 LYS CB   C  18.476  -9.324  -9.526 1.00 . A A . 63 LYS CB   1 1 
        7  7328 1 1 63 LYS CD   C  20.181  -8.812 -11.299 1.00 . A A . 63 LYS CD   1 1 
        7  7329 1 1 63 LYS CE   C  20.498  -7.326 -11.309 1.00 . A A . 63 LYS CE   1 1 
        7  7330 1 1 63 LYS CG   C  19.953  -9.326  -9.887 1.00 . A A . 63 LYS CG   1 1 
        7  7331 1 1 63 LYS H    H  19.820  -7.702  -7.543 1.00 . A A . 63 LYS H    1 1 
        7  7332 1 1 63 LYS HA   H  17.143  -8.839  -7.924 1.00 . A A . 63 LYS HA   1 1 
        7  7333 1 1 63 LYS HB2  H  18.078 -10.309  -9.724 1.00 . A A . 63 LYS HB2  1 1 
        7  7334 1 1 63 LYS HB3  H  17.973  -8.608 -10.157 1.00 . A A . 63 LYS HB3  1 1 
        7  7335 1 1 63 LYS HD2  H  21.009  -9.349 -11.738 1.00 . A A . 63 LYS HD2  1 1 
        7  7336 1 1 63 LYS HD3  H  19.289  -8.985 -11.884 1.00 . A A . 63 LYS HD3  1 1 
        7  7337 1 1 63 LYS HE2  H  20.759  -7.020 -10.307 1.00 . A A . 63 LYS HE2  1 1 
        7  7338 1 1 63 LYS HE3  H  21.336  -7.154 -11.967 1.00 . A A . 63 LYS HE3  1 1 
        7  7339 1 1 63 LYS HG2  H  20.484  -8.692  -9.195 1.00 . A A . 63 LYS HG2  1 1 
        7  7340 1 1 63 LYS HG3  H  20.328 -10.337  -9.815 1.00 . A A . 63 LYS HG3  1 1 
        7  7341 1 1 63 LYS HZ1  H  19.379  -6.398 -12.810 1.00 . A A . 63 LYS HZ1  1 1 
        7  7342 1 1 63 LYS HZ2  H  19.361  -5.574 -11.332 1.00 . A A . 63 LYS HZ2  1 1 
        7  7343 1 1 63 LYS HZ3  H  18.448  -6.984 -11.523 1.00 . A A . 63 LYS HZ3  1 1 
        7  7344 1 1 63 LYS N    N  18.856  -7.708  -7.721 1.00 . A A . 63 LYS N    1 1 
        7  7345 1 1 63 LYS NZ   N  19.341  -6.514 -11.776 1.00 . A A . 63 LYS NZ   1 1 
        7  7346 1 1 63 LYS O    O  19.629  -9.921  -6.381 1.00 . A A . 63 LYS O    1 1 
        7  7347 1 1 64 THR C    C  18.193 -13.699  -7.220 1.00 . A A . 64 THR C    1 1 
        7  7348 1 1 64 THR CA   C  18.396 -12.403  -6.442 1.00 . A A . 64 THR CA   1 1 
        7  7349 1 1 64 THR CB   C  17.566 -12.429  -5.158 1.00 . A A . 64 THR CB   1 1 
        7  7350 1 1 64 THR CG2  C  16.081 -12.275  -5.403 1.00 . A A . 64 THR CG2  1 1 
        7  7351 1 1 64 THR H    H  17.293 -11.324  -7.890 1.00 . A A . 64 THR H    1 1 
        7  7352 1 1 64 THR HA   H  19.441 -12.312  -6.183 1.00 . A A . 64 THR HA   1 1 
        7  7353 1 1 64 THR HB   H  17.882 -11.617  -4.520 1.00 . A A . 64 THR HB   1 1 
        7  7354 1 1 64 THR HG1  H  18.598 -13.613  -3.987 1.00 . A A . 64 THR HG1  1 1 
        7  7355 1 1 64 THR HG21 H  15.689 -13.187  -5.830 1.00 . A A . 64 THR HG21 1 1 
        7  7356 1 1 64 THR HG22 H  15.912 -11.457  -6.086 1.00 . A A . 64 THR HG22 1 1 
        7  7357 1 1 64 THR HG23 H  15.581 -12.072  -4.467 1.00 . A A . 64 THR HG23 1 1 
        7  7358 1 1 64 THR N    N  18.035 -11.247  -7.254 1.00 . A A . 64 THR N    1 1 
        7  7359 1 1 64 THR O    O  17.108 -14.279  -7.206 1.00 . A A . 64 THR O    1 1 
        7  7360 1 1 64 THR OG1  O  17.762 -13.645  -4.459 1.00 . A A . 64 THR OG1  1 1 
        7  7361 1 1 65 THR C    C  19.863 -16.525  -7.948 1.00 . A A . 65 THR C    1 1 
        7  7362 1 1 65 THR CA   C  19.181 -15.375  -8.682 1.00 . A A . 65 THR CA   1 1 
        7  7363 1 1 65 THR CB   C  19.838 -15.167 -10.049 1.00 . A A . 65 THR CB   1 1 
        7  7364 1 1 65 THR CG2  C  19.445 -16.213 -11.066 1.00 . A A . 65 THR CG2  1 1 
        7  7365 1 1 65 THR H    H  20.083 -13.641  -7.870 1.00 . A A . 65 THR H    1 1 
        7  7366 1 1 65 THR HA   H  18.140 -15.622  -8.827 1.00 . A A . 65 THR HA   1 1 
        7  7367 1 1 65 THR HB   H  20.912 -15.208  -9.929 1.00 . A A . 65 THR HB   1 1 
        7  7368 1 1 65 THR HG1  H  18.546 -13.780 -10.539 1.00 . A A . 65 THR HG1  1 1 
        7  7369 1 1 65 THR HG21 H  19.105 -15.728 -11.970 1.00 . A A . 65 THR HG21 1 1 
        7  7370 1 1 65 THR HG22 H  18.649 -16.825 -10.666 1.00 . A A . 65 THR HG22 1 1 
        7  7371 1 1 65 THR HG23 H  20.299 -16.836 -11.292 1.00 . A A . 65 THR HG23 1 1 
        7  7372 1 1 65 THR N    N  19.245 -14.147  -7.897 1.00 . A A . 65 THR N    1 1 
        7  7373 1 1 65 THR O    O  20.823 -16.319  -7.205 1.00 . A A . 65 THR O    1 1 
        7  7374 1 1 65 THR OG1  O  19.498 -13.898 -10.579 1.00 . A A . 65 THR OG1  1 1 
        7  7375 1 1 66 ALA C    C  20.030 -20.078  -8.504 1.00 . A A . 66 ALA C    1 1 
        7  7376 1 1 66 ALA CA   C  19.920 -18.919  -7.519 1.00 . A A . 66 ALA CA   1 1 
        7  7377 1 1 66 ALA CB   C  19.072 -19.320  -6.322 1.00 . A A . 66 ALA CB   1 1 
        7  7378 1 1 66 ALA H    H  18.593 -17.837  -8.765 1.00 . A A . 66 ALA H    1 1 
        7  7379 1 1 66 ALA HA   H  20.909 -18.669  -7.163 1.00 . A A . 66 ALA HA   1 1 
        7  7380 1 1 66 ALA HB1  H  18.088 -19.613  -6.659 1.00 . A A . 66 ALA HB1  1 1 
        7  7381 1 1 66 ALA HB2  H  18.987 -18.483  -5.645 1.00 . A A . 66 ALA HB2  1 1 
        7  7382 1 1 66 ALA HB3  H  19.539 -20.150  -5.813 1.00 . A A . 66 ALA HB3  1 1 
        7  7383 1 1 66 ALA N    N  19.361 -17.737  -8.162 1.00 . A A . 66 ALA N    1 1 
        7  7384 1 1 66 ALA O    O  19.313 -20.056  -9.527 1.00 . A A . 66 ALA O    1 1 
        7  7385 1 1 66 ALA OXT  O  20.835 -20.999  -8.246 1.00 . A A . 66 ALA OXT  1 1 
        8  7386 1 1  1 MET C    C   1.940  14.028   0.967 1.00 . A A .  1 MET C    1 1 
        8  7387 1 1  1 MET CA   C   3.015  15.012   1.416 1.00 . A A .  1 MET CA   1 1 
        8  7388 1 1  1 MET CB   C   3.245  16.071   0.336 1.00 . A A .  1 MET CB   1 1 
        8  7389 1 1  1 MET CE   C   6.387  16.730   0.105 1.00 . A A .  1 MET CE   1 1 
        8  7390 1 1  1 MET CG   C   3.805  17.378   0.874 1.00 . A A .  1 MET CG   1 1 
        8  7391 1 1  1 MET H1   H   4.747  14.115   0.765 1.00 . A A .  1 MET H1   1 1 
        8  7392 1 1  1 MET H2   H   4.089  13.441   2.199 1.00 . A A .  1 MET H2   1 1 
        8  7393 1 1  1 MET H3   H   4.895  14.956   2.252 1.00 . A A .  1 MET H3   1 1 
        8  7394 1 1  1 MET HA   H   2.691  15.496   2.325 1.00 . A A .  1 MET HA   1 1 
        8  7395 1 1  1 MET HB2  H   3.940  15.678  -0.392 1.00 . A A .  1 MET HB2  1 1 
        8  7396 1 1  1 MET HB3  H   2.305  16.280  -0.153 1.00 . A A .  1 MET HB3  1 1 
        8  7397 1 1  1 MET HE1  H   6.422  16.446   1.146 1.00 . A A .  1 MET HE1  1 1 
        8  7398 1 1  1 MET HE2  H   7.355  17.096  -0.201 1.00 . A A .  1 MET HE2  1 1 
        8  7399 1 1  1 MET HE3  H   6.120  15.872  -0.494 1.00 . A A .  1 MET HE3  1 1 
        8  7400 1 1  1 MET HG2  H   3.012  18.112   0.891 1.00 . A A .  1 MET HG2  1 1 
        8  7401 1 1  1 MET HG3  H   4.161  17.214   1.880 1.00 . A A .  1 MET HG3  1 1 
        8  7402 1 1  1 MET N    N   4.302  14.319   1.681 1.00 . A A .  1 MET N    1 1 
        8  7403 1 1  1 MET O    O   0.780  14.137   1.365 1.00 . A A .  1 MET O    1 1 
        8  7404 1 1  1 MET SD   S   5.164  18.019  -0.123 1.00 . A A .  1 MET SD   1 1 
        8  7405 1 1  2 GLU C    C   1.039  11.062   0.727 1.00 . A A .  2 GLU C    1 1 
        8  7406 1 1  2 GLU CA   C   1.403  12.063  -0.365 1.00 . A A .  2 GLU CA   1 1 
        8  7407 1 1  2 GLU CB   C   2.010  11.326  -1.562 1.00 . A A .  2 GLU CB   1 1 
        8  7408 1 1  2 GLU CD   C   2.129  12.216  -3.925 1.00 . A A .  2 GLU CD   1 1 
        8  7409 1 1  2 GLU CG   C   2.739  12.236  -2.536 1.00 . A A .  2 GLU CG   1 1 
        8  7410 1 1  2 GLU H    H   3.272  13.032  -0.141 1.00 . A A .  2 GLU H    1 1 
        8  7411 1 1  2 GLU HA   H   0.507  12.573  -0.683 1.00 . A A .  2 GLU HA   1 1 
        8  7412 1 1  2 GLU HB2  H   2.710  10.589  -1.198 1.00 . A A .  2 GLU HB2  1 1 
        8  7413 1 1  2 GLU HB3  H   1.217  10.822  -2.097 1.00 . A A .  2 GLU HB3  1 1 
        8  7414 1 1  2 GLU HG2  H   2.704  13.248  -2.161 1.00 . A A .  2 GLU HG2  1 1 
        8  7415 1 1  2 GLU HG3  H   3.768  11.915  -2.606 1.00 . A A .  2 GLU HG3  1 1 
        8  7416 1 1  2 GLU N    N   2.334  13.067   0.138 1.00 . A A .  2 GLU N    1 1 
        8  7417 1 1  2 GLU O    O   1.360  11.260   1.898 1.00 . A A .  2 GLU O    1 1 
        8  7418 1 1  2 GLU OE1  O   0.910  12.463  -4.041 1.00 . A A .  2 GLU OE1  1 1 
        8  7419 1 1  2 GLU OE2  O   2.871  11.952  -4.895 1.00 . A A .  2 GLU OE2  1 1 
        8  7420 1 1  3 GLN C    C   0.448   7.579   0.809 1.00 . A A .  3 GLN C    1 1 
        8  7421 1 1  3 GLN CA   C  -0.041   8.949   1.271 1.00 . A A .  3 GLN CA   1 1 
        8  7422 1 1  3 GLN CB   C  -1.566   8.947   1.425 1.00 . A A .  3 GLN CB   1 1 
        8  7423 1 1  3 GLN CD   C  -1.874   8.330   3.857 1.00 . A A .  3 GLN CD   1 1 
        8  7424 1 1  3 GLN CG   C  -2.038   9.403   2.796 1.00 . A A .  3 GLN CG   1 1 
        8  7425 1 1  3 GLN H    H   0.143   9.884  -0.617 1.00 . A A .  3 GLN H    1 1 
        8  7426 1 1  3 GLN HA   H   0.408   9.174   2.227 1.00 . A A .  3 GLN HA   1 1 
        8  7427 1 1  3 GLN HB2  H  -1.991   9.608   0.685 1.00 . A A .  3 GLN HB2  1 1 
        8  7428 1 1  3 GLN HB3  H  -1.935   7.948   1.255 1.00 . A A .  3 GLN HB3  1 1 
        8  7429 1 1  3 GLN HE21 H  -0.959   9.628   5.059 1.00 . A A .  3 GLN HE21 1 1 
        8  7430 1 1  3 GLN HE22 H  -1.146   8.019   5.683 1.00 . A A .  3 GLN HE22 1 1 
        8  7431 1 1  3 GLN HG2  H  -1.465  10.268   3.091 1.00 . A A .  3 GLN HG2  1 1 
        8  7432 1 1  3 GLN HG3  H  -3.084   9.669   2.733 1.00 . A A .  3 GLN HG3  1 1 
        8  7433 1 1  3 GLN N    N   0.367   9.986   0.331 1.00 . A A .  3 GLN N    1 1 
        8  7434 1 1  3 GLN NE2  N  -1.266   8.696   4.979 1.00 . A A .  3 GLN NE2  1 1 
        8  7435 1 1  3 GLN O    O  -0.266   6.582   0.924 1.00 . A A .  3 GLN O    1 1 
        8  7436 1 1  3 GLN OE1  O  -2.292   7.187   3.669 1.00 . A A .  3 GLN OE1  1 1 
        8  7437 1 1  4 ARG C    C   2.797   5.466   0.958 1.00 . A A .  4 ARG C    1 1 
        8  7438 1 1  4 ARG CA   C   2.252   6.291  -0.196 1.00 . A A .  4 ARG CA   1 1 
        8  7439 1 1  4 ARG CB   C   3.362   6.573  -1.211 1.00 . A A .  4 ARG CB   1 1 
        8  7440 1 1  4 ARG CD   C   5.698   7.468  -1.439 1.00 . A A .  4 ARG CD   1 1 
        8  7441 1 1  4 ARG CG   C   4.351   7.632  -0.753 1.00 . A A .  4 ARG CG   1 1 
        8  7442 1 1  4 ARG CZ   C   6.552   9.774  -1.598 1.00 . A A .  4 ARG CZ   1 1 
        8  7443 1 1  4 ARG H    H   2.189   8.367   0.220 1.00 . A A .  4 ARG H    1 1 
        8  7444 1 1  4 ARG HA   H   1.470   5.723  -0.678 1.00 . A A .  4 ARG HA   1 1 
        8  7445 1 1  4 ARG HB2  H   3.907   5.659  -1.395 1.00 . A A .  4 ARG HB2  1 1 
        8  7446 1 1  4 ARG HB3  H   2.913   6.906  -2.135 1.00 . A A .  4 ARG HB3  1 1 
        8  7447 1 1  4 ARG HD2  H   6.129   6.525  -1.138 1.00 . A A .  4 ARG HD2  1 1 
        8  7448 1 1  4 ARG HD3  H   5.546   7.467  -2.508 1.00 . A A .  4 ARG HD3  1 1 
        8  7449 1 1  4 ARG HE   H   7.335   8.341  -0.451 1.00 . A A .  4 ARG HE   1 1 
        8  7450 1 1  4 ARG HG2  H   3.955   8.609  -0.990 1.00 . A A .  4 ARG HG2  1 1 
        8  7451 1 1  4 ARG HG3  H   4.489   7.546   0.314 1.00 . A A .  4 ARG HG3  1 1 
        8  7452 1 1  4 ARG HH11 H   4.937   9.397  -2.757 1.00 . A A .  4 ARG HH11 1 1 
        8  7453 1 1  4 ARG HH12 H   5.556  11.012  -2.848 1.00 . A A .  4 ARG HH12 1 1 
        8  7454 1 1  4 ARG HH21 H   8.149  10.463  -0.569 1.00 . A A .  4 ARG HH21 1 1 
        8  7455 1 1  4 ARG HH22 H   7.379  11.618  -1.607 1.00 . A A .  4 ARG HH22 1 1 
        8  7456 1 1  4 ARG N    N   1.668   7.539   0.285 1.00 . A A .  4 ARG N    1 1 
        8  7457 1 1  4 ARG NE   N   6.624   8.544  -1.093 1.00 . A A .  4 ARG NE   1 1 
        8  7458 1 1  4 ARG NH1  N   5.604  10.085  -2.472 1.00 . A A .  4 ARG NH1  1 1 
        8  7459 1 1  4 ARG NH2  N   7.432  10.693  -1.228 1.00 . A A .  4 ARG NH2  1 1 
        8  7460 1 1  4 ARG O    O   3.870   5.746   1.493 1.00 . A A .  4 ARG O    1 1 
        8  7461 1 1  5 ILE C    C   2.821   2.193   1.880 1.00 . A A .  5 ILE C    1 1 
        8  7462 1 1  5 ILE CA   C   2.426   3.560   2.419 1.00 . A A .  5 ILE CA   1 1 
        8  7463 1 1  5 ILE CB   C   1.280   3.382   3.437 1.00 . A A .  5 ILE CB   1 1 
        8  7464 1 1  5 ILE CD1  C  -0.863   4.438   4.307 1.00 . A A .  5 ILE CD1  1 1 
        8  7465 1 1  5 ILE CG1  C   0.335   4.578   3.396 1.00 . A A .  5 ILE CG1  1 1 
        8  7466 1 1  5 ILE CG2  C   1.831   3.189   4.845 1.00 . A A .  5 ILE CG2  1 1 
        8  7467 1 1  5 ILE H    H   1.198   4.279   0.861 1.00 . A A .  5 ILE H    1 1 
        8  7468 1 1  5 ILE HA   H   3.273   3.999   2.929 1.00 . A A .  5 ILE HA   1 1 
        8  7469 1 1  5 ILE HB   H   0.731   2.495   3.164 1.00 . A A .  5 ILE HB   1 1 
        8  7470 1 1  5 ILE HD11 H  -1.674   5.046   3.933 1.00 . A A .  5 ILE HD11 1 1 
        8  7471 1 1  5 ILE HD12 H  -0.598   4.764   5.303 1.00 . A A .  5 ILE HD12 1 1 
        8  7472 1 1  5 ILE HD13 H  -1.174   3.404   4.338 1.00 . A A .  5 ILE HD13 1 1 
        8  7473 1 1  5 ILE HG12 H   0.875   5.466   3.687 1.00 . A A .  5 ILE HG12 1 1 
        8  7474 1 1  5 ILE HG13 H  -0.024   4.693   2.388 1.00 . A A .  5 ILE HG13 1 1 
        8  7475 1 1  5 ILE HG21 H   2.869   3.486   4.868 1.00 . A A .  5 ILE HG21 1 1 
        8  7476 1 1  5 ILE HG22 H   1.747   2.150   5.125 1.00 . A A .  5 ILE HG22 1 1 
        8  7477 1 1  5 ILE HG23 H   1.267   3.796   5.539 1.00 . A A .  5 ILE HG23 1 1 
        8  7478 1 1  5 ILE N    N   2.042   4.444   1.331 1.00 . A A .  5 ILE N    1 1 
        8  7479 1 1  5 ILE O    O   2.887   1.988   0.669 1.00 . A A .  5 ILE O    1 1 
        8  7480 1 1  6 THR C    C   2.235  -0.990   2.270 1.00 . A A .  6 THR C    1 1 
        8  7481 1 1  6 THR CA   C   3.460  -0.092   2.407 1.00 . A A .  6 THR CA   1 1 
        8  7482 1 1  6 THR CB   C   4.429  -0.678   3.437 1.00 . A A .  6 THR CB   1 1 
        8  7483 1 1  6 THR CG2  C   5.871  -0.666   2.978 1.00 . A A .  6 THR CG2  1 1 
        8  7484 1 1  6 THR H    H   2.997   1.492   3.732 1.00 . A A .  6 THR H    1 1 
        8  7485 1 1  6 THR HA   H   3.958  -0.039   1.449 1.00 . A A .  6 THR HA   1 1 
        8  7486 1 1  6 THR HB   H   4.155  -1.706   3.632 1.00 . A A .  6 THR HB   1 1 
        8  7487 1 1  6 THR HG1  H   4.731   0.915   4.534 1.00 . A A .  6 THR HG1  1 1 
        8  7488 1 1  6 THR HG21 H   5.994   0.066   2.194 1.00 . A A .  6 THR HG21 1 1 
        8  7489 1 1  6 THR HG22 H   6.138  -1.643   2.603 1.00 . A A .  6 THR HG22 1 1 
        8  7490 1 1  6 THR HG23 H   6.512  -0.413   3.810 1.00 . A A .  6 THR HG23 1 1 
        8  7491 1 1  6 THR N    N   3.076   1.263   2.785 1.00 . A A .  6 THR N    1 1 
        8  7492 1 1  6 THR O    O   1.201  -0.744   2.893 1.00 . A A .  6 THR O    1 1 
        8  7493 1 1  6 THR OG1  O   4.360   0.039   4.656 1.00 . A A .  6 THR OG1  1 1 
        8  7494 1 1  7 LEU C    C   1.067  -3.858   2.477 1.00 . A A .  7 LEU C    1 1 
        8  7495 1 1  7 LEU CA   C   1.260  -2.973   1.250 1.00 . A A .  7 LEU CA   1 1 
        8  7496 1 1  7 LEU CB   C   1.526  -3.837   0.016 1.00 . A A .  7 LEU CB   1 1 
        8  7497 1 1  7 LEU CD1  C  -0.871  -4.356  -0.511 1.00 . A A .  7 LEU CD1  1 1 
        8  7498 1 1  7 LEU CD2  C   0.948  -5.832  -1.389 1.00 . A A .  7 LEU CD2  1 1 
        8  7499 1 1  7 LEU CG   C   0.502  -4.947  -0.234 1.00 . A A .  7 LEU CG   1 1 
        8  7500 1 1  7 LEU H    H   3.208  -2.183   0.994 1.00 . A A .  7 LEU H    1 1 
        8  7501 1 1  7 LEU HA   H   0.359  -2.398   1.091 1.00 . A A .  7 LEU HA   1 1 
        8  7502 1 1  7 LEU HB2  H   1.545  -3.191  -0.851 1.00 . A A .  7 LEU HB2  1 1 
        8  7503 1 1  7 LEU HB3  H   2.498  -4.293   0.124 1.00 . A A .  7 LEU HB3  1 1 
        8  7504 1 1  7 LEU HD11 H  -0.956  -3.398  -0.021 1.00 . A A .  7 LEU HD11 1 1 
        8  7505 1 1  7 LEU HD12 H  -1.632  -5.022  -0.135 1.00 . A A .  7 LEU HD12 1 1 
        8  7506 1 1  7 LEU HD13 H  -0.999  -4.227  -1.576 1.00 . A A .  7 LEU HD13 1 1 
        8  7507 1 1  7 LEU HD21 H   0.256  -6.653  -1.501 1.00 . A A .  7 LEU HD21 1 1 
        8  7508 1 1  7 LEU HD22 H   1.937  -6.218  -1.187 1.00 . A A .  7 LEU HD22 1 1 
        8  7509 1 1  7 LEU HD23 H   0.968  -5.251  -2.300 1.00 . A A .  7 LEU HD23 1 1 
        8  7510 1 1  7 LEU HG   H   0.429  -5.563   0.650 1.00 . A A .  7 LEU HG   1 1 
        8  7511 1 1  7 LEU N    N   2.357  -2.035   1.459 1.00 . A A .  7 LEU N    1 1 
        8  7512 1 1  7 LEU O    O  -0.060  -4.176   2.856 1.00 . A A .  7 LEU O    1 1 
        8  7513 1 1  8 LYS C    C   1.493  -4.363   5.452 1.00 . A A .  8 LYS C    1 1 
        8  7514 1 1  8 LYS CA   C   2.136  -5.097   4.279 1.00 . A A .  8 LYS CA   1 1 
        8  7515 1 1  8 LYS CB   C   3.549  -5.548   4.658 1.00 . A A .  8 LYS CB   1 1 
        8  7516 1 1  8 LYS CD   C   4.687  -6.979   6.381 1.00 . A A .  8 LYS CD   1 1 
        8  7517 1 1  8 LYS CE   C   4.981  -8.413   6.790 1.00 . A A .  8 LYS CE   1 1 
        8  7518 1 1  8 LYS CG   C   3.595  -6.912   5.325 1.00 . A A .  8 LYS CG   1 1 
        8  7519 1 1  8 LYS H    H   3.045  -3.963   2.744 1.00 . A A .  8 LYS H    1 1 
        8  7520 1 1  8 LYS HA   H   1.543  -5.966   4.043 1.00 . A A .  8 LYS HA   1 1 
        8  7521 1 1  8 LYS HB2  H   4.153  -5.587   3.764 1.00 . A A .  8 LYS HB2  1 1 
        8  7522 1 1  8 LYS HB3  H   3.974  -4.824   5.337 1.00 . A A .  8 LYS HB3  1 1 
        8  7523 1 1  8 LYS HD2  H   5.588  -6.538   5.980 1.00 . A A .  8 LYS HD2  1 1 
        8  7524 1 1  8 LYS HD3  H   4.368  -6.423   7.250 1.00 . A A .  8 LYS HD3  1 1 
        8  7525 1 1  8 LYS HE2  H   5.090  -8.451   7.864 1.00 . A A .  8 LYS HE2  1 1 
        8  7526 1 1  8 LYS HE3  H   4.151  -9.036   6.492 1.00 . A A .  8 LYS HE3  1 1 
        8  7527 1 1  8 LYS HG2  H   2.643  -7.105   5.795 1.00 . A A .  8 LYS HG2  1 1 
        8  7528 1 1  8 LYS HG3  H   3.787  -7.663   4.573 1.00 . A A .  8 LYS HG3  1 1 
        8  7529 1 1  8 LYS HZ1  H   6.429  -8.399   5.286 1.00 . A A .  8 LYS HZ1  1 1 
        8  7530 1 1  8 LYS HZ2  H   6.120  -9.935   5.923 1.00 . A A .  8 LYS HZ2  1 1 
        8  7531 1 1  8 LYS HZ3  H   7.030  -8.819   6.811 1.00 . A A .  8 LYS HZ3  1 1 
        8  7532 1 1  8 LYS N    N   2.178  -4.251   3.095 1.00 . A A .  8 LYS N    1 1 
        8  7533 1 1  8 LYS NZ   N   6.227  -8.927   6.158 1.00 . A A .  8 LYS NZ   1 1 
        8  7534 1 1  8 LYS O    O   0.666  -4.924   6.171 1.00 . A A .  8 LYS O    1 1 
        8  7535 1 1  9 ASP C    C  -0.168  -2.135   6.590 1.00 . A A .  9 ASP C    1 1 
        8  7536 1 1  9 ASP CA   C   1.343  -2.293   6.723 1.00 . A A .  9 ASP CA   1 1 
        8  7537 1 1  9 ASP CB   C   2.011  -0.916   6.738 1.00 . A A .  9 ASP CB   1 1 
        8  7538 1 1  9 ASP CG   C   3.495  -0.995   7.042 1.00 . A A .  9 ASP CG   1 1 
        8  7539 1 1  9 ASP H    H   2.545  -2.715   5.033 1.00 . A A .  9 ASP H    1 1 
        8  7540 1 1  9 ASP HA   H   1.560  -2.797   7.654 1.00 . A A .  9 ASP HA   1 1 
        8  7541 1 1  9 ASP HB2  H   1.885  -0.452   5.771 1.00 . A A .  9 ASP HB2  1 1 
        8  7542 1 1  9 ASP HB3  H   1.540  -0.303   7.492 1.00 . A A .  9 ASP HB3  1 1 
        8  7543 1 1  9 ASP N    N   1.882  -3.105   5.639 1.00 . A A .  9 ASP N    1 1 
        8  7544 1 1  9 ASP O    O  -0.906  -2.307   7.559 1.00 . A A .  9 ASP O    1 1 
        8  7545 1 1  9 ASP OD1  O   4.171  -1.875   6.468 1.00 . A A .  9 ASP OD1  1 1 
        8  7546 1 1  9 ASP OD2  O   3.978  -0.179   7.855 1.00 . A A .  9 ASP OD2  1 1 
        8  7547 1 1 10 TYR C    C  -2.821  -2.895   5.433 1.00 . A A . 10 TYR C    1 1 
        8  7548 1 1 10 TYR CA   C  -2.042  -1.619   5.127 1.00 . A A . 10 TYR CA   1 1 
        8  7549 1 1 10 TYR CB   C  -2.268  -1.204   3.673 1.00 . A A . 10 TYR CB   1 1 
        8  7550 1 1 10 TYR CD1  C  -4.759  -1.545   3.454 1.00 . A A . 10 TYR CD1  1 1 
        8  7551 1 1 10 TYR CD2  C  -3.887   0.643   3.087 1.00 . A A . 10 TYR CD2  1 1 
        8  7552 1 1 10 TYR CE1  C  -6.038  -1.082   3.205 1.00 . A A . 10 TYR CE1  1 1 
        8  7553 1 1 10 TYR CE2  C  -5.162   1.114   2.836 1.00 . A A . 10 TYR CE2  1 1 
        8  7554 1 1 10 TYR CG   C  -3.665  -0.693   3.399 1.00 . A A . 10 TYR CG   1 1 
        8  7555 1 1 10 TYR CZ   C  -6.233   0.248   2.897 1.00 . A A . 10 TYR CZ   1 1 
        8  7556 1 1 10 TYR H    H   0.021  -1.678   4.654 1.00 . A A . 10 TYR H    1 1 
        8  7557 1 1 10 TYR HA   H  -2.396  -0.832   5.777 1.00 . A A . 10 TYR HA   1 1 
        8  7558 1 1 10 TYR HB2  H  -1.572  -0.420   3.417 1.00 . A A . 10 TYR HB2  1 1 
        8  7559 1 1 10 TYR HB3  H  -2.094  -2.056   3.031 1.00 . A A . 10 TYR HB3  1 1 
        8  7560 1 1 10 TYR HD1  H  -4.603  -2.585   3.696 1.00 . A A . 10 TYR HD1  1 1 
        8  7561 1 1 10 TYR HD2  H  -3.046   1.318   3.041 1.00 . A A . 10 TYR HD2  1 1 
        8  7562 1 1 10 TYR HE1  H  -6.877  -1.760   3.251 1.00 . A A . 10 TYR HE1  1 1 
        8  7563 1 1 10 TYR HE2  H  -5.315   2.156   2.596 1.00 . A A . 10 TYR HE2  1 1 
        8  7564 1 1 10 TYR HH   H  -7.635   1.547   3.103 1.00 . A A . 10 TYR HH   1 1 
        8  7565 1 1 10 TYR N    N  -0.619  -1.803   5.385 1.00 . A A . 10 TYR N    1 1 
        8  7566 1 1 10 TYR O    O  -3.981  -2.843   5.843 1.00 . A A . 10 TYR O    1 1 
        8  7567 1 1 10 TYR OH   O  -7.504   0.713   2.648 1.00 . A A . 10 TYR OH   1 1 
        8  7568 1 1 11 ALA C    C  -2.935  -5.595   6.977 1.00 . A A . 11 ALA C    1 1 
        8  7569 1 1 11 ALA CA   C  -2.811  -5.328   5.481 1.00 . A A . 11 ALA CA   1 1 
        8  7570 1 1 11 ALA CB   C  -2.026  -6.443   4.807 1.00 . A A . 11 ALA CB   1 1 
        8  7571 1 1 11 ALA H    H  -1.254  -4.017   4.900 1.00 . A A . 11 ALA H    1 1 
        8  7572 1 1 11 ALA HA   H  -3.801  -5.303   5.048 1.00 . A A . 11 ALA HA   1 1 
        8  7573 1 1 11 ALA HB1  H  -2.431  -6.623   3.822 1.00 . A A . 11 ALA HB1  1 1 
        8  7574 1 1 11 ALA HB2  H  -2.104  -7.345   5.397 1.00 . A A . 11 ALA HB2  1 1 
        8  7575 1 1 11 ALA HB3  H  -0.989  -6.156   4.725 1.00 . A A . 11 ALA HB3  1 1 
        8  7576 1 1 11 ALA N    N  -2.177  -4.040   5.228 1.00 . A A . 11 ALA N    1 1 
        8  7577 1 1 11 ALA O    O  -3.985  -6.021   7.457 1.00 . A A . 11 ALA O    1 1 
        8  7578 1 1 12 MET C    C  -2.563  -4.437   9.885 1.00 . A A . 12 MET C    1 1 
        8  7579 1 1 12 MET CA   C  -1.842  -5.563   9.148 1.00 . A A . 12 MET CA   1 1 
        8  7580 1 1 12 MET CB   C  -0.403  -5.678   9.650 1.00 . A A . 12 MET CB   1 1 
        8  7581 1 1 12 MET CE   C   0.439  -9.390   8.500 1.00 . A A . 12 MET CE   1 1 
        8  7582 1 1 12 MET CG   C   0.009  -7.098  10.001 1.00 . A A . 12 MET CG   1 1 
        8  7583 1 1 12 MET H    H  -1.048  -5.014   7.274 1.00 . A A . 12 MET H    1 1 
        8  7584 1 1 12 MET HA   H  -2.354  -6.487   9.342 1.00 . A A . 12 MET HA   1 1 
        8  7585 1 1 12 MET HB2  H   0.263  -5.311   8.883 1.00 . A A . 12 MET HB2  1 1 
        8  7586 1 1 12 MET HB3  H  -0.290  -5.064  10.531 1.00 . A A . 12 MET HB3  1 1 
        8  7587 1 1 12 MET HE1  H  -0.037  -9.755   9.399 1.00 . A A . 12 MET HE1  1 1 
        8  7588 1 1 12 MET HE2  H   1.201 -10.088   8.187 1.00 . A A . 12 MET HE2  1 1 
        8  7589 1 1 12 MET HE3  H  -0.300  -9.288   7.718 1.00 . A A . 12 MET HE3  1 1 
        8  7590 1 1 12 MET HG2  H   0.461  -7.095  10.980 1.00 . A A . 12 MET HG2  1 1 
        8  7591 1 1 12 MET HG3  H  -0.875  -7.720  10.016 1.00 . A A . 12 MET HG3  1 1 
        8  7592 1 1 12 MET N    N  -1.856  -5.347   7.710 1.00 . A A . 12 MET N    1 1 
        8  7593 1 1 12 MET O    O  -3.067  -4.626  10.992 1.00 . A A . 12 MET O    1 1 
        8  7594 1 1 12 MET SD   S   1.186  -7.795   8.824 1.00 . A A . 12 MET SD   1 1 
        8  7595 1 1 13 ARG C    C  -4.745  -2.091   9.577 1.00 . A A . 13 ARG C    1 1 
        8  7596 1 1 13 ARG CA   C  -3.246  -2.102   9.859 1.00 . A A . 13 ARG CA   1 1 
        8  7597 1 1 13 ARG CB   C  -2.606  -0.816   9.331 1.00 . A A . 13 ARG CB   1 1 
        8  7598 1 1 13 ARG CD   C  -1.764   0.907  10.965 1.00 . A A . 13 ARG CD   1 1 
        8  7599 1 1 13 ARG CG   C  -2.953   0.417  10.152 1.00 . A A . 13 ARG CG   1 1 
        8  7600 1 1 13 ARG CZ   C  -2.707   1.574  13.141 1.00 . A A . 13 ARG CZ   1 1 
        8  7601 1 1 13 ARG H    H  -2.171  -3.182   8.388 1.00 . A A . 13 ARG H    1 1 
        8  7602 1 1 13 ARG HA   H  -3.097  -2.150  10.924 1.00 . A A . 13 ARG HA   1 1 
        8  7603 1 1 13 ARG HB2  H  -1.530  -0.936   9.335 1.00 . A A . 13 ARG HB2  1 1 
        8  7604 1 1 13 ARG HB3  H  -2.939  -0.651   8.315 1.00 . A A . 13 ARG HB3  1 1 
        8  7605 1 1 13 ARG HD2  H  -0.888   0.346  10.675 1.00 . A A . 13 ARG HD2  1 1 
        8  7606 1 1 13 ARG HD3  H  -1.605   1.954  10.752 1.00 . A A . 13 ARG HD3  1 1 
        8  7607 1 1 13 ARG HE   H  -1.552  -0.026  12.837 1.00 . A A . 13 ARG HE   1 1 
        8  7608 1 1 13 ARG HG2  H  -3.267   1.208   9.483 1.00 . A A . 13 ARG HG2  1 1 
        8  7609 1 1 13 ARG HG3  H  -3.762   0.171  10.828 1.00 . A A . 13 ARG HG3  1 1 
        8  7610 1 1 13 ARG HH11 H  -3.196   2.797  11.607 1.00 . A A . 13 ARG HH11 1 1 
        8  7611 1 1 13 ARG HH12 H  -3.844   3.245  13.149 1.00 . A A . 13 ARG HH12 1 1 
        8  7612 1 1 13 ARG HH21 H  -2.406   0.562  14.864 1.00 . A A . 13 ARG HH21 1 1 
        8  7613 1 1 13 ARG HH22 H  -3.396   1.976  14.998 1.00 . A A . 13 ARG HH22 1 1 
        8  7614 1 1 13 ARG N    N  -2.598  -3.267   9.264 1.00 . A A . 13 ARG N    1 1 
        8  7615 1 1 13 ARG NE   N  -1.977   0.743  12.401 1.00 . A A . 13 ARG NE   1 1 
        8  7616 1 1 13 ARG NH1  N  -3.297   2.624  12.586 1.00 . A A . 13 ARG NH1  1 1 
        8  7617 1 1 13 ARG NH2  N  -2.848   1.353  14.441 1.00 . A A . 13 ARG NH2  1 1 
        8  7618 1 1 13 ARG O    O  -5.558  -2.283  10.482 1.00 . A A . 13 ARG O    1 1 
        8  7619 1 1 14 PHE C    C  -7.079  -3.183   7.694 1.00 . A A . 14 PHE C    1 1 
        8  7620 1 1 14 PHE CA   C  -6.496  -1.790   7.916 1.00 . A A . 14 PHE CA   1 1 
        8  7621 1 1 14 PHE CB   C  -6.596  -0.965   6.642 1.00 . A A . 14 PHE CB   1 1 
        8  7622 1 1 14 PHE CD1  C  -6.967   1.423   7.297 1.00 . A A . 14 PHE CD1  1 1 
        8  7623 1 1 14 PHE CD2  C  -4.808   0.788   6.530 1.00 . A A . 14 PHE CD2  1 1 
        8  7624 1 1 14 PHE CE1  C  -6.528   2.711   7.471 1.00 . A A . 14 PHE CE1  1 1 
        8  7625 1 1 14 PHE CE2  C  -4.366   2.073   6.703 1.00 . A A . 14 PHE CE2  1 1 
        8  7626 1 1 14 PHE CG   C  -6.116   0.444   6.822 1.00 . A A . 14 PHE CG   1 1 
        8  7627 1 1 14 PHE CZ   C  -5.227   3.033   7.173 1.00 . A A . 14 PHE CZ   1 1 
        8  7628 1 1 14 PHE H    H  -4.420  -1.689   7.647 1.00 . A A . 14 PHE H    1 1 
        8  7629 1 1 14 PHE HA   H  -7.054  -1.295   8.697 1.00 . A A . 14 PHE HA   1 1 
        8  7630 1 1 14 PHE HB2  H  -5.998  -1.428   5.873 1.00 . A A . 14 PHE HB2  1 1 
        8  7631 1 1 14 PHE HB3  H  -7.619  -0.934   6.328 1.00 . A A . 14 PHE HB3  1 1 
        8  7632 1 1 14 PHE HD1  H  -7.981   1.175   7.531 1.00 . A A . 14 PHE HD1  1 1 
        8  7633 1 1 14 PHE HD2  H  -4.133   0.043   6.162 1.00 . A A . 14 PHE HD2  1 1 
        8  7634 1 1 14 PHE HE1  H  -7.203   3.470   7.841 1.00 . A A . 14 PHE HE1  1 1 
        8  7635 1 1 14 PHE HE2  H  -3.342   2.328   6.473 1.00 . A A . 14 PHE HE2  1 1 
        8  7636 1 1 14 PHE HZ   H  -4.887   4.027   7.308 1.00 . A A . 14 PHE HZ   1 1 
        8  7637 1 1 14 PHE N    N  -5.107  -1.849   8.321 1.00 . A A . 14 PHE N    1 1 
        8  7638 1 1 14 PHE O    O  -8.216  -3.456   8.076 1.00 . A A . 14 PHE O    1 1 
        8  7639 1 1 15 GLY C    C  -6.684  -5.771   5.339 1.00 . A A . 15 GLY C    1 1 
        8  7640 1 1 15 GLY CA   C  -6.761  -5.409   6.809 1.00 . A A . 15 GLY CA   1 1 
        8  7641 1 1 15 GLY H    H  -5.400  -3.784   6.787 1.00 . A A . 15 GLY H    1 1 
        8  7642 1 1 15 GLY HA2  H  -6.157  -6.102   7.372 1.00 . A A . 15 GLY HA2  1 1 
        8  7643 1 1 15 GLY HA3  H  -7.787  -5.494   7.135 1.00 . A A . 15 GLY HA3  1 1 
        8  7644 1 1 15 GLY N    N  -6.297  -4.058   7.072 1.00 . A A . 15 GLY N    1 1 
        8  7645 1 1 15 GLY O    O  -6.973  -4.945   4.474 1.00 . A A . 15 GLY O    1 1 
        8  7646 1 1 16 GLN C    C  -7.519  -7.374   2.955 1.00 . A A . 16 GLN C    1 1 
        8  7647 1 1 16 GLN CA   C  -6.180  -7.478   3.679 1.00 . A A . 16 GLN CA   1 1 
        8  7648 1 1 16 GLN CB   C  -5.685  -8.926   3.652 1.00 . A A . 16 GLN CB   1 1 
        8  7649 1 1 16 GLN CD   C  -4.065 -10.119   5.182 1.00 . A A . 16 GLN CD   1 1 
        8  7650 1 1 16 GLN CG   C  -4.236  -9.081   4.089 1.00 . A A . 16 GLN CG   1 1 
        8  7651 1 1 16 GLN H    H  -6.078  -7.623   5.789 1.00 . A A . 16 GLN H    1 1 
        8  7652 1 1 16 GLN HA   H  -5.461  -6.852   3.174 1.00 . A A . 16 GLN HA   1 1 
        8  7653 1 1 16 GLN HB2  H  -6.304  -9.518   4.309 1.00 . A A . 16 GLN HB2  1 1 
        8  7654 1 1 16 GLN HB3  H  -5.776  -9.306   2.644 1.00 . A A . 16 GLN HB3  1 1 
        8  7655 1 1 16 GLN HE21 H  -4.400  -8.737   6.576 1.00 . A A . 16 GLN HE21 1 1 
        8  7656 1 1 16 GLN HE22 H  -4.093 -10.344   7.160 1.00 . A A . 16 GLN HE22 1 1 
        8  7657 1 1 16 GLN HG2  H  -3.646  -9.380   3.237 1.00 . A A . 16 GLN HG2  1 1 
        8  7658 1 1 16 GLN HG3  H  -3.881  -8.131   4.456 1.00 . A A . 16 GLN HG3  1 1 
        8  7659 1 1 16 GLN N    N  -6.293  -7.009   5.056 1.00 . A A . 16 GLN N    1 1 
        8  7660 1 1 16 GLN NE2  N  -4.200  -9.690   6.432 1.00 . A A . 16 GLN NE2  1 1 
        8  7661 1 1 16 GLN O    O  -7.566  -7.172   1.741 1.00 . A A . 16 GLN O    1 1 
        8  7662 1 1 16 GLN OE1  O  -3.814 -11.291   4.907 1.00 . A A . 16 GLN OE1  1 1 
        8  7663 1 1 17 THR C    C -10.230  -6.034   2.599 1.00 . A A . 17 THR C    1 1 
        8  7664 1 1 17 THR CA   C  -9.947  -7.433   3.135 1.00 . A A . 17 THR CA   1 1 
        8  7665 1 1 17 THR CB   C -10.990  -7.811   4.185 1.00 . A A . 17 THR CB   1 1 
        8  7666 1 1 17 THR CG2  C -12.410  -7.804   3.648 1.00 . A A . 17 THR CG2  1 1 
        8  7667 1 1 17 THR H    H  -8.507  -7.670   4.669 1.00 . A A . 17 THR H    1 1 
        8  7668 1 1 17 THR HA   H -10.000  -8.136   2.319 1.00 . A A . 17 THR HA   1 1 
        8  7669 1 1 17 THR HB   H -10.940  -7.101   4.999 1.00 . A A . 17 THR HB   1 1 
        8  7670 1 1 17 THR HG1  H -10.820  -9.753   4.008 1.00 . A A . 17 THR HG1  1 1 
        8  7671 1 1 17 THR HG21 H -13.100  -7.661   4.464 1.00 . A A . 17 THR HG21 1 1 
        8  7672 1 1 17 THR HG22 H -12.610  -8.748   3.163 1.00 . A A . 17 THR HG22 1 1 
        8  7673 1 1 17 THR HG23 H -12.520  -7.001   2.936 1.00 . A A . 17 THR HG23 1 1 
        8  7674 1 1 17 THR N    N  -8.607  -7.512   3.707 1.00 . A A . 17 THR N    1 1 
        8  7675 1 1 17 THR O    O -10.670  -5.873   1.461 1.00 . A A . 17 THR O    1 1 
        8  7676 1 1 17 THR OG1  O -10.730  -9.102   4.707 1.00 . A A . 17 THR OG1  1 1 
        8  7677 1 1 18 LYS C    C  -9.284  -3.232   1.892 1.00 . A A . 18 LYS C    1 1 
        8  7678 1 1 18 LYS CA   C -10.200  -3.639   3.034 1.00 . A A . 18 LYS CA   1 1 
        8  7679 1 1 18 LYS CB   C -10.000  -2.707   4.230 1.00 . A A . 18 LYS CB   1 1 
        8  7680 1 1 18 LYS CD   C -10.450  -0.463   5.275 1.00 . A A . 18 LYS CD   1 1 
        8  7681 1 1 18 LYS CE   C -10.280   0.976   4.809 1.00 . A A . 18 LYS CE   1 1 
        8  7682 1 1 18 LYS CG   C -10.760  -1.395   4.116 1.00 . A A . 18 LYS CG   1 1 
        8  7683 1 1 18 LYS H    H  -9.630  -5.216   4.322 1.00 . A A . 18 LYS H    1 1 
        8  7684 1 1 18 LYS HA   H -11.230  -3.556   2.697 1.00 . A A . 18 LYS HA   1 1 
        8  7685 1 1 18 LYS HB2  H -10.330  -3.211   5.126 1.00 . A A . 18 LYS HB2  1 1 
        8  7686 1 1 18 LYS HB3  H  -8.954  -2.481   4.319 1.00 . A A . 18 LYS HB3  1 1 
        8  7687 1 1 18 LYS HD2  H -11.250  -0.510   5.991 1.00 . A A . 18 LYS HD2  1 1 
        8  7688 1 1 18 LYS HD3  H  -9.532  -0.785   5.744 1.00 . A A . 18 LYS HD3  1 1 
        8  7689 1 1 18 LYS HE2  H  -9.260   1.272   4.946 1.00 . A A . 18 LYS HE2  1 1 
        8  7690 1 1 18 LYS HE3  H -10.540   1.033   3.761 1.00 . A A . 18 LYS HE3  1 1 
        8  7691 1 1 18 LYS HG2  H -10.490  -0.909   3.191 1.00 . A A . 18 LYS HG2  1 1 
        8  7692 1 1 18 LYS HG3  H -11.820  -1.604   4.112 1.00 . A A . 18 LYS HG3  1 1 
        8  7693 1 1 18 LYS HZ1  H -11.970   1.390   5.976 1.00 . A A . 18 LYS HZ1  1 1 
        8  7694 1 1 18 LYS HZ2  H -11.520   2.653   4.942 1.00 . A A . 18 LYS HZ2  1 1 
        8  7695 1 1 18 LYS HZ3  H -10.620   2.353   6.343 1.00 . A A . 18 LYS HZ3  1 1 
        8  7696 1 1 18 LYS N    N  -9.979  -5.024   3.426 1.00 . A A . 18 LYS N    1 1 
        8  7697 1 1 18 LYS NZ   N -11.160   1.908   5.570 1.00 . A A . 18 LYS NZ   1 1 
        8  7698 1 1 18 LYS O    O  -9.667  -2.460   1.013 1.00 . A A . 18 LYS O    1 1 
        8  7699 1 1 19 THR C    C  -7.602  -3.841  -0.502 1.00 . A A . 19 THR C    1 1 
        8  7700 1 1 19 THR CA   C  -7.081  -3.449   0.877 1.00 . A A . 19 THR CA   1 1 
        8  7701 1 1 19 THR CB   C  -5.764  -4.172   1.161 1.00 . A A . 19 THR CB   1 1 
        8  7702 1 1 19 THR CG2  C  -4.562  -3.494   0.541 1.00 . A A . 19 THR CG2  1 1 
        8  7703 1 1 19 THR H    H  -7.816  -4.367   2.639 1.00 . A A . 19 THR H    1 1 
        8  7704 1 1 19 THR HA   H  -6.906  -2.383   0.894 1.00 . A A . 19 THR HA   1 1 
        8  7705 1 1 19 THR HB   H  -5.822  -5.175   0.759 1.00 . A A . 19 THR HB   1 1 
        8  7706 1 1 19 THR HG1  H  -4.855  -4.923   2.725 1.00 . A A . 19 THR HG1  1 1 
        8  7707 1 1 19 THR HG21 H  -3.692  -3.671   1.156 1.00 . A A . 19 THR HG21 1 1 
        8  7708 1 1 19 THR HG22 H  -4.743  -2.433   0.471 1.00 . A A . 19 THR HG22 1 1 
        8  7709 1 1 19 THR HG23 H  -4.391  -3.897  -0.448 1.00 . A A . 19 THR HG23 1 1 
        8  7710 1 1 19 THR N    N  -8.063  -3.757   1.911 1.00 . A A . 19 THR N    1 1 
        8  7711 1 1 19 THR O    O  -7.575  -3.042  -1.438 1.00 . A A . 19 THR O    1 1 
        8  7712 1 1 19 THR OG1  O  -5.533  -4.265   2.555 1.00 . A A . 19 THR OG1  1 1 
        8  7713 1 1 20 ALA C    C  -9.836  -4.796  -2.315 1.00 . A A . 20 ALA C    1 1 
        8  7714 1 1 20 ALA CA   C  -8.600  -5.578  -1.884 1.00 . A A . 20 ALA CA   1 1 
        8  7715 1 1 20 ALA CB   C  -8.923  -7.061  -1.766 1.00 . A A . 20 ALA CB   1 1 
        8  7716 1 1 20 ALA H    H  -8.067  -5.667   0.164 1.00 . A A . 20 ALA H    1 1 
        8  7717 1 1 20 ALA HA   H  -7.832  -5.460  -2.633 1.00 . A A . 20 ALA HA   1 1 
        8  7718 1 1 20 ALA HB1  H  -9.866  -7.263  -2.252 1.00 . A A . 20 ALA HB1  1 1 
        8  7719 1 1 20 ALA HB2  H  -8.990  -7.333  -0.723 1.00 . A A . 20 ALA HB2  1 1 
        8  7720 1 1 20 ALA HB3  H  -8.143  -7.639  -2.238 1.00 . A A . 20 ALA HB3  1 1 
        8  7721 1 1 20 ALA N    N  -8.074  -5.077  -0.619 1.00 . A A . 20 ALA N    1 1 
        8  7722 1 1 20 ALA O    O -10.070  -4.595  -3.506 1.00 . A A . 20 ALA O    1 1 
        8  7723 1 1 21 LYS C    C -11.500  -2.153  -1.984 1.00 . A A . 21 LYS C    1 1 
        8  7724 1 1 21 LYS CA   C -11.830  -3.596  -1.621 1.00 . A A . 21 LYS CA   1 1 
        8  7725 1 1 21 LYS CB   C -12.770  -3.625  -0.416 1.00 . A A . 21 LYS CB   1 1 
        8  7726 1 1 21 LYS CD   C -14.700  -2.109  -0.949 1.00 . A A . 21 LYS CD   1 1 
        8  7727 1 1 21 LYS CE   C -15.910  -2.010  -1.860 1.00 . A A . 21 LYS CE   1 1 
        8  7728 1 1 21 LYS CG   C -14.240  -3.549  -0.789 1.00 . A A . 21 LYS CG   1 1 
        8  7729 1 1 21 LYS H    H -10.380  -4.547  -0.408 1.00 . A A . 21 LYS H    1 1 
        8  7730 1 1 21 LYS HA   H -12.330  -4.060  -2.462 1.00 . A A . 21 LYS HA   1 1 
        8  7731 1 1 21 LYS HB2  H -12.610  -4.543   0.132 1.00 . A A . 21 LYS HB2  1 1 
        8  7732 1 1 21 LYS HB3  H -12.540  -2.788   0.228 1.00 . A A . 21 LYS HB3  1 1 
        8  7733 1 1 21 LYS HD2  H -14.960  -1.714   0.023 1.00 . A A . 21 LYS HD2  1 1 
        8  7734 1 1 21 LYS HD3  H -13.900  -1.528  -1.371 1.00 . A A . 21 LYS HD3  1 1 
        8  7735 1 1 21 LYS HE2  H -15.580  -2.039  -2.887 1.00 . A A . 21 LYS HE2  1 1 
        8  7736 1 1 21 LYS HE3  H -16.560  -2.851  -1.670 1.00 . A A . 21 LYS HE3  1 1 
        8  7737 1 1 21 LYS HG2  H -14.400  -4.070  -1.722 1.00 . A A . 21 LYS HG2  1 1 
        8  7738 1 1 21 LYS HG3  H -14.830  -4.021  -0.011 1.00 . A A . 21 LYS HG3  1 1 
        8  7739 1 1 21 LYS HZ1  H -16.390  -0.029  -2.329 1.00 . A A . 21 LYS HZ1  1 1 
        8  7740 1 1 21 LYS HZ2  H -16.490  -0.386  -0.679 1.00 . A A . 21 LYS HZ2  1 1 
        8  7741 1 1 21 LYS HZ3  H -17.700  -0.924  -1.740 1.00 . A A . 21 LYS HZ3  1 1 
        8  7742 1 1 21 LYS N    N -10.620  -4.356  -1.339 1.00 . A A . 21 LYS N    1 1 
        8  7743 1 1 21 LYS NZ   N -16.680  -0.749  -1.636 1.00 . A A . 21 LYS NZ   1 1 
        8  7744 1 1 21 LYS O    O -12.110  -1.570  -2.879 1.00 . A A . 21 LYS O    1 1 
        8  7745 1 1 22 ASP C    C  -9.342  -0.098  -2.839 1.00 . A A . 22 ASP C    1 1 
        8  7746 1 1 22 ASP CA   C -10.110  -0.205  -1.528 1.00 . A A . 22 ASP CA   1 1 
        8  7747 1 1 22 ASP CB   C  -9.259   0.304  -0.368 1.00 . A A . 22 ASP CB   1 1 
        8  7748 1 1 22 ASP CG   C -10.040   1.169   0.597 1.00 . A A . 22 ASP CG   1 1 
        8  7749 1 1 22 ASP H    H -10.080  -2.095  -0.579 1.00 . A A . 22 ASP H    1 1 
        8  7750 1 1 22 ASP HA   H -11.000   0.401  -1.600 1.00 . A A . 22 ASP HA   1 1 
        8  7751 1 1 22 ASP HB2  H  -8.865  -0.543   0.178 1.00 . A A . 22 ASP HB2  1 1 
        8  7752 1 1 22 ASP HB3  H  -8.440   0.888  -0.763 1.00 . A A . 22 ASP HB3  1 1 
        8  7753 1 1 22 ASP N    N -10.530  -1.581  -1.282 1.00 . A A . 22 ASP N    1 1 
        8  7754 1 1 22 ASP O    O  -9.492   0.874  -3.582 1.00 . A A . 22 ASP O    1 1 
        8  7755 1 1 22 ASP OD1  O -11.290   1.205   0.487 1.00 . A A . 22 ASP OD1  1 1 
        8  7756 1 1 22 ASP OD2  O  -9.418   1.814   1.463 1.00 . A A . 22 ASP OD2  1 1 
        8  7757 1 1 23 LEU C    C  -8.552  -1.577  -5.528 1.00 . A A . 23 LEU C    1 1 
        8  7758 1 1 23 LEU CA   C  -7.718  -1.117  -4.337 1.00 . A A . 23 LEU CA   1 1 
        8  7759 1 1 23 LEU CB   C  -6.505  -2.033  -4.166 1.00 . A A . 23 LEU CB   1 1 
        8  7760 1 1 23 LEU CD1  C  -5.185  -1.657  -2.069 1.00 . A A . 23 LEU CD1  1 1 
        8  7761 1 1 23 LEU CD2  C  -4.007  -1.832  -4.266 1.00 . A A . 23 LEU CD2  1 1 
        8  7762 1 1 23 LEU CG   C  -5.270  -1.365  -3.558 1.00 . A A . 23 LEU CG   1 1 
        8  7763 1 1 23 LEU H    H  -8.439  -1.846  -2.486 1.00 . A A . 23 LEU H    1 1 
        8  7764 1 1 23 LEU HA   H  -7.373  -0.111  -4.521 1.00 . A A . 23 LEU HA   1 1 
        8  7765 1 1 23 LEU HB2  H  -6.792  -2.861  -3.533 1.00 . A A . 23 LEU HB2  1 1 
        8  7766 1 1 23 LEU HB3  H  -6.235  -2.422  -5.136 1.00 . A A . 23 LEU HB3  1 1 
        8  7767 1 1 23 LEU HD11 H  -5.036  -2.715  -1.916 1.00 . A A . 23 LEU HD11 1 1 
        8  7768 1 1 23 LEU HD12 H  -6.102  -1.350  -1.588 1.00 . A A . 23 LEU HD12 1 1 
        8  7769 1 1 23 LEU HD13 H  -4.356  -1.112  -1.640 1.00 . A A . 23 LEU HD13 1 1 
        8  7770 1 1 23 LEU HD21 H  -3.905  -2.901  -4.153 1.00 . A A . 23 LEU HD21 1 1 
        8  7771 1 1 23 LEU HD22 H  -3.148  -1.340  -3.833 1.00 . A A . 23 LEU HD22 1 1 
        8  7772 1 1 23 LEU HD23 H  -4.071  -1.586  -5.316 1.00 . A A . 23 LEU HD23 1 1 
        8  7773 1 1 23 LEU HG   H  -5.349  -0.296  -3.684 1.00 . A A . 23 LEU HG   1 1 
        8  7774 1 1 23 LEU N    N  -8.516  -1.100  -3.116 1.00 . A A . 23 LEU N    1 1 
        8  7775 1 1 23 LEU O    O  -8.284  -1.200  -6.669 1.00 . A A . 23 LEU O    1 1 
        8  7776 1 1 24 GLY C    C  -9.965  -4.236  -6.845 1.00 . A A . 24 GLY C    1 1 
        8  7777 1 1 24 GLY CA   C -10.420  -2.891  -6.317 1.00 . A A . 24 GLY CA   1 1 
        8  7778 1 1 24 GLY H    H  -9.732  -2.661  -4.329 1.00 . A A . 24 GLY H    1 1 
        8  7779 1 1 24 GLY HA2  H -11.420  -2.988  -5.936 1.00 . A A . 24 GLY HA2  1 1 
        8  7780 1 1 24 GLY HA3  H -10.420  -2.179  -7.128 1.00 . A A . 24 GLY HA3  1 1 
        8  7781 1 1 24 GLY N    N  -9.566  -2.394  -5.256 1.00 . A A . 24 GLY N    1 1 
        8  7782 1 1 24 GLY O    O -10.210  -4.573  -8.003 1.00 . A A . 24 GLY O    1 1 
        8  7783 1 1 25 VAL C    C  -9.299  -7.397  -5.418 1.00 . A A . 25 VAL C    1 1 
        8  7784 1 1 25 VAL CA   C  -8.802  -6.323  -6.379 1.00 . A A . 25 VAL CA   1 1 
        8  7785 1 1 25 VAL CB   C  -7.263  -6.355  -6.415 1.00 . A A . 25 VAL CB   1 1 
        8  7786 1 1 25 VAL CG1  C  -6.741  -5.600  -7.627 1.00 . A A . 25 VAL CG1  1 1 
        8  7787 1 1 25 VAL CG2  C  -6.687  -5.779  -5.130 1.00 . A A . 25 VAL CG2  1 1 
        8  7788 1 1 25 VAL H    H  -9.130  -4.683  -5.085 1.00 . A A . 25 VAL H    1 1 
        8  7789 1 1 25 VAL HA   H  -9.169  -6.541  -7.371 1.00 . A A . 25 VAL HA   1 1 
        8  7790 1 1 25 VAL HB   H  -6.945  -7.383  -6.496 1.00 . A A . 25 VAL HB   1 1 
        8  7791 1 1 25 VAL HG11 H  -6.499  -4.586  -7.345 1.00 . A A . 25 VAL HG11 1 1 
        8  7792 1 1 25 VAL HG12 H  -7.497  -5.589  -8.398 1.00 . A A . 25 VAL HG12 1 1 
        8  7793 1 1 25 VAL HG13 H  -5.853  -6.090  -8.003 1.00 . A A . 25 VAL HG13 1 1 
        8  7794 1 1 25 VAL HG21 H  -5.609  -5.826  -5.166 1.00 . A A . 25 VAL HG21 1 1 
        8  7795 1 1 25 VAL HG22 H  -7.045  -6.350  -4.287 1.00 . A A . 25 VAL HG22 1 1 
        8  7796 1 1 25 VAL HG23 H  -6.998  -4.750  -5.026 1.00 . A A . 25 VAL HG23 1 1 
        8  7797 1 1 25 VAL N    N  -9.296  -5.007  -5.993 1.00 . A A . 25 VAL N    1 1 
        8  7798 1 1 25 VAL O    O -10.040  -7.108  -4.481 1.00 . A A . 25 VAL O    1 1 
        8  7799 1 1 26 GLN C    C  -8.244 -10.007  -3.726 1.00 . A A . 26 GLN C    1 1 
        8  7800 1 1 26 GLN CA   C  -9.284  -9.752  -4.810 1.00 . A A . 26 GLN CA   1 1 
        8  7801 1 1 26 GLN CB   C  -9.482 -11.013  -5.653 1.00 . A A . 26 GLN CB   1 1 
        8  7802 1 1 26 GLN CD   C  -8.363 -11.094  -7.916 1.00 . A A . 26 GLN CD   1 1 
        8  7803 1 1 26 GLN CG   C  -8.246 -11.418  -6.439 1.00 . A A . 26 GLN CG   1 1 
        8  7804 1 1 26 GLN H    H  -8.292  -8.805  -6.414 1.00 . A A . 26 GLN H    1 1 
        8  7805 1 1 26 GLN HA   H -10.220  -9.492  -4.340 1.00 . A A . 26 GLN HA   1 1 
        8  7806 1 1 26 GLN HB2  H  -9.750 -11.830  -4.999 1.00 . A A . 26 GLN HB2  1 1 
        8  7807 1 1 26 GLN HB3  H -10.280 -10.843  -6.351 1.00 . A A . 26 GLN HB3  1 1 
        8  7808 1 1 26 GLN HE21 H  -7.345 -12.737  -8.383 1.00 . A A . 26 GLN HE21 1 1 
        8  7809 1 1 26 GLN HE22 H  -7.860 -11.769  -9.718 1.00 . A A . 26 GLN HE22 1 1 
        8  7810 1 1 26 GLN HG2  H  -7.392 -10.893  -6.039 1.00 . A A . 26 GLN HG2  1 1 
        8  7811 1 1 26 GLN HG3  H  -8.099 -12.482  -6.330 1.00 . A A . 26 GLN HG3  1 1 
        8  7812 1 1 26 GLN N    N  -8.883  -8.637  -5.655 1.00 . A A . 26 GLN N    1 1 
        8  7813 1 1 26 GLN NE2  N  -7.799 -11.954  -8.757 1.00 . A A . 26 GLN NE2  1 1 
        8  7814 1 1 26 GLN O    O  -7.046  -9.832  -3.947 1.00 . A A . 26 GLN O    1 1 
        8  7815 1 1 26 GLN OE1  O  -8.953 -10.084  -8.297 1.00 . A A . 26 GLN OE1  1 1 
        8  7816 1 1 27 GLN C    C  -6.763 -11.730  -1.814 1.00 . A A . 27 GLN C    1 1 
        8  7817 1 1 27 GLN CA   C  -7.828 -10.707  -1.433 1.00 . A A . 27 GLN CA   1 1 
        8  7818 1 1 27 GLN CB   C  -8.635 -11.212  -0.236 1.00 . A A . 27 GLN CB   1 1 
        8  7819 1 1 27 GLN CD   C -10.850 -10.114   0.278 1.00 . A A . 27 GLN CD   1 1 
        8  7820 1 1 27 GLN CG   C  -9.355 -10.109   0.523 1.00 . A A . 27 GLN CG   1 1 
        8  7821 1 1 27 GLN H    H  -9.679 -10.543  -2.450 1.00 . A A . 27 GLN H    1 1 
        8  7822 1 1 27 GLN HA   H  -7.338  -9.786  -1.161 1.00 . A A . 27 GLN HA   1 1 
        8  7823 1 1 27 GLN HB2  H  -9.372 -11.920  -0.587 1.00 . A A . 27 GLN HB2  1 1 
        8  7824 1 1 27 GLN HB3  H  -7.966 -11.713   0.449 1.00 . A A . 27 GLN HB3  1 1 
        8  7825 1 1 27 GLN HE21 H -10.920  -8.144   0.536 1.00 . A A . 27 GLN HE21 1 1 
        8  7826 1 1 27 GLN HE22 H -12.430  -8.910   0.186 1.00 . A A . 27 GLN HE22 1 1 
        8  7827 1 1 27 GLN HG2  H  -9.179 -10.242   1.580 1.00 . A A . 27 GLN HG2  1 1 
        8  7828 1 1 27 GLN HG3  H  -8.957  -9.155   0.210 1.00 . A A . 27 GLN HG3  1 1 
        8  7829 1 1 27 GLN N    N  -8.713 -10.423  -2.558 1.00 . A A . 27 GLN N    1 1 
        8  7830 1 1 27 GLN NE2  N -11.460  -8.936   0.339 1.00 . A A . 27 GLN NE2  1 1 
        8  7831 1 1 27 GLN O    O  -5.699 -11.794  -1.197 1.00 . A A . 27 GLN O    1 1 
        8  7832 1 1 27 GLN OE1  O -11.450 -11.161   0.036 1.00 . A A . 27 GLN OE1  1 1 
        8  7833 1 1 28 SER C    C  -4.832 -12.916  -3.805 1.00 . A A . 28 SER C    1 1 
        8  7834 1 1 28 SER CA   C  -6.126 -13.548  -3.299 1.00 . A A . 28 SER CA   1 1 
        8  7835 1 1 28 SER CB   C  -6.765 -14.385  -4.409 1.00 . A A . 28 SER CB   1 1 
        8  7836 1 1 28 SER H    H  -7.919 -12.428  -3.284 1.00 . A A . 28 SER H    1 1 
        8  7837 1 1 28 SER HA   H  -5.895 -14.193  -2.465 1.00 . A A . 28 SER HA   1 1 
        8  7838 1 1 28 SER HB2  H  -7.502 -13.788  -4.927 1.00 . A A . 28 SER HB2  1 1 
        8  7839 1 1 28 SER HB3  H  -6.003 -14.697  -5.107 1.00 . A A . 28 SER HB3  1 1 
        8  7840 1 1 28 SER HG   H  -6.739 -16.187  -3.642 1.00 . A A . 28 SER HG   1 1 
        8  7841 1 1 28 SER N    N  -7.057 -12.529  -2.833 1.00 . A A . 28 SER N    1 1 
        8  7842 1 1 28 SER O    O  -3.737 -13.337  -3.432 1.00 . A A . 28 SER O    1 1 
        8  7843 1 1 28 SER OG   O  -7.402 -15.536  -3.881 1.00 . A A . 28 SER OG   1 1 
        8  7844 1 1 29 ALA C    C  -3.000 -10.531  -4.114 1.00 . A A . 29 ALA C    1 1 
        8  7845 1 1 29 ALA CA   C  -3.812 -11.212  -5.209 1.00 . A A . 29 ALA CA   1 1 
        8  7846 1 1 29 ALA CB   C  -4.254 -10.193  -6.250 1.00 . A A . 29 ALA CB   1 1 
        8  7847 1 1 29 ALA H    H  -5.869 -11.613  -4.914 1.00 . A A . 29 ALA H    1 1 
        8  7848 1 1 29 ALA HA   H  -3.189 -11.945  -5.700 1.00 . A A . 29 ALA HA   1 1 
        8  7849 1 1 29 ALA HB1  H  -5.252  -9.851  -6.017 1.00 . A A . 29 ALA HB1  1 1 
        8  7850 1 1 29 ALA HB2  H  -4.251 -10.652  -7.227 1.00 . A A . 29 ALA HB2  1 1 
        8  7851 1 1 29 ALA HB3  H  -3.576  -9.353  -6.243 1.00 . A A . 29 ALA HB3  1 1 
        8  7852 1 1 29 ALA N    N  -4.969 -11.902  -4.654 1.00 . A A . 29 ALA N    1 1 
        8  7853 1 1 29 ALA O    O  -1.768 -10.575  -4.122 1.00 . A A . 29 ALA O    1 1 
        8  7854 1 1 30 ILE C    C  -2.181 -10.194  -1.259 1.00 . A A . 30 ILE C    1 1 
        8  7855 1 1 30 ILE CA   C  -3.033  -9.221  -2.065 1.00 . A A . 30 ILE CA   1 1 
        8  7856 1 1 30 ILE CB   C  -4.052  -8.545  -1.125 1.00 . A A . 30 ILE CB   1 1 
        8  7857 1 1 30 ILE CD1  C  -4.379  -6.666  -2.814 1.00 . A A . 30 ILE CD1  1 1 
        8  7858 1 1 30 ILE CG1  C  -5.042  -7.698  -1.926 1.00 . A A . 30 ILE CG1  1 1 
        8  7859 1 1 30 ILE CG2  C  -3.332  -7.692  -0.091 1.00 . A A . 30 ILE CG2  1 1 
        8  7860 1 1 30 ILE H    H  -4.673  -9.908  -3.215 1.00 . A A . 30 ILE H    1 1 
        8  7861 1 1 30 ILE HA   H  -2.393  -8.458  -2.482 1.00 . A A . 30 ILE HA   1 1 
        8  7862 1 1 30 ILE HB   H  -4.593  -9.319  -0.602 1.00 . A A . 30 ILE HB   1 1 
        8  7863 1 1 30 ILE HD11 H  -3.467  -6.323  -2.346 1.00 . A A . 30 ILE HD11 1 1 
        8  7864 1 1 30 ILE HD12 H  -5.048  -5.831  -2.956 1.00 . A A . 30 ILE HD12 1 1 
        8  7865 1 1 30 ILE HD13 H  -4.146  -7.111  -3.770 1.00 . A A . 30 ILE HD13 1 1 
        8  7866 1 1 30 ILE HG12 H  -5.634  -8.344  -2.556 1.00 . A A . 30 ILE HG12 1 1 
        8  7867 1 1 30 ILE HG13 H  -5.695  -7.175  -1.241 1.00 . A A . 30 ILE HG13 1 1 
        8  7868 1 1 30 ILE HG21 H  -3.926  -6.819   0.131 1.00 . A A . 30 ILE HG21 1 1 
        8  7869 1 1 30 ILE HG22 H  -2.373  -7.384  -0.482 1.00 . A A . 30 ILE HG22 1 1 
        8  7870 1 1 30 ILE HG23 H  -3.186  -8.267   0.812 1.00 . A A . 30 ILE HG23 1 1 
        8  7871 1 1 30 ILE N    N  -3.694  -9.906  -3.169 1.00 . A A . 30 ILE N    1 1 
        8  7872 1 1 30 ILE O    O  -1.029  -9.906  -0.936 1.00 . A A . 30 ILE O    1 1 
        8  7873 1 1 31 ASN C    C  -0.841 -12.876  -0.950 1.00 . A A . 31 ASN C    1 1 
        8  7874 1 1 31 ASN CA   C  -2.051 -12.365  -0.177 1.00 . A A . 31 ASN CA   1 1 
        8  7875 1 1 31 ASN CB   C  -2.988 -13.529   0.155 1.00 . A A . 31 ASN CB   1 1 
        8  7876 1 1 31 ASN CG   C  -2.553 -14.286   1.394 1.00 . A A . 31 ASN CG   1 1 
        8  7877 1 1 31 ASN H    H  -3.677 -11.519  -1.229 1.00 . A A . 31 ASN H    1 1 
        8  7878 1 1 31 ASN HA   H  -1.711 -11.914   0.743 1.00 . A A . 31 ASN HA   1 1 
        8  7879 1 1 31 ASN HB2  H  -3.984 -13.144   0.323 1.00 . A A . 31 ASN HB2  1 1 
        8  7880 1 1 31 ASN HB3  H  -3.008 -14.216  -0.678 1.00 . A A . 31 ASN HB3  1 1 
        8  7881 1 1 31 ASN HD21 H  -1.117 -15.195   0.357 1.00 . A A . 31 ASN HD21 1 1 
        8  7882 1 1 31 ASN HD22 H  -1.226 -15.624   2.036 1.00 . A A . 31 ASN HD22 1 1 
        8  7883 1 1 31 ASN N    N  -2.757 -11.347  -0.940 1.00 . A A . 31 ASN N    1 1 
        8  7884 1 1 31 ASN ND2  N  -1.528 -15.119   1.248 1.00 . A A . 31 ASN ND2  1 1 
        8  7885 1 1 31 ASN O    O   0.207 -13.154  -0.369 1.00 . A A . 31 ASN O    1 1 
        8  7886 1 1 31 ASN OD1  O  -3.131 -14.126   2.470 1.00 . A A . 31 ASN OD1  1 1 
        8  7887 1 1 32 LYS C    C   1.196 -12.444  -3.232 1.00 . A A . 32 LYS C    1 1 
        8  7888 1 1 32 LYS CA   C   0.082 -13.477  -3.121 1.00 . A A . 32 LYS CA   1 1 
        8  7889 1 1 32 LYS CB   C  -0.452 -13.813  -4.514 1.00 . A A . 32 LYS CB   1 1 
        8  7890 1 1 32 LYS CD   C  -1.178 -16.126  -5.190 1.00 . A A . 32 LYS CD   1 1 
        8  7891 1 1 32 LYS CE   C  -2.339 -17.105  -5.264 1.00 . A A . 32 LYS CE   1 1 
        8  7892 1 1 32 LYS CG   C  -1.583 -14.831  -4.503 1.00 . A A . 32 LYS CG   1 1 
        8  7893 1 1 32 LYS H    H  -1.855 -12.763  -2.671 1.00 . A A . 32 LYS H    1 1 
        8  7894 1 1 32 LYS HA   H   0.481 -14.368  -2.674 1.00 . A A . 32 LYS HA   1 1 
        8  7895 1 1 32 LYS HB2  H  -0.815 -12.908  -4.976 1.00 . A A . 32 LYS HB2  1 1 
        8  7896 1 1 32 LYS HB3  H   0.357 -14.210  -5.110 1.00 . A A . 32 LYS HB3  1 1 
        8  7897 1 1 32 LYS HD2  H  -0.845 -15.903  -6.192 1.00 . A A . 32 LYS HD2  1 1 
        8  7898 1 1 32 LYS HD3  H  -0.370 -16.580  -4.633 1.00 . A A . 32 LYS HD3  1 1 
        8  7899 1 1 32 LYS HE2  H  -1.966 -18.100  -5.071 1.00 . A A . 32 LYS HE2  1 1 
        8  7900 1 1 32 LYS HE3  H  -3.065 -16.840  -4.509 1.00 . A A . 32 LYS HE3  1 1 
        8  7901 1 1 32 LYS HG2  H  -1.849 -15.046  -3.480 1.00 . A A . 32 LYS HG2  1 1 
        8  7902 1 1 32 LYS HG3  H  -2.434 -14.413  -5.019 1.00 . A A . 32 LYS HG3  1 1 
        8  7903 1 1 32 LYS HZ1  H  -2.471 -17.684  -7.266 1.00 . A A . 32 LYS HZ1  1 1 
        8  7904 1 1 32 LYS HZ2  H  -3.026 -16.114  -6.970 1.00 . A A . 32 LYS HZ2  1 1 
        8  7905 1 1 32 LYS HZ3  H  -3.971 -17.443  -6.522 1.00 . A A . 32 LYS HZ3  1 1 
        8  7906 1 1 32 LYS N    N  -0.996 -12.999  -2.266 1.00 . A A . 32 LYS N    1 1 
        8  7907 1 1 32 LYS NZ   N  -2.998 -17.085  -6.598 1.00 . A A . 32 LYS NZ   1 1 
        8  7908 1 1 32 LYS O    O   2.359 -12.790  -3.444 1.00 . A A . 32 LYS O    1 1 
        8  7909 1 1 33 TRP C    C   2.747 -10.105  -2.000 1.00 . A A . 33 TRP C    1 1 
        8  7910 1 1 33 TRP CA   C   1.783 -10.094  -3.182 1.00 . A A . 33 TRP CA   1 1 
        8  7911 1 1 33 TRP CB   C   1.011  -8.786  -3.229 1.00 . A A . 33 TRP CB   1 1 
        8  7912 1 1 33 TRP CD1  C   0.540  -9.247  -5.673 1.00 . A A . 33 TRP CD1  1 1 
        8  7913 1 1 33 TRP CD2  C  -0.656  -7.573  -4.825 1.00 . A A . 33 TRP CD2  1 1 
        8  7914 1 1 33 TRP CE2  C  -0.999  -7.717  -6.180 1.00 . A A . 33 TRP CE2  1 1 
        8  7915 1 1 33 TRP CE3  C  -1.279  -6.585  -4.070 1.00 . A A . 33 TRP CE3  1 1 
        8  7916 1 1 33 TRP CG   C   0.338  -8.550  -4.534 1.00 . A A . 33 TRP CG   1 1 
        8  7917 1 1 33 TRP CH2  C  -2.547  -5.942  -6.035 1.00 . A A . 33 TRP CH2  1 1 
        8  7918 1 1 33 TRP CZ2  C  -1.945  -6.907  -6.797 1.00 . A A . 33 TRP CZ2  1 1 
        8  7919 1 1 33 TRP CZ3  C  -2.223  -5.777  -4.681 1.00 . A A . 33 TRP CZ3  1 1 
        8  7920 1 1 33 TRP H    H  -0.112 -10.962  -2.931 1.00 . A A . 33 TRP H    1 1 
        8  7921 1 1 33 TRP HA   H   2.341 -10.207  -4.098 1.00 . A A . 33 TRP HA   1 1 
        8  7922 1 1 33 TRP HB2  H   0.245  -8.818  -2.483 1.00 . A A . 33 TRP HB2  1 1 
        8  7923 1 1 33 TRP HB3  H   1.679  -7.965  -3.036 1.00 . A A . 33 TRP HB3  1 1 
        8  7924 1 1 33 TRP HD1  H   1.231 -10.062  -5.750 1.00 . A A . 33 TRP HD1  1 1 
        8  7925 1 1 33 TRP HE1  H  -0.279  -9.080  -7.601 1.00 . A A . 33 TRP HE1  1 1 
        8  7926 1 1 33 TRP HE3  H  -1.042  -6.455  -3.025 1.00 . A A . 33 TRP HE3  1 1 
        8  7927 1 1 33 TRP HH2  H  -3.288  -5.289  -6.472 1.00 . A A . 33 TRP HH2  1 1 
        8  7928 1 1 33 TRP HZ2  H  -2.203  -7.024  -7.841 1.00 . A A . 33 TRP HZ2  1 1 
        8  7929 1 1 33 TRP HZ3  H  -2.718  -5.005  -4.112 1.00 . A A . 33 TRP HZ3  1 1 
        8  7930 1 1 33 TRP N    N   0.831 -11.179  -3.094 1.00 . A A . 33 TRP N    1 1 
        8  7931 1 1 33 TRP NE1  N  -0.253  -8.750  -6.680 1.00 . A A . 33 TRP NE1  1 1 
        8  7932 1 1 33 TRP O    O   3.953  -9.934  -2.167 1.00 . A A . 33 TRP O    1 1 
        8  7933 1 1 34 ILE C    C   3.657 -11.716   0.602 1.00 . A A . 34 ILE C    1 1 
        8  7934 1 1 34 ILE CA   C   3.011 -10.346   0.408 1.00 . A A . 34 ILE CA   1 1 
        8  7935 1 1 34 ILE CB   C   2.171 -10.006   1.654 1.00 . A A . 34 ILE CB   1 1 
        8  7936 1 1 34 ILE CD1  C   0.218  -8.552   2.397 1.00 . A A . 34 ILE CD1  1 1 
        8  7937 1 1 34 ILE CG1  C   1.355  -8.734   1.415 1.00 . A A . 34 ILE CG1  1 1 
        8  7938 1 1 34 ILE CG2  C   3.069  -9.847   2.871 1.00 . A A . 34 ILE CG2  1 1 
        8  7939 1 1 34 ILE H    H   1.234 -10.439  -0.737 1.00 . A A . 34 ILE H    1 1 
        8  7940 1 1 34 ILE HA   H   3.789  -9.602   0.311 1.00 . A A . 34 ILE HA   1 1 
        8  7941 1 1 34 ILE HB   H   1.496 -10.829   1.840 1.00 . A A . 34 ILE HB   1 1 
        8  7942 1 1 34 ILE HD11 H   0.620  -8.359   3.380 1.00 . A A . 34 ILE HD11 1 1 
        8  7943 1 1 34 ILE HD12 H  -0.382  -9.450   2.423 1.00 . A A . 34 ILE HD12 1 1 
        8  7944 1 1 34 ILE HD13 H  -0.394  -7.717   2.088 1.00 . A A . 34 ILE HD13 1 1 
        8  7945 1 1 34 ILE HG12 H   2.006  -7.876   1.501 1.00 . A A . 34 ILE HG12 1 1 
        8  7946 1 1 34 ILE HG13 H   0.936  -8.764   0.421 1.00 . A A . 34 ILE HG13 1 1 
        8  7947 1 1 34 ILE HG21 H   3.680  -8.964   2.755 1.00 . A A . 34 ILE HG21 1 1 
        8  7948 1 1 34 ILE HG22 H   3.705 -10.716   2.965 1.00 . A A . 34 ILE HG22 1 1 
        8  7949 1 1 34 ILE HG23 H   2.460  -9.748   3.757 1.00 . A A . 34 ILE HG23 1 1 
        8  7950 1 1 34 ILE N    N   2.203 -10.309  -0.805 1.00 . A A . 34 ILE N    1 1 
        8  7951 1 1 34 ILE O    O   4.678 -11.840   1.277 1.00 . A A . 34 ILE O    1 1 
        8  7952 1 1 35 HIS C    C   5.004 -14.183  -0.393 1.00 . A A . 35 HIS C    1 1 
        8  7953 1 1 35 HIS CA   C   3.571 -14.102   0.115 1.00 . A A . 35 HIS CA   1 1 
        8  7954 1 1 35 HIS CB   C   2.687 -15.069  -0.676 1.00 . A A . 35 HIS CB   1 1 
        8  7955 1 1 35 HIS CD2  C   1.293 -17.185  -0.134 1.00 . A A . 35 HIS CD2  1 1 
        8  7956 1 1 35 HIS CE1  C   2.311 -17.781   1.713 1.00 . A A . 35 HIS CE1  1 1 
        8  7957 1 1 35 HIS CG   C   2.274 -16.281   0.099 1.00 . A A . 35 HIS CG   1 1 
        8  7958 1 1 35 HIS H    H   2.243 -12.581  -0.518 1.00 . A A . 35 HIS H    1 1 
        8  7959 1 1 35 HIS HA   H   3.555 -14.377   1.152 1.00 . A A . 35 HIS HA   1 1 
        8  7960 1 1 35 HIS HB2  H   1.792 -14.554  -0.986 1.00 . A A . 35 HIS HB2  1 1 
        8  7961 1 1 35 HIS HB3  H   3.224 -15.402  -1.552 1.00 . A A . 35 HIS HB3  1 1 
        8  7962 1 1 35 HIS HD1  H   3.648 -16.234   1.697 1.00 . A A . 35 HIS HD1  1 1 
        8  7963 1 1 35 HIS HD2  H   0.606 -17.181  -0.968 1.00 . A A . 35 HIS HD2  1 1 
        8  7964 1 1 35 HIS HE1  H   2.583 -18.321   2.609 1.00 . A A . 35 HIS HE1  1 1 
        8  7965 1 1 35 HIS HE2  H   0.803 -18.926   0.932 1.00 . A A . 35 HIS HE2  1 1 
        8  7966 1 1 35 HIS N    N   3.055 -12.741   0.006 1.00 . A A . 35 HIS N    1 1 
        8  7967 1 1 35 HIS ND1  N   2.893 -16.684   1.265 1.00 . A A . 35 HIS ND1  1 1 
        8  7968 1 1 35 HIS NE2  N   1.337 -18.105   0.884 1.00 . A A . 35 HIS NE2  1 1 
        8  7969 1 1 35 HIS O    O   5.815 -14.957   0.116 1.00 . A A . 35 HIS O    1 1 
        8  7970 1 1 36 ALA C    C   7.351 -12.038  -1.705 1.00 . A A . 36 ALA C    1 1 
        8  7971 1 1 36 ALA CA   C   6.630 -13.354  -1.995 1.00 . A A . 36 ALA CA   1 1 
        8  7972 1 1 36 ALA CB   C   6.532 -13.583  -3.495 1.00 . A A . 36 ALA CB   1 1 
        8  7973 1 1 36 ALA H    H   4.602 -12.794  -1.757 1.00 . A A . 36 ALA H    1 1 
        8  7974 1 1 36 ALA HA   H   7.201 -14.167  -1.570 1.00 . A A . 36 ALA HA   1 1 
        8  7975 1 1 36 ALA HB1  H   5.728 -14.276  -3.700 1.00 . A A . 36 ALA HB1  1 1 
        8  7976 1 1 36 ALA HB2  H   7.463 -13.993  -3.860 1.00 . A A . 36 ALA HB2  1 1 
        8  7977 1 1 36 ALA HB3  H   6.333 -12.645  -3.991 1.00 . A A . 36 ALA HB3  1 1 
        8  7978 1 1 36 ALA N    N   5.300 -13.381  -1.401 1.00 . A A . 36 ALA N    1 1 
        8  7979 1 1 36 ALA O    O   8.430 -11.783  -2.243 1.00 . A A . 36 ALA O    1 1 
        8  7980 1 1 37 GLY C    C   7.470  -9.003  -1.705 1.00 . A A . 37 GLY C    1 1 
        8  7981 1 1 37 GLY CA   C   7.365  -9.935  -0.514 1.00 . A A . 37 GLY CA   1 1 
        8  7982 1 1 37 GLY H    H   5.899 -11.460  -0.454 1.00 . A A . 37 GLY H    1 1 
        8  7983 1 1 37 GLY HA2  H   6.769  -9.457   0.250 1.00 . A A . 37 GLY HA2  1 1 
        8  7984 1 1 37 GLY HA3  H   8.354 -10.115  -0.123 1.00 . A A . 37 GLY HA3  1 1 
        8  7985 1 1 37 GLY N    N   6.756 -11.207  -0.854 1.00 . A A . 37 GLY N    1 1 
        8  7986 1 1 37 GLY O    O   8.548  -8.491  -2.006 1.00 . A A . 37 GLY O    1 1 
        8  7987 1 1 38 ARG C    C   6.308  -6.442  -3.127 1.00 . A A . 38 ARG C    1 1 
        8  7988 1 1 38 ARG CA   C   6.322  -7.908  -3.549 1.00 . A A . 38 ARG CA   1 1 
        8  7989 1 1 38 ARG CB   C   5.098  -8.213  -4.414 1.00 . A A . 38 ARG CB   1 1 
        8  7990 1 1 38 ARG CD   C   4.005  -8.093  -6.675 1.00 . A A . 38 ARG CD   1 1 
        8  7991 1 1 38 ARG CG   C   5.249  -7.771  -5.861 1.00 . A A . 38 ARG CG   1 1 
        8  7992 1 1 38 ARG CZ   C   2.937  -7.385  -8.779 1.00 . A A . 38 ARG CZ   1 1 
        8  7993 1 1 38 ARG H    H   5.521  -9.221  -2.095 1.00 . A A . 38 ARG H    1 1 
        8  7994 1 1 38 ARG HA   H   7.215  -8.096  -4.127 1.00 . A A . 38 ARG HA   1 1 
        8  7995 1 1 38 ARG HB2  H   4.920  -9.278  -4.403 1.00 . A A . 38 ARG HB2  1 1 
        8  7996 1 1 38 ARG HB3  H   4.238  -7.709  -3.995 1.00 . A A . 38 ARG HB3  1 1 
        8  7997 1 1 38 ARG HD2  H   4.029  -9.136  -6.949 1.00 . A A . 38 ARG HD2  1 1 
        8  7998 1 1 38 ARG HD3  H   3.133  -7.901  -6.065 1.00 . A A . 38 ARG HD3  1 1 
        8  7999 1 1 38 ARG HE   H   4.637  -6.635  -8.051 1.00 . A A . 38 ARG HE   1 1 
        8  8000 1 1 38 ARG HG2  H   5.416  -6.705  -5.886 1.00 . A A . 38 ARG HG2  1 1 
        8  8001 1 1 38 ARG HG3  H   6.095  -8.283  -6.296 1.00 . A A . 38 ARG HG3  1 1 
        8  8002 1 1 38 ARG HH11 H   1.946  -8.841  -7.784 1.00 . A A . 38 ARG HH11 1 1 
        8  8003 1 1 38 ARG HH12 H   1.216  -8.325  -9.267 1.00 . A A . 38 ARG HH12 1 1 
        8  8004 1 1 38 ARG HH21 H   3.678  -5.956 -10.001 1.00 . A A . 38 ARG HH21 1 1 
        8  8005 1 1 38 ARG HH22 H   2.198  -6.688 -10.527 1.00 . A A . 38 ARG HH22 1 1 
        8  8006 1 1 38 ARG N    N   6.349  -8.785  -2.384 1.00 . A A . 38 ARG N    1 1 
        8  8007 1 1 38 ARG NE   N   3.922  -7.286  -7.889 1.00 . A A . 38 ARG NE   1 1 
        8  8008 1 1 38 ARG NH1  N   1.952  -8.256  -8.595 1.00 . A A . 38 ARG NH1  1 1 
        8  8009 1 1 38 ARG NH2  N   2.937  -6.613  -9.857 1.00 . A A . 38 ARG NH2  1 1 
        8  8010 1 1 38 ARG O    O   5.331  -5.960  -2.554 1.00 . A A . 38 ARG O    1 1 
        8  8011 1 1 39 LYS C    C   6.411  -3.509  -3.719 1.00 . A A . 39 LYS C    1 1 
        8  8012 1 1 39 LYS CA   C   7.514  -4.328  -3.056 1.00 . A A . 39 LYS CA   1 1 
        8  8013 1 1 39 LYS CB   C   8.884  -3.788  -3.469 1.00 . A A . 39 LYS CB   1 1 
        8  8014 1 1 39 LYS CD   C   9.992  -3.722  -1.214 1.00 . A A . 39 LYS CD   1 1 
        8  8015 1 1 39 LYS CE   C  10.675  -2.364  -1.165 1.00 . A A . 39 LYS CE   1 1 
        8  8016 1 1 39 LYS CG   C  10.027  -4.312  -2.615 1.00 . A A . 39 LYS CG   1 1 
        8  8017 1 1 39 LYS H    H   8.146  -6.179  -3.865 1.00 . A A . 39 LYS H    1 1 
        8  8018 1 1 39 LYS HA   H   7.412  -4.246  -1.985 1.00 . A A . 39 LYS HA   1 1 
        8  8019 1 1 39 LYS HB2  H   9.074  -4.064  -4.495 1.00 . A A . 39 LYS HB2  1 1 
        8  8020 1 1 39 LYS HB3  H   8.872  -2.710  -3.392 1.00 . A A . 39 LYS HB3  1 1 
        8  8021 1 1 39 LYS HD2  H   8.964  -3.608  -0.906 1.00 . A A . 39 LYS HD2  1 1 
        8  8022 1 1 39 LYS HD3  H  10.499  -4.395  -0.538 1.00 . A A . 39 LYS HD3  1 1 
        8  8023 1 1 39 LYS HE2  H  11.692  -2.499  -0.828 1.00 . A A . 39 LYS HE2  1 1 
        8  8024 1 1 39 LYS HE3  H  10.679  -1.941  -2.158 1.00 . A A . 39 LYS HE3  1 1 
        8  8025 1 1 39 LYS HG2  H   9.947  -5.386  -2.542 1.00 . A A . 39 LYS HG2  1 1 
        8  8026 1 1 39 LYS HG3  H  10.964  -4.050  -3.084 1.00 . A A . 39 LYS HG3  1 1 
        8  8027 1 1 39 LYS HZ1  H  10.389  -1.494   0.714 1.00 . A A . 39 LYS HZ1  1 1 
        8  8028 1 1 39 LYS HZ2  H   8.968  -1.659  -0.188 1.00 . A A . 39 LYS HZ2  1 1 
        8  8029 1 1 39 LYS HZ3  H  10.081  -0.449  -0.581 1.00 . A A . 39 LYS HZ3  1 1 
        8  8030 1 1 39 LYS N    N   7.400  -5.739  -3.409 1.00 . A A . 39 LYS N    1 1 
        8  8031 1 1 39 LYS NZ   N   9.980  -1.426  -0.240 1.00 . A A . 39 LYS NZ   1 1 
        8  8032 1 1 39 LYS O    O   6.358  -3.393  -4.944 1.00 . A A . 39 LYS O    1 1 
        8  8033 1 1 40 ILE C    C   4.028  -1.064  -2.390 1.00 . A A . 40 ILE C    1 1 
        8  8034 1 1 40 ILE CA   C   4.430  -2.131  -3.403 1.00 . A A . 40 ILE CA   1 1 
        8  8035 1 1 40 ILE CB   C   3.199  -2.999  -3.737 1.00 . A A . 40 ILE CB   1 1 
        8  8036 1 1 40 ILE CD1  C   2.408  -4.962  -5.152 1.00 . A A . 40 ILE CD1  1 1 
        8  8037 1 1 40 ILE CG1  C   3.580  -4.106  -4.720 1.00 . A A . 40 ILE CG1  1 1 
        8  8038 1 1 40 ILE CG2  C   2.077  -2.139  -4.303 1.00 . A A . 40 ILE CG2  1 1 
        8  8039 1 1 40 ILE H    H   5.627  -3.070  -1.932 1.00 . A A . 40 ILE H    1 1 
        8  8040 1 1 40 ILE HA   H   4.759  -1.646  -4.311 1.00 . A A . 40 ILE HA   1 1 
        8  8041 1 1 40 ILE HB   H   2.845  -3.447  -2.820 1.00 . A A . 40 ILE HB   1 1 
        8  8042 1 1 40 ILE HD11 H   1.981  -5.448  -4.288 1.00 . A A . 40 ILE HD11 1 1 
        8  8043 1 1 40 ILE HD12 H   2.747  -5.707  -5.855 1.00 . A A . 40 ILE HD12 1 1 
        8  8044 1 1 40 ILE HD13 H   1.662  -4.337  -5.620 1.00 . A A . 40 ILE HD13 1 1 
        8  8045 1 1 40 ILE HG12 H   4.009  -3.661  -5.606 1.00 . A A . 40 ILE HG12 1 1 
        8  8046 1 1 40 ILE HG13 H   4.311  -4.754  -4.258 1.00 . A A . 40 ILE HG13 1 1 
        8  8047 1 1 40 ILE HG21 H   2.463  -1.529  -5.107 1.00 . A A . 40 ILE HG21 1 1 
        8  8048 1 1 40 ILE HG22 H   1.684  -1.502  -3.526 1.00 . A A . 40 ILE HG22 1 1 
        8  8049 1 1 40 ILE HG23 H   1.290  -2.775  -4.680 1.00 . A A . 40 ILE HG23 1 1 
        8  8050 1 1 40 ILE N    N   5.531  -2.942  -2.900 1.00 . A A . 40 ILE N    1 1 
        8  8051 1 1 40 ILE O    O   4.300  -1.193  -1.197 1.00 . A A . 40 ILE O    1 1 
        8  8052 1 1 41 PHE C    C   1.600   1.640  -2.483 1.00 . A A . 41 PHE C    1 1 
        8  8053 1 1 41 PHE CA   C   2.936   1.079  -2.010 1.00 . A A . 41 PHE CA   1 1 
        8  8054 1 1 41 PHE CB   C   3.983   2.194  -1.976 1.00 . A A . 41 PHE CB   1 1 
        8  8055 1 1 41 PHE CD1  C   6.173   0.971  -2.029 1.00 . A A . 41 PHE CD1  1 1 
        8  8056 1 1 41 PHE CD2  C   5.616   2.212  -0.070 1.00 . A A . 41 PHE CD2  1 1 
        8  8057 1 1 41 PHE CE1  C   7.370   0.592  -1.452 1.00 . A A . 41 PHE CE1  1 1 
        8  8058 1 1 41 PHE CE2  C   6.812   1.837   0.512 1.00 . A A . 41 PHE CE2  1 1 
        8  8059 1 1 41 PHE CG   C   5.283   1.784  -1.345 1.00 . A A . 41 PHE CG   1 1 
        8  8060 1 1 41 PHE CZ   C   7.691   1.025  -0.180 1.00 . A A . 41 PHE CZ   1 1 
        8  8061 1 1 41 PHE H    H   3.188   0.033  -3.836 1.00 . A A . 41 PHE H    1 1 
        8  8062 1 1 41 PHE HA   H   2.813   0.679  -1.015 1.00 . A A . 41 PHE HA   1 1 
        8  8063 1 1 41 PHE HB2  H   4.191   2.513  -2.986 1.00 . A A . 41 PHE HB2  1 1 
        8  8064 1 1 41 PHE HB3  H   3.588   3.030  -1.414 1.00 . A A . 41 PHE HB3  1 1 
        8  8065 1 1 41 PHE HD1  H   5.924   0.631  -3.023 1.00 . A A . 41 PHE HD1  1 1 
        8  8066 1 1 41 PHE HD2  H   4.930   2.848   0.472 1.00 . A A . 41 PHE HD2  1 1 
        8  8067 1 1 41 PHE HE1  H   8.056  -0.043  -1.995 1.00 . A A . 41 PHE HE1  1 1 
        8  8068 1 1 41 PHE HE2  H   7.060   2.177   1.506 1.00 . A A . 41 PHE HE2  1 1 
        8  8069 1 1 41 PHE HZ   H   8.625   0.730   0.273 1.00 . A A . 41 PHE HZ   1 1 
        8  8070 1 1 41 PHE N    N   3.377  -0.011  -2.875 1.00 . A A . 41 PHE N    1 1 
        8  8071 1 1 41 PHE O    O   1.440   1.982  -3.655 1.00 . A A . 41 PHE O    1 1 
        8  8072 1 1 42 LEU C    C  -0.800   3.722  -1.469 1.00 . A A . 42 LEU C    1 1 
        8  8073 1 1 42 LEU CA   C  -0.674   2.264  -1.892 1.00 . A A . 42 LEU CA   1 1 
        8  8074 1 1 42 LEU CB   C  -1.779   1.431  -1.229 1.00 . A A . 42 LEU CB   1 1 
        8  8075 1 1 42 LEU CD1  C  -0.444  -0.479  -0.269 1.00 . A A . 42 LEU CD1  1 1 
        8  8076 1 1 42 LEU CD2  C  -0.771   1.620   1.075 1.00 . A A . 42 LEU CD2  1 1 
        8  8077 1 1 42 LEU CG   C  -1.385   0.676   0.047 1.00 . A A . 42 LEU CG   1 1 
        8  8078 1 1 42 LEU H    H   0.830   1.454  -0.649 1.00 . A A . 42 LEU H    1 1 
        8  8079 1 1 42 LEU HA   H  -0.792   2.206  -2.963 1.00 . A A . 42 LEU HA   1 1 
        8  8080 1 1 42 LEU HB2  H  -2.595   2.094  -0.983 1.00 . A A . 42 LEU HB2  1 1 
        8  8081 1 1 42 LEU HB3  H  -2.133   0.709  -1.949 1.00 . A A . 42 LEU HB3  1 1 
        8  8082 1 1 42 LEU HD11 H  -0.174  -0.447  -1.315 1.00 . A A . 42 LEU HD11 1 1 
        8  8083 1 1 42 LEU HD12 H  -0.939  -1.414  -0.054 1.00 . A A . 42 LEU HD12 1 1 
        8  8084 1 1 42 LEU HD13 H   0.447  -0.395   0.336 1.00 . A A . 42 LEU HD13 1 1 
        8  8085 1 1 42 LEU HD21 H  -1.263   1.483   2.026 1.00 . A A . 42 LEU HD21 1 1 
        8  8086 1 1 42 LEU HD22 H  -0.897   2.641   0.750 1.00 . A A . 42 LEU HD22 1 1 
        8  8087 1 1 42 LEU HD23 H   0.283   1.404   1.181 1.00 . A A . 42 LEU HD23 1 1 
        8  8088 1 1 42 LEU HG   H  -2.273   0.258   0.480 1.00 . A A . 42 LEU HG   1 1 
        8  8089 1 1 42 LEU N    N   0.643   1.738  -1.565 1.00 . A A . 42 LEU N    1 1 
        8  8090 1 1 42 LEU O    O  -0.091   4.185  -0.577 1.00 . A A . 42 LEU O    1 1 
        8  8091 1 1 43 THR C    C  -3.367   6.062  -1.309 1.00 . A A . 43 THR C    1 1 
        8  8092 1 1 43 THR CA   C  -1.941   5.845  -1.802 1.00 . A A . 43 THR CA   1 1 
        8  8093 1 1 43 THR CB   C  -1.674   6.713  -3.032 1.00 . A A . 43 THR CB   1 1 
        8  8094 1 1 43 THR CG2  C  -1.431   8.168  -2.696 1.00 . A A . 43 THR CG2  1 1 
        8  8095 1 1 43 THR H    H  -2.250   4.012  -2.812 1.00 . A A . 43 THR H    1 1 
        8  8096 1 1 43 THR HA   H  -1.255   6.126  -1.017 1.00 . A A . 43 THR HA   1 1 
        8  8097 1 1 43 THR HB   H  -2.531   6.663  -3.687 1.00 . A A . 43 THR HB   1 1 
        8  8098 1 1 43 THR HG1  H   0.242   6.343  -3.199 1.00 . A A . 43 THR HG1  1 1 
        8  8099 1 1 43 THR HG21 H  -1.368   8.743  -3.609 1.00 . A A . 43 THR HG21 1 1 
        8  8100 1 1 43 THR HG22 H  -0.505   8.261  -2.149 1.00 . A A . 43 THR HG22 1 1 
        8  8101 1 1 43 THR HG23 H  -2.244   8.539  -2.092 1.00 . A A . 43 THR HG23 1 1 
        8  8102 1 1 43 THR N    N  -1.714   4.439  -2.112 1.00 . A A . 43 THR N    1 1 
        8  8103 1 1 43 THR O    O  -4.314   6.056  -2.096 1.00 . A A . 43 THR O    1 1 
        8  8104 1 1 43 THR OG1  O  -0.543   6.240  -3.742 1.00 . A A . 43 THR OG1  1 1 
        8  8105 1 1 44 ILE C    C  -5.251   7.921   0.485 1.00 . A A . 44 ILE C    1 1 
        8  8106 1 1 44 ILE CA   C  -4.824   6.461   0.599 1.00 . A A . 44 ILE CA   1 1 
        8  8107 1 1 44 ILE CB   C  -4.837   6.051   2.084 1.00 . A A . 44 ILE CB   1 1 
        8  8108 1 1 44 ILE CD1  C  -4.034   4.259   3.703 1.00 . A A . 44 ILE CD1  1 1 
        8  8109 1 1 44 ILE CG1  C  -4.229   4.659   2.256 1.00 . A A . 44 ILE CG1  1 1 
        8  8110 1 1 44 ILE CG2  C  -6.257   6.087   2.629 1.00 . A A . 44 ILE CG2  1 1 
        8  8111 1 1 44 ILE H    H  -2.720   6.238   0.574 1.00 . A A . 44 ILE H    1 1 
        8  8112 1 1 44 ILE HA   H  -5.537   5.847   0.071 1.00 . A A . 44 ILE HA   1 1 
        8  8113 1 1 44 ILE HB   H  -4.247   6.766   2.638 1.00 . A A . 44 ILE HB   1 1 
        8  8114 1 1 44 ILE HD11 H  -3.335   3.438   3.758 1.00 . A A . 44 ILE HD11 1 1 
        8  8115 1 1 44 ILE HD12 H  -4.982   3.955   4.122 1.00 . A A . 44 ILE HD12 1 1 
        8  8116 1 1 44 ILE HD13 H  -3.647   5.100   4.259 1.00 . A A . 44 ILE HD13 1 1 
        8  8117 1 1 44 ILE HG12 H  -4.879   3.930   1.796 1.00 . A A . 44 ILE HG12 1 1 
        8  8118 1 1 44 ILE HG13 H  -3.264   4.631   1.770 1.00 . A A . 44 ILE HG13 1 1 
        8  8119 1 1 44 ILE HG21 H  -6.867   5.376   2.093 1.00 . A A . 44 ILE HG21 1 1 
        8  8120 1 1 44 ILE HG22 H  -6.666   7.080   2.505 1.00 . A A . 44 ILE HG22 1 1 
        8  8121 1 1 44 ILE HG23 H  -6.245   5.830   3.679 1.00 . A A . 44 ILE HG23 1 1 
        8  8122 1 1 44 ILE N    N  -3.513   6.248  -0.001 1.00 . A A . 44 ILE N    1 1 
        8  8123 1 1 44 ILE O    O  -4.640   8.807   1.082 1.00 . A A . 44 ILE O    1 1 
        8  8124 1 1 45 ASN C    C  -7.739   9.914   0.672 1.00 . A A . 45 ASN C    1 1 
        8  8125 1 1 45 ASN CA   C  -6.818   9.515  -0.477 1.00 . A A . 45 ASN CA   1 1 
        8  8126 1 1 45 ASN CB   C  -7.568   9.614  -1.806 1.00 . A A . 45 ASN CB   1 1 
        8  8127 1 1 45 ASN CG   C  -6.733   9.137  -2.979 1.00 . A A . 45 ASN CG   1 1 
        8  8128 1 1 45 ASN H    H  -6.752   7.413  -0.734 1.00 . A A . 45 ASN H    1 1 
        8  8129 1 1 45 ASN HA   H  -5.975  10.188  -0.498 1.00 . A A . 45 ASN HA   1 1 
        8  8130 1 1 45 ASN HB2  H  -8.461   9.008  -1.756 1.00 . A A . 45 ASN HB2  1 1 
        8  8131 1 1 45 ASN HB3  H  -7.847  10.643  -1.980 1.00 . A A . 45 ASN HB3  1 1 
        8  8132 1 1 45 ASN HD21 H  -8.342   9.132  -4.151 1.00 . A A . 45 ASN HD21 1 1 
        8  8133 1 1 45 ASN HD22 H  -6.856   8.643  -4.903 1.00 . A A . 45 ASN HD22 1 1 
        8  8134 1 1 45 ASN N    N  -6.306   8.163  -0.286 1.00 . A A . 45 ASN N    1 1 
        8  8135 1 1 45 ASN ND2  N  -7.375   8.952  -4.126 1.00 . A A . 45 ASN ND2  1 1 
        8  8136 1 1 45 ASN O    O  -8.048   9.102   1.544 1.00 . A A . 45 ASN O    1 1 
        8  8137 1 1 45 ASN OD1  O  -5.524   8.939  -2.854 1.00 . A A . 45 ASN OD1  1 1 
        8  8138 1 1 46 ALA C    C -10.520  11.349   1.412 1.00 . A A . 46 ALA C    1 1 
        8  8139 1 1 46 ALA CA   C  -9.061  11.676   1.711 1.00 . A A . 46 ALA CA   1 1 
        8  8140 1 1 46 ALA CB   C  -8.879  13.179   1.869 1.00 . A A . 46 ALA CB   1 1 
        8  8141 1 1 46 ALA H    H  -7.893  11.771  -0.054 1.00 . A A . 46 ALA H    1 1 
        8  8142 1 1 46 ALA HA   H  -8.780  11.206   2.642 1.00 . A A . 46 ALA HA   1 1 
        8  8143 1 1 46 ALA HB1  H  -8.865  13.645   0.895 1.00 . A A . 46 ALA HB1  1 1 
        8  8144 1 1 46 ALA HB2  H  -7.948  13.378   2.377 1.00 . A A . 46 ALA HB2  1 1 
        8  8145 1 1 46 ALA HB3  H  -9.697  13.581   2.448 1.00 . A A . 46 ALA HB3  1 1 
        8  8146 1 1 46 ALA N    N  -8.174  11.171   0.667 1.00 . A A . 46 ALA N    1 1 
        8  8147 1 1 46 ALA O    O -11.420  11.749   2.154 1.00 . A A . 46 ALA O    1 1 
        8  8148 1 1 47 ASP C    C -12.350   8.753   0.165 1.00 . A A . 47 ASP C    1 1 
        8  8149 1 1 47 ASP CA   C -12.110  10.242  -0.068 1.00 . A A . 47 ASP CA   1 1 
        8  8150 1 1 47 ASP CB   C -12.350  10.579  -1.543 1.00 . A A . 47 ASP CB   1 1 
        8  8151 1 1 47 ASP CG   C -11.070  10.737  -2.345 1.00 . A A . 47 ASP CG   1 1 
        8  8152 1 1 47 ASP H    H -10.010  10.328  -0.232 1.00 . A A . 47 ASP H    1 1 
        8  8153 1 1 47 ASP HA   H -12.800  10.805   0.541 1.00 . A A . 47 ASP HA   1 1 
        8  8154 1 1 47 ASP HB2  H -12.930   9.784  -1.990 1.00 . A A . 47 ASP HB2  1 1 
        8  8155 1 1 47 ASP HB3  H -12.910  11.502  -1.603 1.00 . A A . 47 ASP HB3  1 1 
        8  8156 1 1 47 ASP N    N -10.750  10.620   0.324 1.00 . A A . 47 ASP N    1 1 
        8  8157 1 1 47 ASP O    O -13.490   8.301   0.216 1.00 . A A . 47 ASP O    1 1 
        8  8158 1 1 47 ASP OD1  O -10.510   9.709  -2.768 1.00 . A A . 47 ASP OD1  1 1 
        8  8159 1 1 47 ASP OD2  O -10.640  11.891  -2.547 1.00 . A A . 47 ASP OD2  1 1 
        8  8160 1 1 48 GLY C    C -10.820   5.762  -0.644 1.00 . A A . 48 GLY C    1 1 
        8  8161 1 1 48 GLY CA   C -11.380   6.566   0.515 1.00 . A A . 48 GLY CA   1 1 
        8  8162 1 1 48 GLY H    H -10.380   8.409   0.244 1.00 . A A . 48 GLY H    1 1 
        8  8163 1 1 48 GLY HA2  H -10.840   6.304   1.416 1.00 . A A . 48 GLY HA2  1 1 
        8  8164 1 1 48 GLY HA3  H -12.430   6.315   0.642 1.00 . A A . 48 GLY HA3  1 1 
        8  8165 1 1 48 GLY N    N -11.270   7.996   0.300 1.00 . A A . 48 GLY N    1 1 
        8  8166 1 1 48 GLY O    O -11.020   4.550  -0.718 1.00 . A A . 48 GLY O    1 1 
        8  8167 1 1 49 SER C    C  -8.089   5.381  -2.418 1.00 . A A . 49 SER C    1 1 
        8  8168 1 1 49 SER CA   C  -9.531   5.780  -2.705 1.00 . A A . 49 SER CA   1 1 
        8  8169 1 1 49 SER CB   C  -9.591   6.693  -3.926 1.00 . A A . 49 SER CB   1 1 
        8  8170 1 1 49 SER H    H  -9.999   7.406  -1.436 1.00 . A A . 49 SER H    1 1 
        8  8171 1 1 49 SER HA   H -10.100   4.893  -2.909 1.00 . A A . 49 SER HA   1 1 
        8  8172 1 1 49 SER HB2  H -10.020   7.637  -3.641 1.00 . A A . 49 SER HB2  1 1 
        8  8173 1 1 49 SER HB3  H  -8.592   6.851  -4.303 1.00 . A A . 49 SER HB3  1 1 
        8  8174 1 1 49 SER HG   H -10.220   6.590  -5.776 1.00 . A A . 49 SER HG   1 1 
        8  8175 1 1 49 SER N    N -10.120   6.440  -1.549 1.00 . A A . 49 SER N    1 1 
        8  8176 1 1 49 SER O    O  -7.251   6.224  -2.099 1.00 . A A . 49 SER O    1 1 
        8  8177 1 1 49 SER OG   O -10.380   6.121  -4.953 1.00 . A A . 49 SER OG   1 1 
        8  8178 1 1 50 VAL C    C  -5.924   2.848  -3.503 1.00 . A A . 50 VAL C    1 1 
        8  8179 1 1 50 VAL CA   C  -6.469   3.572  -2.277 1.00 . A A . 50 VAL CA   1 1 
        8  8180 1 1 50 VAL CB   C  -6.450   2.607  -1.075 1.00 . A A . 50 VAL CB   1 1 
        8  8181 1 1 50 VAL CG1  C  -5.052   2.524  -0.484 1.00 . A A . 50 VAL CG1  1 1 
        8  8182 1 1 50 VAL CG2  C  -7.455   3.038  -0.016 1.00 . A A . 50 VAL CG2  1 1 
        8  8183 1 1 50 VAL H    H  -8.522   3.465  -2.784 1.00 . A A . 50 VAL H    1 1 
        8  8184 1 1 50 VAL HA   H  -5.825   4.408  -2.050 1.00 . A A . 50 VAL HA   1 1 
        8  8185 1 1 50 VAL HB   H  -6.725   1.623  -1.426 1.00 . A A . 50 VAL HB   1 1 
        8  8186 1 1 50 VAL HG11 H  -4.525   1.693  -0.926 1.00 . A A . 50 VAL HG11 1 1 
        8  8187 1 1 50 VAL HG12 H  -5.122   2.382   0.583 1.00 . A A . 50 VAL HG12 1 1 
        8  8188 1 1 50 VAL HG13 H  -4.521   3.441  -0.693 1.00 . A A . 50 VAL HG13 1 1 
        8  8189 1 1 50 VAL HG21 H  -7.287   2.473   0.889 1.00 . A A . 50 VAL HG21 1 1 
        8  8190 1 1 50 VAL HG22 H  -8.457   2.851  -0.374 1.00 . A A . 50 VAL HG22 1 1 
        8  8191 1 1 50 VAL HG23 H  -7.335   4.091   0.188 1.00 . A A . 50 VAL HG23 1 1 
        8  8192 1 1 50 VAL N    N  -7.809   4.088  -2.530 1.00 . A A . 50 VAL N    1 1 
        8  8193 1 1 50 VAL O    O  -6.315   1.716  -3.791 1.00 . A A . 50 VAL O    1 1 
        8  8194 1 1 51 TYR C    C  -2.990   2.480  -5.155 1.00 . A A . 51 TYR C    1 1 
        8  8195 1 1 51 TYR CA   C  -4.427   2.918  -5.418 1.00 . A A . 51 TYR CA   1 1 
        8  8196 1 1 51 TYR CB   C  -4.471   3.913  -6.582 1.00 . A A . 51 TYR CB   1 1 
        8  8197 1 1 51 TYR CD1  C  -2.205   5.024  -6.519 1.00 . A A . 51 TYR CD1  1 1 
        8  8198 1 1 51 TYR CD2  C  -4.125   6.364  -6.076 1.00 . A A . 51 TYR CD2  1 1 
        8  8199 1 1 51 TYR CE1  C  -1.390   6.127  -6.344 1.00 . A A . 51 TYR CE1  1 1 
        8  8200 1 1 51 TYR CE2  C  -3.318   7.471  -5.900 1.00 . A A . 51 TYR CE2  1 1 
        8  8201 1 1 51 TYR CG   C  -3.583   5.123  -6.388 1.00 . A A . 51 TYR CG   1 1 
        8  8202 1 1 51 TYR CZ   C  -1.951   7.348  -6.035 1.00 . A A . 51 TYR CZ   1 1 
        8  8203 1 1 51 TYR H    H  -4.750   4.406  -3.945 1.00 . A A . 51 TYR H    1 1 
        8  8204 1 1 51 TYR HA   H  -5.011   2.049  -5.682 1.00 . A A . 51 TYR HA   1 1 
        8  8205 1 1 51 TYR HB2  H  -4.153   3.413  -7.484 1.00 . A A . 51 TYR HB2  1 1 
        8  8206 1 1 51 TYR HB3  H  -5.485   4.263  -6.709 1.00 . A A . 51 TYR HB3  1 1 
        8  8207 1 1 51 TYR HD1  H  -1.768   4.067  -6.761 1.00 . A A . 51 TYR HD1  1 1 
        8  8208 1 1 51 TYR HD2  H  -5.196   6.456  -5.970 1.00 . A A . 51 TYR HD2  1 1 
        8  8209 1 1 51 TYR HE1  H  -0.319   6.029  -6.451 1.00 . A A . 51 TYR HE1  1 1 
        8  8210 1 1 51 TYR HE2  H  -3.758   8.427  -5.657 1.00 . A A . 51 TYR HE2  1 1 
        8  8211 1 1 51 TYR HH   H  -0.631   8.597  -6.659 1.00 . A A . 51 TYR HH   1 1 
        8  8212 1 1 51 TYR N    N  -5.022   3.506  -4.224 1.00 . A A . 51 TYR N    1 1 
        8  8213 1 1 51 TYR O    O  -2.253   3.142  -4.425 1.00 . A A . 51 TYR O    1 1 
        8  8214 1 1 51 TYR OH   O  -1.144   8.448  -5.861 1.00 . A A . 51 TYR OH   1 1 
        8  8215 1 1 52 ALA C    C  -0.332   1.291  -6.705 1.00 . A A . 52 ALA C    1 1 
        8  8216 1 1 52 ALA CA   C  -1.254   0.828  -5.582 1.00 . A A . 52 ALA CA   1 1 
        8  8217 1 1 52 ALA CB   C  -1.291  -0.692  -5.517 1.00 . A A . 52 ALA CB   1 1 
        8  8218 1 1 52 ALA H    H  -3.236   0.875  -6.321 1.00 . A A . 52 ALA H    1 1 
        8  8219 1 1 52 ALA HA   H  -0.869   1.195  -4.642 1.00 . A A . 52 ALA HA   1 1 
        8  8220 1 1 52 ALA HB1  H  -0.418  -1.095  -6.009 1.00 . A A . 52 ALA HB1  1 1 
        8  8221 1 1 52 ALA HB2  H  -2.181  -1.051  -6.011 1.00 . A A . 52 ALA HB2  1 1 
        8  8222 1 1 52 ALA HB3  H  -1.300  -1.007  -4.484 1.00 . A A . 52 ALA HB3  1 1 
        8  8223 1 1 52 ALA N    N  -2.602   1.359  -5.753 1.00 . A A . 52 ALA N    1 1 
        8  8224 1 1 52 ALA O    O  -0.793   1.749  -7.751 1.00 . A A . 52 ALA O    1 1 
        8  8225 1 1 53 GLU C    C   3.297   0.876  -7.218 1.00 . A A . 53 GLU C    1 1 
        8  8226 1 1 53 GLU CA   C   1.962   1.568  -7.473 1.00 . A A . 53 GLU CA   1 1 
        8  8227 1 1 53 GLU CB   C   2.148   3.086  -7.449 1.00 . A A . 53 GLU CB   1 1 
        8  8228 1 1 53 GLU CD   C   3.614   4.799  -6.313 1.00 . A A . 53 GLU CD   1 1 
        8  8229 1 1 53 GLU CG   C   2.691   3.611  -6.131 1.00 . A A . 53 GLU CG   1 1 
        8  8230 1 1 53 GLU H    H   1.275   0.792  -5.627 1.00 . A A . 53 GLU H    1 1 
        8  8231 1 1 53 GLU HA   H   1.596   1.273  -8.445 1.00 . A A . 53 GLU HA   1 1 
        8  8232 1 1 53 GLU HB2  H   2.836   3.364  -8.235 1.00 . A A . 53 GLU HB2  1 1 
        8  8233 1 1 53 GLU HB3  H   1.194   3.558  -7.636 1.00 . A A . 53 GLU HB3  1 1 
        8  8234 1 1 53 GLU HG2  H   1.862   3.912  -5.508 1.00 . A A . 53 GLU HG2  1 1 
        8  8235 1 1 53 GLU HG3  H   3.239   2.820  -5.640 1.00 . A A . 53 GLU HG3  1 1 
        8  8236 1 1 53 GLU N    N   0.971   1.164  -6.481 1.00 . A A . 53 GLU N    1 1 
        8  8237 1 1 53 GLU O    O   3.449   0.138  -6.246 1.00 . A A . 53 GLU O    1 1 
        8  8238 1 1 53 GLU OE1  O   4.470   4.754  -7.222 1.00 . A A . 53 GLU OE1  1 1 
        8  8239 1 1 53 GLU OE2  O   3.483   5.777  -5.544 1.00 . A A . 53 GLU OE2  1 1 
        8  8240 1 1 54 GLU C    C   6.670   1.601  -7.950 1.00 . A A . 54 GLU C    1 1 
        8  8241 1 1 54 GLU CA   C   5.588   0.525  -7.965 1.00 . A A . 54 GLU CA   1 1 
        8  8242 1 1 54 GLU CB   C   5.843  -0.459  -9.109 1.00 . A A . 54 GLU CB   1 1 
        8  8243 1 1 54 GLU CD   C   7.989  -1.424  -8.191 1.00 . A A . 54 GLU CD   1 1 
        8  8244 1 1 54 GLU CG   C   6.582  -1.714  -8.676 1.00 . A A . 54 GLU CG   1 1 
        8  8245 1 1 54 GLU H    H   4.083   1.722  -8.851 1.00 . A A . 54 GLU H    1 1 
        8  8246 1 1 54 GLU HA   H   5.617  -0.012  -7.029 1.00 . A A . 54 GLU HA   1 1 
        8  8247 1 1 54 GLU HB2  H   4.895  -0.753  -9.534 1.00 . A A . 54 GLU HB2  1 1 
        8  8248 1 1 54 GLU HB3  H   6.431   0.035  -9.870 1.00 . A A . 54 GLU HB3  1 1 
        8  8249 1 1 54 GLU HG2  H   6.032  -2.183  -7.874 1.00 . A A . 54 GLU HG2  1 1 
        8  8250 1 1 54 GLU HG3  H   6.639  -2.391  -9.516 1.00 . A A . 54 GLU HG3  1 1 
        8  8251 1 1 54 GLU N    N   4.264   1.123  -8.097 1.00 . A A . 54 GLU N    1 1 
        8  8252 1 1 54 GLU O    O   6.654   2.522  -8.765 1.00 . A A . 54 GLU O    1 1 
        8  8253 1 1 54 GLU OE1  O   8.657  -0.555  -8.791 1.00 . A A . 54 GLU OE1  1 1 
        8  8254 1 1 54 GLU OE2  O   8.424  -2.065  -7.211 1.00 . A A . 54 GLU OE2  1 1 
        8  8255 1 1 55 VAL C    C   9.894   1.824  -6.172 1.00 . A A . 55 VAL C    1 1 
        8  8256 1 1 55 VAL CA   C   8.697   2.435  -6.896 1.00 . A A . 55 VAL CA   1 1 
        8  8257 1 1 55 VAL CB   C   8.243   3.705  -6.146 1.00 . A A . 55 VAL CB   1 1 
        8  8258 1 1 55 VAL CG1  C   7.794   3.365  -4.733 1.00 . A A . 55 VAL CG1  1 1 
        8  8259 1 1 55 VAL CG2  C   9.355   4.743  -6.126 1.00 . A A . 55 VAL CG2  1 1 
        8  8260 1 1 55 VAL H    H   7.566   0.718  -6.396 1.00 . A A . 55 VAL H    1 1 
        8  8261 1 1 55 VAL HA   H   9.000   2.722  -7.893 1.00 . A A . 55 VAL HA   1 1 
        8  8262 1 1 55 VAL HB   H   7.398   4.126  -6.674 1.00 . A A . 55 VAL HB   1 1 
        8  8263 1 1 55 VAL HG11 H   8.566   3.646  -4.031 1.00 . A A . 55 VAL HG11 1 1 
        8  8264 1 1 55 VAL HG12 H   7.610   2.304  -4.659 1.00 . A A . 55 VAL HG12 1 1 
        8  8265 1 1 55 VAL HG13 H   6.885   3.904  -4.504 1.00 . A A . 55 VAL HG13 1 1 
        8  8266 1 1 55 VAL HG21 H   8.981   5.666  -5.707 1.00 . A A . 55 VAL HG21 1 1 
        8  8267 1 1 55 VAL HG22 H   9.702   4.919  -7.134 1.00 . A A . 55 VAL HG22 1 1 
        8  8268 1 1 55 VAL HG23 H  10.175   4.381  -5.521 1.00 . A A . 55 VAL HG23 1 1 
        8  8269 1 1 55 VAL N    N   7.608   1.475  -7.018 1.00 . A A . 55 VAL N    1 1 
        8  8270 1 1 55 VAL O    O   9.844   1.579  -4.967 1.00 . A A . 55 VAL O    1 1 
        8  8271 1 1 56 LYS C    C  13.414   1.458  -7.112 1.00 . A A . 56 LYS C    1 1 
        8  8272 1 1 56 LYS CA   C  12.175   0.997  -6.348 1.00 . A A . 56 LYS CA   1 1 
        8  8273 1 1 56 LYS CB   C  12.088  -0.531  -6.368 1.00 . A A . 56 LYS CB   1 1 
        8  8274 1 1 56 LYS CD   C  13.183  -2.622  -5.505 1.00 . A A . 56 LYS CD   1 1 
        8  8275 1 1 56 LYS CE   C  13.630  -3.367  -4.258 1.00 . A A . 56 LYS CE   1 1 
        8  8276 1 1 56 LYS CG   C  12.772  -1.194  -5.185 1.00 . A A . 56 LYS CG   1 1 
        8  8277 1 1 56 LYS H    H  10.944   1.796  -7.872 1.00 . A A . 56 LYS H    1 1 
        8  8278 1 1 56 LYS HA   H  12.253   1.330  -5.325 1.00 . A A . 56 LYS HA   1 1 
        8  8279 1 1 56 LYS HB2  H  11.048  -0.821  -6.365 1.00 . A A . 56 LYS HB2  1 1 
        8  8280 1 1 56 LYS HB3  H  12.551  -0.894  -7.273 1.00 . A A . 56 LYS HB3  1 1 
        8  8281 1 1 56 LYS HD2  H  12.341  -3.140  -5.939 1.00 . A A . 56 LYS HD2  1 1 
        8  8282 1 1 56 LYS HD3  H  13.999  -2.600  -6.212 1.00 . A A . 56 LYS HD3  1 1 
        8  8283 1 1 56 LYS HE2  H  13.939  -2.647  -3.515 1.00 . A A . 56 LYS HE2  1 1 
        8  8284 1 1 56 LYS HE3  H  12.797  -3.939  -3.878 1.00 . A A . 56 LYS HE3  1 1 
        8  8285 1 1 56 LYS HG2  H  13.652  -0.628  -4.924 1.00 . A A . 56 LYS HG2  1 1 
        8  8286 1 1 56 LYS HG3  H  12.090  -1.206  -4.347 1.00 . A A . 56 LYS HG3  1 1 
        8  8287 1 1 56 LYS HZ1  H  14.425  -5.273  -4.574 1.00 . A A . 56 LYS HZ1  1 1 
        8  8288 1 1 56 LYS HZ2  H  15.482  -4.212  -3.787 1.00 . A A . 56 LYS HZ2  1 1 
        8  8289 1 1 56 LYS HZ3  H  15.206  -4.052  -5.448 1.00 . A A . 56 LYS HZ3  1 1 
        8  8290 1 1 56 LYS N    N  10.966   1.580  -6.918 1.00 . A A . 56 LYS N    1 1 
        8  8291 1 1 56 LYS NZ   N  14.765  -4.290  -4.536 1.00 . A A . 56 LYS NZ   1 1 
        8  8292 1 1 56 LYS O    O  13.952   0.725  -7.941 1.00 . A A . 56 LYS O    1 1 
        8  8293 1 1 57 PRO C    C  16.362   2.617  -7.012 1.00 . A A . 57 PRO C    1 1 
        8  8294 1 1 57 PRO CA   C  15.064   3.247  -7.506 1.00 . A A . 57 PRO CA   1 1 
        8  8295 1 1 57 PRO CB   C  15.010   4.728  -7.130 1.00 . A A . 57 PRO CB   1 1 
        8  8296 1 1 57 PRO CD   C  13.300   3.630  -5.866 1.00 . A A . 57 PRO CD   1 1 
        8  8297 1 1 57 PRO CG   C  14.296   4.758  -5.823 1.00 . A A . 57 PRO CG   1 1 
        8  8298 1 1 57 PRO HA   H  14.999   3.142  -8.580 1.00 . A A . 57 PRO HA   1 1 
        8  8299 1 1 57 PRO HB2  H  16.015   5.116  -7.041 1.00 . A A . 57 PRO HB2  1 1 
        8  8300 1 1 57 PRO HB3  H  14.472   5.276  -7.888 1.00 . A A . 57 PRO HB3  1 1 
        8  8301 1 1 57 PRO HD2  H  13.209   3.169  -4.893 1.00 . A A . 57 PRO HD2  1 1 
        8  8302 1 1 57 PRO HD3  H  12.339   3.988  -6.205 1.00 . A A . 57 PRO HD3  1 1 
        8  8303 1 1 57 PRO HG2  H  14.999   4.606  -5.017 1.00 . A A . 57 PRO HG2  1 1 
        8  8304 1 1 57 PRO HG3  H  13.787   5.702  -5.706 1.00 . A A . 57 PRO HG3  1 1 
        8  8305 1 1 57 PRO N    N  13.884   2.688  -6.841 1.00 . A A . 57 PRO N    1 1 
        8  8306 1 1 57 PRO O    O  16.542   2.399  -5.815 1.00 . A A . 57 PRO O    1 1 
        8  8307 1 1 58 ASP C    C  18.377   0.515  -6.702 1.00 . A A . 58 ASP C    1 1 
        8  8308 1 1 58 ASP CA   C  18.555   1.731  -7.610 1.00 . A A . 58 ASP CA   1 1 
        8  8309 1 1 58 ASP CB   C  19.456   2.769  -6.937 1.00 . A A . 58 ASP CB   1 1 
        8  8310 1 1 58 ASP CG   C  20.778   2.185  -6.475 1.00 . A A . 58 ASP CG   1 1 
        8  8311 1 1 58 ASP H    H  17.067   2.534  -8.880 1.00 . A A . 58 ASP H    1 1 
        8  8312 1 1 58 ASP HA   H  19.019   1.411  -8.532 1.00 . A A . 58 ASP HA   1 1 
        8  8313 1 1 58 ASP HB2  H  19.664   3.565  -7.640 1.00 . A A . 58 ASP HB2  1 1 
        8  8314 1 1 58 ASP HB3  H  18.939   3.175  -6.078 1.00 . A A . 58 ASP HB3  1 1 
        8  8315 1 1 58 ASP N    N  17.267   2.332  -7.945 1.00 . A A . 58 ASP N    1 1 
        8  8316 1 1 58 ASP O    O  18.702   0.563  -5.515 1.00 . A A . 58 ASP O    1 1 
        8  8317 1 1 58 ASP OD1  O  21.380   1.402  -7.237 1.00 . A A . 58 ASP OD1  1 1 
        8  8318 1 1 58 ASP OD2  O  21.208   2.511  -5.349 1.00 . A A . 58 ASP OD2  1 1 
        8  8319 1 1 59 PRO C    C  18.916  -2.329  -5.818 1.00 . A A . 59 PRO C    1 1 
        8  8320 1 1 59 PRO CA   C  17.638  -1.829  -6.484 1.00 . A A . 59 PRO CA   1 1 
        8  8321 1 1 59 PRO CB   C  17.160  -2.833  -7.539 1.00 . A A . 59 PRO CB   1 1 
        8  8322 1 1 59 PRO CD   C  17.444  -0.741  -8.658 1.00 . A A . 59 PRO CD   1 1 
        8  8323 1 1 59 PRO CG   C  16.616  -1.996  -8.645 1.00 . A A . 59 PRO CG   1 1 
        8  8324 1 1 59 PRO HA   H  16.872  -1.696  -5.735 1.00 . A A . 59 PRO HA   1 1 
        8  8325 1 1 59 PRO HB2  H  17.994  -3.434  -7.871 1.00 . A A . 59 PRO HB2  1 1 
        8  8326 1 1 59 PRO HB3  H  16.397  -3.468  -7.114 1.00 . A A . 59 PRO HB3  1 1 
        8  8327 1 1 59 PRO HD2  H  18.301  -0.860  -9.303 1.00 . A A . 59 PRO HD2  1 1 
        8  8328 1 1 59 PRO HD3  H  16.846   0.101  -8.972 1.00 . A A . 59 PRO HD3  1 1 
        8  8329 1 1 59 PRO HG2  H  16.715  -2.519  -9.585 1.00 . A A . 59 PRO HG2  1 1 
        8  8330 1 1 59 PRO HG3  H  15.580  -1.760  -8.453 1.00 . A A . 59 PRO HG3  1 1 
        8  8331 1 1 59 PRO N    N  17.857  -0.598  -7.250 1.00 . A A . 59 PRO N    1 1 
        8  8332 1 1 59 PRO O    O  19.636  -3.158  -6.375 1.00 . A A . 59 PRO O    1 1 
        8  8333 1 1 60 SER C    C  20.264  -1.829  -2.412 1.00 . A A . 60 SER C    1 1 
        8  8334 1 1 60 SER CA   C  20.386  -2.210  -3.882 1.00 . A A . 60 SER CA   1 1 
        8  8335 1 1 60 SER CB   C  21.628  -1.556  -4.490 1.00 . A A . 60 SER CB   1 1 
        8  8336 1 1 60 SER H    H  18.583  -1.158  -4.231 1.00 . A A . 60 SER H    1 1 
        8  8337 1 1 60 SER HA   H  20.483  -3.284  -3.957 1.00 . A A . 60 SER HA   1 1 
        8  8338 1 1 60 SER HB2  H  22.464  -1.683  -3.818 1.00 . A A . 60 SER HB2  1 1 
        8  8339 1 1 60 SER HB3  H  21.852  -2.025  -5.435 1.00 . A A . 60 SER HB3  1 1 
        8  8340 1 1 60 SER HG   H  21.295   0.269  -3.860 1.00 . A A . 60 SER HG   1 1 
        8  8341 1 1 60 SER N    N  19.194  -1.817  -4.623 1.00 . A A . 60 SER N    1 1 
        8  8342 1 1 60 SER O    O  20.708  -0.757  -1.998 1.00 . A A . 60 SER O    1 1 
        8  8343 1 1 60 SER OG   O  21.422  -0.171  -4.704 1.00 . A A . 60 SER OG   1 1 
        8  8344 1 1 61 ASN C    C  20.033  -3.628   0.626 1.00 . A A . 61 ASN C    1 1 
        8  8345 1 1 61 ASN CA   C  19.479  -2.468  -0.197 1.00 . A A . 61 ASN CA   1 1 
        8  8346 1 1 61 ASN CB   C  17.997  -2.262   0.124 1.00 . A A . 61 ASN CB   1 1 
        8  8347 1 1 61 ASN CG   C  17.122  -3.364  -0.439 1.00 . A A . 61 ASN CG   1 1 
        8  8348 1 1 61 ASN H    H  19.325  -3.549  -2.013 1.00 . A A . 61 ASN H    1 1 
        8  8349 1 1 61 ASN HA   H  20.022  -1.571   0.057 1.00 . A A . 61 ASN HA   1 1 
        8  8350 1 1 61 ASN HB2  H  17.868  -2.239   1.196 1.00 . A A . 61 ASN HB2  1 1 
        8  8351 1 1 61 ASN HB3  H  17.673  -1.321  -0.294 1.00 . A A . 61 ASN HB3  1 1 
        8  8352 1 1 61 ASN HD21 H  17.604  -4.553   1.082 1.00 . A A . 61 ASN HD21 1 1 
        8  8353 1 1 61 ASN HD22 H  16.515  -5.227  -0.089 1.00 . A A . 61 ASN HD22 1 1 
        8  8354 1 1 61 ASN N    N  19.658  -2.712  -1.625 1.00 . A A . 61 ASN N    1 1 
        8  8355 1 1 61 ASN ND2  N  17.076  -4.495   0.254 1.00 . A A . 61 ASN ND2  1 1 
        8  8356 1 1 61 ASN O    O  19.938  -4.787   0.226 1.00 . A A . 61 ASN O    1 1 
        8  8357 1 1 61 ASN OD1  O  16.496  -3.201  -1.487 1.00 . A A . 61 ASN OD1  1 1 
        8  8358 1 1 62 LYS C    C  20.748  -4.098   4.102 1.00 . A A . 62 LYS C    1 1 
        8  8359 1 1 62 LYS CA   C  21.183  -4.319   2.656 1.00 . A A . 62 LYS CA   1 1 
        8  8360 1 1 62 LYS CB   C  22.710  -4.312   2.561 1.00 . A A . 62 LYS CB   1 1 
        8  8361 1 1 62 LYS CD   C  24.125  -2.743   3.926 1.00 . A A . 62 LYS CD   1 1 
        8  8362 1 1 62 LYS CE   C  24.291  -1.274   4.279 1.00 . A A . 62 LYS CE   1 1 
        8  8363 1 1 62 LYS CG   C  23.323  -2.923   2.647 1.00 . A A . 62 LYS CG   1 1 
        8  8364 1 1 62 LYS H    H  20.658  -2.361   2.041 1.00 . A A . 62 LYS H    1 1 
        8  8365 1 1 62 LYS HA   H  20.816  -5.281   2.329 1.00 . A A . 62 LYS HA   1 1 
        8  8366 1 1 62 LYS HB2  H  23.111  -4.911   3.365 1.00 . A A . 62 LYS HB2  1 1 
        8  8367 1 1 62 LYS HB3  H  23.001  -4.752   1.617 1.00 . A A . 62 LYS HB3  1 1 
        8  8368 1 1 62 LYS HD2  H  23.611  -3.240   4.734 1.00 . A A . 62 LYS HD2  1 1 
        8  8369 1 1 62 LYS HD3  H  25.101  -3.185   3.793 1.00 . A A . 62 LYS HD3  1 1 
        8  8370 1 1 62 LYS HE2  H  24.100  -0.680   3.397 1.00 . A A . 62 LYS HE2  1 1 
        8  8371 1 1 62 LYS HE3  H  23.575  -1.017   5.046 1.00 . A A . 62 LYS HE3  1 1 
        8  8372 1 1 62 LYS HG2  H  23.978  -2.776   1.801 1.00 . A A . 62 LYS HG2  1 1 
        8  8373 1 1 62 LYS HG3  H  22.532  -2.189   2.622 1.00 . A A . 62 LYS HG3  1 1 
        8  8374 1 1 62 LYS HZ1  H  26.103  -1.836   5.152 1.00 . A A . 62 LYS HZ1  1 1 
        8  8375 1 1 62 LYS HZ2  H  25.620  -0.261   5.533 1.00 . A A . 62 LYS HZ2  1 1 
        8  8376 1 1 62 LYS HZ3  H  26.250  -0.605   4.002 1.00 . A A . 62 LYS HZ3  1 1 
        8  8377 1 1 62 LYS N    N  20.613  -3.304   1.777 1.00 . A A . 62 LYS N    1 1 
        8  8378 1 1 62 LYS NZ   N  25.662  -0.973   4.777 1.00 . A A . 62 LYS NZ   1 1 
        8  8379 1 1 62 LYS O    O  20.401  -5.046   4.806 1.00 . A A . 62 LYS O    1 1 
        8  8380 1 1 63 LYS C    C  19.451  -1.289   5.914 1.00 . A A . 63 LYS C    1 1 
        8  8381 1 1 63 LYS CA   C  20.377  -2.502   5.901 1.00 . A A . 63 LYS CA   1 1 
        8  8382 1 1 63 LYS CB   C  21.616  -2.227   6.757 1.00 . A A . 63 LYS CB   1 1 
        8  8383 1 1 63 LYS CD   C  23.142  -3.377   8.391 1.00 . A A . 63 LYS CD   1 1 
        8  8384 1 1 63 LYS CE   C  23.324  -3.375   9.900 1.00 . A A . 63 LYS CE   1 1 
        8  8385 1 1 63 LYS CG   C  21.699  -3.098   8.002 1.00 . A A . 63 LYS CG   1 1 
        8  8386 1 1 63 LYS H    H  21.056  -2.130   3.933 1.00 . A A . 63 LYS H    1 1 
        8  8387 1 1 63 LYS HA   H  19.845  -3.347   6.315 1.00 . A A . 63 LYS HA   1 1 
        8  8388 1 1 63 LYS HB2  H  22.498  -2.407   6.161 1.00 . A A . 63 LYS HB2  1 1 
        8  8389 1 1 63 LYS HB3  H  21.606  -1.193   7.069 1.00 . A A . 63 LYS HB3  1 1 
        8  8390 1 1 63 LYS HD2  H  23.427  -4.344   8.004 1.00 . A A . 63 LYS HD2  1 1 
        8  8391 1 1 63 LYS HD3  H  23.774  -2.613   7.961 1.00 . A A . 63 LYS HD3  1 1 
        8  8392 1 1 63 LYS HE2  H  22.480  -2.874  10.351 1.00 . A A . 63 LYS HE2  1 1 
        8  8393 1 1 63 LYS HE3  H  23.361  -4.399  10.245 1.00 . A A . 63 LYS HE3  1 1 
        8  8394 1 1 63 LYS HG2  H  21.209  -2.588   8.819 1.00 . A A . 63 LYS HG2  1 1 
        8  8395 1 1 63 LYS HG3  H  21.199  -4.035   7.808 1.00 . A A . 63 LYS HG3  1 1 
        8  8396 1 1 63 LYS HZ1  H  24.367  -1.695  10.570 1.00 . A A . 63 LYS HZ1  1 1 
        8  8397 1 1 63 LYS HZ2  H  25.257  -2.681   9.524 1.00 . A A . 63 LYS HZ2  1 1 
        8  8398 1 1 63 LYS HZ3  H  25.002  -3.162  11.126 1.00 . A A . 63 LYS HZ3  1 1 
        8  8399 1 1 63 LYS N    N  20.770  -2.843   4.539 1.00 . A A . 63 LYS N    1 1 
        8  8400 1 1 63 LYS NZ   N  24.575  -2.679  10.308 1.00 . A A . 63 LYS NZ   1 1 
        8  8401 1 1 63 LYS O    O  19.827  -0.207   5.464 1.00 . A A . 63 LYS O    1 1 
        8  8402 1 1 64 THR C    C  16.642  -0.316   7.892 1.00 . A A . 64 THR C    1 1 
        8  8403 1 1 64 THR CA   C  17.264  -0.398   6.501 1.00 . A A . 64 THR CA   1 1 
        8  8404 1 1 64 THR CB   C  16.172  -0.604   5.453 1.00 . A A . 64 THR CB   1 1 
        8  8405 1 1 64 THR CG2  C  15.402  -1.895   5.634 1.00 . A A . 64 THR CG2  1 1 
        8  8406 1 1 64 THR H    H  18.002  -2.363   6.775 1.00 . A A . 64 THR H    1 1 
        8  8407 1 1 64 THR HA   H  17.779   0.529   6.295 1.00 . A A . 64 THR HA   1 1 
        8  8408 1 1 64 THR HB   H  16.626  -0.625   4.473 1.00 . A A . 64 THR HB   1 1 
        8  8409 1 1 64 THR HG1  H  15.689   1.288   5.310 1.00 . A A . 64 THR HG1  1 1 
        8  8410 1 1 64 THR HG21 H  14.490  -1.697   6.178 1.00 . A A . 64 THR HG21 1 1 
        8  8411 1 1 64 THR HG22 H  16.006  -2.599   6.187 1.00 . A A . 64 THR HG22 1 1 
        8  8412 1 1 64 THR HG23 H  15.161  -2.309   4.667 1.00 . A A . 64 THR HG23 1 1 
        8  8413 1 1 64 THR N    N  18.242  -1.477   6.432 1.00 . A A . 64 THR N    1 1 
        8  8414 1 1 64 THR O    O  16.276  -1.334   8.481 1.00 . A A . 64 THR O    1 1 
        8  8415 1 1 64 THR OG1  O  15.237   0.460   5.486 1.00 . A A . 64 THR OG1  1 1 
        8  8416 1 1 65 THR C    C  14.564   1.753   9.624 1.00 . A A . 65 THR C    1 1 
        8  8417 1 1 65 THR CA   C  15.947   1.118   9.732 1.00 . A A . 65 THR CA   1 1 
        8  8418 1 1 65 THR CB   C  16.864   2.006  10.575 1.00 . A A . 65 THR CB   1 1 
        8  8419 1 1 65 THR CG2  C  18.149   1.319  10.985 1.00 . A A . 65 THR CG2  1 1 
        8  8420 1 1 65 THR H    H  16.835   1.674   7.893 1.00 . A A . 65 THR H    1 1 
        8  8421 1 1 65 THR HA   H  15.851   0.155  10.213 1.00 . A A . 65 THR HA   1 1 
        8  8422 1 1 65 THR HB   H  16.341   2.293  11.475 1.00 . A A . 65 THR HB   1 1 
        8  8423 1 1 65 THR HG1  H  17.771   3.735  10.419 1.00 . A A . 65 THR HG1  1 1 
        8  8424 1 1 65 THR HG21 H  18.990   1.947  10.731 1.00 . A A . 65 THR HG21 1 1 
        8  8425 1 1 65 THR HG22 H  18.235   0.376  10.465 1.00 . A A . 65 THR HG22 1 1 
        8  8426 1 1 65 THR HG23 H  18.140   1.143  12.051 1.00 . A A . 65 THR HG23 1 1 
        8  8427 1 1 65 THR N    N  16.525   0.901   8.411 1.00 . A A . 65 THR N    1 1 
        8  8428 1 1 65 THR O    O  14.417   2.857   9.097 1.00 . A A . 65 THR O    1 1 
        8  8429 1 1 65 THR OG1  O  17.214   3.181   9.867 1.00 . A A . 65 THR OG1  1 1 
        8  8430 1 1 66 ALA C    C  11.512   1.411  11.446 1.00 . A A . 66 ALA C    1 1 
        8  8431 1 1 66 ALA CA   C  12.184   1.545  10.084 1.00 . A A . 66 ALA CA   1 1 
        8  8432 1 1 66 ALA CB   C  11.387   0.802   9.024 1.00 . A A . 66 ALA CB   1 1 
        8  8433 1 1 66 ALA H    H  13.735   0.178  10.532 1.00 . A A . 66 ALA H    1 1 
        8  8434 1 1 66 ALA HA   H  12.216   2.589   9.812 1.00 . A A . 66 ALA HA   1 1 
        8  8435 1 1 66 ALA HB1  H  10.758   1.502   8.491 1.00 . A A . 66 ALA HB1  1 1 
        8  8436 1 1 66 ALA HB2  H  10.770   0.051   9.496 1.00 . A A . 66 ALA HB2  1 1 
        8  8437 1 1 66 ALA HB3  H  12.065   0.327   8.330 1.00 . A A . 66 ALA HB3  1 1 
        8  8438 1 1 66 ALA N    N  13.554   1.050  10.125 1.00 . A A . 66 ALA N    1 1 
        8  8439 1 1 66 ALA O    O  10.564   2.180  11.717 1.00 . A A . 66 ALA O    1 1 
        8  8440 1 1 66 ALA OXT  O  11.937   0.538  12.231 1.00 . A A . 66 ALA OXT  1 1 
        9  8441 1 1  1 MET C    C  -0.103  13.255  -0.111 1.00 . A A .  1 MET C    1 1 
        9  8442 1 1  1 MET CA   C  -1.008  14.483  -0.117 1.00 . A A .  1 MET CA   1 1 
        9  8443 1 1  1 MET CB   C  -2.474  14.058  -0.194 1.00 . A A .  1 MET CB   1 1 
        9  8444 1 1  1 MET CE   C  -5.468  14.195  -2.344 1.00 . A A .  1 MET CE   1 1 
        9  8445 1 1  1 MET CG   C  -2.888  13.549  -1.566 1.00 . A A .  1 MET CG   1 1 
        9  8446 1 1  1 MET H1   H  -1.501  16.030  -1.381 1.00 . A A .  1 MET H1   1 1 
        9  8447 1 1  1 MET H2   H  -0.613  14.759  -2.117 1.00 . A A .  1 MET H2   1 1 
        9  8448 1 1  1 MET H3   H   0.177  15.868  -1.071 1.00 . A A .  1 MET H3   1 1 
        9  8449 1 1  1 MET HA   H  -0.847  15.044   0.792 1.00 . A A .  1 MET HA   1 1 
        9  8450 1 1  1 MET HB2  H  -2.647  13.270   0.525 1.00 . A A .  1 MET HB2  1 1 
        9  8451 1 1  1 MET HB3  H  -3.097  14.904   0.056 1.00 . A A .  1 MET HB3  1 1 
        9  8452 1 1  1 MET HE1  H  -5.529  13.538  -1.489 1.00 . A A .  1 MET HE1  1 1 
        9  8453 1 1  1 MET HE2  H  -5.757  13.657  -3.234 1.00 . A A .  1 MET HE2  1 1 
        9  8454 1 1  1 MET HE3  H  -6.129  15.036  -2.200 1.00 . A A .  1 MET HE3  1 1 
        9  8455 1 1  1 MET HG2  H  -2.001  13.267  -2.112 1.00 . A A .  1 MET HG2  1 1 
        9  8456 1 1  1 MET HG3  H  -3.521  12.684  -1.438 1.00 . A A .  1 MET HG3  1 1 
        9  8457 1 1  1 MET N    N  -0.709  15.365  -1.276 1.00 . A A .  1 MET N    1 1 
        9  8458 1 1  1 MET O    O  -0.201  12.397  -0.988 1.00 . A A .  1 MET O    1 1 
        9  8459 1 1  1 MET SD   S  -3.786  14.785  -2.524 1.00 . A A .  1 MET SD   1 1 
        9  8460 1 1  2 GLU C    C   1.098  10.953   1.875 1.00 . A A .  2 GLU C    1 1 
        9  8461 1 1  2 GLU CA   C   1.695  12.054   1.004 1.00 . A A .  2 GLU CA   1 1 
        9  8462 1 1  2 GLU CB   C   3.028  12.520   1.589 1.00 . A A .  2 GLU CB   1 1 
        9  8463 1 1  2 GLU CD   C   5.445  12.733   0.888 1.00 . A A .  2 GLU CD   1 1 
        9  8464 1 1  2 GLU CG   C   4.236  11.825   0.985 1.00 . A A .  2 GLU CG   1 1 
        9  8465 1 1  2 GLU H    H   0.804  13.892   1.553 1.00 . A A .  2 GLU H    1 1 
        9  8466 1 1  2 GLU HA   H   1.866  11.658   0.014 1.00 . A A .  2 GLU HA   1 1 
        9  8467 1 1  2 GLU HB2  H   3.130  13.582   1.422 1.00 . A A .  2 GLU HB2  1 1 
        9  8468 1 1  2 GLU HB3  H   3.027  12.332   2.654 1.00 . A A .  2 GLU HB3  1 1 
        9  8469 1 1  2 GLU HG2  H   4.493  10.975   1.601 1.00 . A A .  2 GLU HG2  1 1 
        9  8470 1 1  2 GLU HG3  H   3.979  11.484  -0.007 1.00 . A A .  2 GLU HG3  1 1 
        9  8471 1 1  2 GLU N    N   0.774  13.176   0.883 1.00 . A A .  2 GLU N    1 1 
        9  8472 1 1  2 GLU O    O   1.096  11.052   3.102 1.00 . A A .  2 GLU O    1 1 
        9  8473 1 1  2 GLU OE1  O   5.880  13.257   1.935 1.00 . A A .  2 GLU OE1  1 1 
        9  8474 1 1  2 GLU OE2  O   5.958  12.921  -0.235 1.00 . A A .  2 GLU OE2  1 1 
        9  8475 1 1  3 GLN C    C   0.421   7.455   1.341 1.00 . A A .  3 GLN C    1 1 
        9  8476 1 1  3 GLN CA   C  -0.005   8.785   1.951 1.00 . A A .  3 GLN CA   1 1 
        9  8477 1 1  3 GLN CB   C  -1.529   8.902   1.938 1.00 . A A .  3 GLN CB   1 1 
        9  8478 1 1  3 GLN CD   C  -3.246   9.210   3.767 1.00 . A A .  3 GLN CD   1 1 
        9  8479 1 1  3 GLN CG   C  -2.194   8.300   3.165 1.00 . A A .  3 GLN CG   1 1 
        9  8480 1 1  3 GLN H    H   0.624   9.882   0.255 1.00 . A A .  3 GLN H    1 1 
        9  8481 1 1  3 GLN HA   H   0.340   8.824   2.974 1.00 . A A .  3 GLN HA   1 1 
        9  8482 1 1  3 GLN HB2  H  -1.794   9.948   1.885 1.00 . A A .  3 GLN HB2  1 1 
        9  8483 1 1  3 GLN HB3  H  -1.910   8.398   1.063 1.00 . A A .  3 GLN HB3  1 1 
        9  8484 1 1  3 GLN HE21 H  -3.256   8.131   5.438 1.00 . A A .  3 GLN HE21 1 1 
        9  8485 1 1  3 GLN HE22 H  -4.337   9.489   5.409 1.00 . A A .  3 GLN HE22 1 1 
        9  8486 1 1  3 GLN HG2  H  -2.662   7.368   2.884 1.00 . A A .  3 GLN HG2  1 1 
        9  8487 1 1  3 GLN HG3  H  -1.435   8.109   3.910 1.00 . A A .  3 GLN HG3  1 1 
        9  8488 1 1  3 GLN N    N   0.594   9.903   1.234 1.00 . A A .  3 GLN N    1 1 
        9  8489 1 1  3 GLN NE2  N  -3.653   8.913   4.995 1.00 . A A .  3 GLN NE2  1 1 
        9  8490 1 1  3 GLN O    O  -0.389   6.537   1.194 1.00 . A A .  3 GLN O    1 1 
        9  8491 1 1  3 GLN OE1  O  -3.688  10.170   3.134 1.00 . A A .  3 GLN OE1  1 1 
        9  8492 1 1  4 ARG C    C   2.771   5.206   1.470 1.00 . A A .  4 ARG C    1 1 
        9  8493 1 1  4 ARG CA   C   2.249   6.148   0.397 1.00 . A A .  4 ARG CA   1 1 
        9  8494 1 1  4 ARG CB   C   3.369   6.498  -0.585 1.00 . A A .  4 ARG CB   1 1 
        9  8495 1 1  4 ARG CD   C   4.043   8.482  -1.974 1.00 . A A .  4 ARG CD   1 1 
        9  8496 1 1  4 ARG CG   C   2.944   7.476  -1.668 1.00 . A A .  4 ARG CG   1 1 
        9  8497 1 1  4 ARG CZ   C   3.027  10.065  -3.568 1.00 . A A .  4 ARG CZ   1 1 
        9  8498 1 1  4 ARG H    H   2.287   8.131   1.137 1.00 . A A .  4 ARG H    1 1 
        9  8499 1 1  4 ARG HA   H   1.457   5.646  -0.138 1.00 . A A .  4 ARG HA   1 1 
        9  8500 1 1  4 ARG HB2  H   4.190   6.934  -0.036 1.00 . A A .  4 ARG HB2  1 1 
        9  8501 1 1  4 ARG HB3  H   3.710   5.590  -1.062 1.00 . A A .  4 ARG HB3  1 1 
        9  8502 1 1  4 ARG HD2  H   4.658   8.601  -1.096 1.00 . A A .  4 ARG HD2  1 1 
        9  8503 1 1  4 ARG HD3  H   4.645   8.102  -2.786 1.00 . A A .  4 ARG HD3  1 1 
        9  8504 1 1  4 ARG HE   H   3.488  10.487  -1.672 1.00 . A A .  4 ARG HE   1 1 
        9  8505 1 1  4 ARG HG2  H   2.713   6.925  -2.567 1.00 . A A .  4 ARG HG2  1 1 
        9  8506 1 1  4 ARG HG3  H   2.065   8.008  -1.333 1.00 . A A .  4 ARG HG3  1 1 
        9  8507 1 1  4 ARG HH11 H   3.386   8.224  -4.327 1.00 . A A .  4 ARG HH11 1 1 
        9  8508 1 1  4 ARG HH12 H   2.673   9.357  -5.426 1.00 . A A .  4 ARG HH12 1 1 
        9  8509 1 1  4 ARG HH21 H   2.547  11.975  -3.116 1.00 . A A .  4 ARG HH21 1 1 
        9  8510 1 1  4 ARG HH22 H   2.196  11.486  -4.739 1.00 . A A .  4 ARG HH22 1 1 
        9  8511 1 1  4 ARG N    N   1.699   7.362   0.991 1.00 . A A .  4 ARG N    1 1 
        9  8512 1 1  4 ARG NE   N   3.500   9.784  -2.354 1.00 . A A .  4 ARG NE   1 1 
        9  8513 1 1  4 ARG NH1  N   3.029   9.140  -4.518 1.00 . A A .  4 ARG NH1  1 1 
        9  8514 1 1  4 ARG NH2  N   2.552  11.274  -3.829 1.00 . A A .  4 ARG NH2  1 1 
        9  8515 1 1  4 ARG O    O   3.878   5.373   1.981 1.00 . A A .  4 ARG O    1 1 
        9  8516 1 1  5 ILE C    C   2.722   1.918   2.140 1.00 . A A .  5 ILE C    1 1 
        9  8517 1 1  5 ILE CA   C   2.321   3.225   2.805 1.00 . A A .  5 ILE CA   1 1 
        9  8518 1 1  5 ILE CB   C   1.158   2.949   3.781 1.00 . A A .  5 ILE CB   1 1 
        9  8519 1 1  5 ILE CD1  C  -0.975   3.936   4.748 1.00 . A A .  5 ILE CD1  1 1 
        9  8520 1 1  5 ILE CG1  C   0.234   4.157   3.865 1.00 . A A .  5 ILE CG1  1 1 
        9  8521 1 1  5 ILE CG2  C   1.685   2.587   5.163 1.00 . A A .  5 ILE CG2  1 1 
        9  8522 1 1  5 ILE H    H   1.093   4.135   1.348 1.00 . A A .  5 ILE H    1 1 
        9  8523 1 1  5 ILE HA   H   3.159   3.608   3.367 1.00 . A A .  5 ILE HA   1 1 
        9  8524 1 1  5 ILE HB   H   0.599   2.111   3.399 1.00 . A A .  5 ILE HB   1 1 
        9  8525 1 1  5 ILE HD11 H  -1.246   4.866   5.226 1.00 . A A .  5 ILE HD11 1 1 
        9  8526 1 1  5 ILE HD12 H  -0.739   3.200   5.503 1.00 . A A .  5 ILE HD12 1 1 
        9  8527 1 1  5 ILE HD13 H  -1.801   3.586   4.147 1.00 . A A .  5 ILE HD13 1 1 
        9  8528 1 1  5 ILE HG12 H   0.784   5.000   4.258 1.00 . A A .  5 ILE HG12 1 1 
        9  8529 1 1  5 ILE HG13 H  -0.112   4.388   2.875 1.00 . A A .  5 ILE HG13 1 1 
        9  8530 1 1  5 ILE HG21 H   1.110   3.105   5.916 1.00 . A A .  5 ILE HG21 1 1 
        9  8531 1 1  5 ILE HG22 H   2.723   2.878   5.240 1.00 . A A .  5 ILE HG22 1 1 
        9  8532 1 1  5 ILE HG23 H   1.598   1.521   5.313 1.00 . A A .  5 ILE HG23 1 1 
        9  8533 1 1  5 ILE N    N   1.959   4.211   1.798 1.00 . A A .  5 ILE N    1 1 
        9  8534 1 1  5 ILE O    O   2.775   1.824   0.915 1.00 . A A .  5 ILE O    1 1 
        9  8535 1 1  6 THR C    C   2.163  -1.288   2.242 1.00 . A A .  6 THR C    1 1 
        9  8536 1 1  6 THR CA   C   3.385  -0.398   2.445 1.00 . A A .  6 THR CA   1 1 
        9  8537 1 1  6 THR CB   C   4.373  -1.073   3.397 1.00 . A A .  6 THR CB   1 1 
        9  8538 1 1  6 THR CG2  C   5.743  -0.429   3.392 1.00 . A A .  6 THR CG2  1 1 
        9  8539 1 1  6 THR H    H   2.923   1.052   3.919 1.00 . A A .  6 THR H    1 1 
        9  8540 1 1  6 THR HA   H   3.865  -0.250   1.490 1.00 . A A .  6 THR HA   1 1 
        9  8541 1 1  6 THR HB   H   4.492  -2.106   3.103 1.00 . A A .  6 THR HB   1 1 
        9  8542 1 1  6 THR HG1  H   4.013  -1.906   5.129 1.00 . A A .  6 THR HG1  1 1 
        9  8543 1 1  6 THR HG21 H   6.228  -0.626   2.448 1.00 . A A .  6 THR HG21 1 1 
        9  8544 1 1  6 THR HG22 H   6.337  -0.841   4.195 1.00 . A A .  6 THR HG22 1 1 
        9  8545 1 1  6 THR HG23 H   5.640   0.636   3.530 1.00 . A A .  6 THR HG23 1 1 
        9  8546 1 1  6 THR N    N   2.994   0.912   2.954 1.00 . A A .  6 THR N    1 1 
        9  8547 1 1  6 THR O    O   1.082  -1.000   2.755 1.00 . A A .  6 THR O    1 1 
        9  8548 1 1  6 THR OG1  O   3.890  -1.044   4.728 1.00 . A A .  6 THR OG1  1 1 
        9  8549 1 1  7 LEU C    C   1.074  -4.269   2.390 1.00 . A A .  7 LEU C    1 1 
        9  8550 1 1  7 LEU CA   C   1.257  -3.303   1.225 1.00 . A A .  7 LEU CA   1 1 
        9  8551 1 1  7 LEU CB   C   1.532  -4.082  -0.063 1.00 . A A .  7 LEU CB   1 1 
        9  8552 1 1  7 LEU CD1  C  -0.680  -4.259  -1.224 1.00 . A A .  7 LEU CD1  1 1 
        9  8553 1 1  7 LEU CD2  C   0.965  -6.135  -1.382 1.00 . A A .  7 LEU CD2  1 1 
        9  8554 1 1  7 LEU CG   C   0.412  -5.027  -0.499 1.00 . A A .  7 LEU CG   1 1 
        9  8555 1 1  7 LEU H    H   3.229  -2.546   1.112 1.00 . A A .  7 LEU H    1 1 
        9  8556 1 1  7 LEU HA   H   0.350  -2.729   1.101 1.00 . A A .  7 LEU HA   1 1 
        9  8557 1 1  7 LEU HB2  H   1.706  -3.372  -0.858 1.00 . A A .  7 LEU HB2  1 1 
        9  8558 1 1  7 LEU HB3  H   2.430  -4.665   0.080 1.00 . A A .  7 LEU HB3  1 1 
        9  8559 1 1  7 LEU HD11 H  -0.258  -3.380  -1.687 1.00 . A A .  7 LEU HD11 1 1 
        9  8560 1 1  7 LEU HD12 H  -1.443  -3.962  -0.519 1.00 . A A .  7 LEU HD12 1 1 
        9  8561 1 1  7 LEU HD13 H  -1.120  -4.889  -1.985 1.00 . A A .  7 LEU HD13 1 1 
        9  8562 1 1  7 LEU HD21 H   0.432  -7.054  -1.185 1.00 . A A .  7 LEU HD21 1 1 
        9  8563 1 1  7 LEU HD22 H   2.015  -6.276  -1.167 1.00 . A A .  7 LEU HD22 1 1 
        9  8564 1 1  7 LEU HD23 H   0.844  -5.863  -2.419 1.00 . A A .  7 LEU HD23 1 1 
        9  8565 1 1  7 LEU HG   H  -0.026  -5.483   0.378 1.00 . A A .  7 LEU HG   1 1 
        9  8566 1 1  7 LEU N    N   2.344  -2.369   1.493 1.00 . A A .  7 LEU N    1 1 
        9  8567 1 1  7 LEU O    O  -0.047  -4.660   2.716 1.00 . A A .  7 LEU O    1 1 
        9  8568 1 1  8 LYS C    C   1.480  -4.924   5.353 1.00 . A A .  8 LYS C    1 1 
        9  8569 1 1  8 LYS CA   C   2.150  -5.569   4.144 1.00 . A A .  8 LYS CA   1 1 
        9  8570 1 1  8 LYS CB   C   3.568  -6.012   4.509 1.00 . A A .  8 LYS CB   1 1 
        9  8571 1 1  8 LYS CD   C   4.932  -7.226   6.235 1.00 . A A .  8 LYS CD   1 1 
        9  8572 1 1  8 LYS CE   C   4.818  -8.040   7.514 1.00 . A A .  8 LYS CE   1 1 
        9  8573 1 1  8 LYS CG   C   3.609  -7.177   5.486 1.00 . A A .  8 LYS CG   1 1 
        9  8574 1 1  8 LYS H    H   3.047  -4.303   2.709 1.00 . A A .  8 LYS H    1 1 
        9  8575 1 1  8 LYS HA   H   1.578  -6.433   3.848 1.00 . A A .  8 LYS HA   1 1 
        9  8576 1 1  8 LYS HB2  H   4.084  -6.309   3.607 1.00 . A A .  8 LYS HB2  1 1 
        9  8577 1 1  8 LYS HB3  H   4.090  -5.178   4.953 1.00 . A A .  8 LYS HB3  1 1 
        9  8578 1 1  8 LYS HD2  H   5.679  -7.678   5.600 1.00 . A A .  8 LYS HD2  1 1 
        9  8579 1 1  8 LYS HD3  H   5.232  -6.219   6.486 1.00 . A A .  8 LYS HD3  1 1 
        9  8580 1 1  8 LYS HE2  H   5.364  -7.535   8.297 1.00 . A A .  8 LYS HE2  1 1 
        9  8581 1 1  8 LYS HE3  H   3.775  -8.109   7.791 1.00 . A A .  8 LYS HE3  1 1 
        9  8582 1 1  8 LYS HG2  H   2.808  -7.064   6.200 1.00 . A A .  8 LYS HG2  1 1 
        9  8583 1 1  8 LYS HG3  H   3.481  -8.099   4.939 1.00 . A A .  8 LYS HG3  1 1 
        9  8584 1 1  8 LYS HZ1  H   6.349  -9.449   7.690 1.00 . A A .  8 LYS HZ1  1 1 
        9  8585 1 1  8 LYS HZ2  H   5.351  -9.688   6.347 1.00 . A A .  8 LYS HZ2  1 1 
        9  8586 1 1  8 LYS HZ3  H   4.799 -10.094   7.893 1.00 . A A .  8 LYS HZ3  1 1 
        9  8587 1 1  8 LYS N    N   2.184  -4.648   3.015 1.00 . A A .  8 LYS N    1 1 
        9  8588 1 1  8 LYS NZ   N   5.368  -9.414   7.348 1.00 . A A .  8 LYS NZ   1 1 
        9  8589 1 1  8 LYS O    O   0.641  -5.539   6.013 1.00 . A A .  8 LYS O    1 1 
        9  8590 1 1  9 ASP C    C  -0.185  -2.676   6.564 1.00 . A A .  9 ASP C    1 1 
        9  8591 1 1  9 ASP CA   C   1.298  -2.952   6.773 1.00 . A A .  9 ASP CA   1 1 
        9  8592 1 1  9 ASP CB   C   2.041  -1.631   6.976 1.00 . A A .  9 ASP CB   1 1 
        9  8593 1 1  9 ASP CG   C   3.440  -1.831   7.521 1.00 . A A .  9 ASP CG   1 1 
        9  8594 1 1  9 ASP H    H   2.534  -3.247   5.079 1.00 . A A .  9 ASP H    1 1 
        9  8595 1 1  9 ASP HA   H   1.418  -3.563   7.655 1.00 . A A .  9 ASP HA   1 1 
        9  8596 1 1  9 ASP HB2  H   2.109  -1.117   6.029 1.00 . A A .  9 ASP HB2  1 1 
        9  8597 1 1  9 ASP HB3  H   1.487  -1.016   7.671 1.00 . A A .  9 ASP HB3  1 1 
        9  8598 1 1  9 ASP N    N   1.860  -3.682   5.641 1.00 . A A .  9 ASP N    1 1 
        9  8599 1 1  9 ASP O    O  -1.021  -3.062   7.379 1.00 . A A .  9 ASP O    1 1 
        9  8600 1 1  9 ASP OD1  O   4.209  -2.607   6.915 1.00 . A A .  9 ASP OD1  1 1 
        9  8601 1 1  9 ASP OD2  O   3.771  -1.209   8.553 1.00 . A A .  9 ASP OD2  1 1 
        9  8602 1 1 10 TYR C    C  -2.792  -2.880   5.210 1.00 . A A . 10 TYR C    1 1 
        9  8603 1 1 10 TYR CA   C  -1.885  -1.654   5.150 1.00 . A A . 10 TYR CA   1 1 
        9  8604 1 1 10 TYR CB   C  -1.969  -1.013   3.765 1.00 . A A . 10 TYR CB   1 1 
        9  8605 1 1 10 TYR CD1  C  -4.417  -0.860   3.178 1.00 . A A . 10 TYR CD1  1 1 
        9  8606 1 1 10 TYR CD2  C  -3.256   1.157   3.693 1.00 . A A . 10 TYR CD2  1 1 
        9  8607 1 1 10 TYR CE1  C  -5.581  -0.142   2.972 1.00 . A A . 10 TYR CE1  1 1 
        9  8608 1 1 10 TYR CE2  C  -4.415   1.881   3.489 1.00 . A A . 10 TYR CE2  1 1 
        9  8609 1 1 10 TYR CG   C  -3.237  -0.222   3.541 1.00 . A A . 10 TYR CG   1 1 
        9  8610 1 1 10 TYR CZ   C  -5.574   1.228   3.130 1.00 . A A . 10 TYR CZ   1 1 
        9  8611 1 1 10 TYR H    H   0.210  -1.711   4.859 1.00 . A A . 10 TYR H    1 1 
        9  8612 1 1 10 TYR HA   H  -2.222  -0.940   5.886 1.00 . A A . 10 TYR HA   1 1 
        9  8613 1 1 10 TYR HB2  H  -1.132  -0.341   3.636 1.00 . A A . 10 TYR HB2  1 1 
        9  8614 1 1 10 TYR HB3  H  -1.921  -1.787   3.014 1.00 . A A . 10 TYR HB3  1 1 
        9  8615 1 1 10 TYR HD1  H  -4.419  -1.933   3.057 1.00 . A A . 10 TYR HD1  1 1 
        9  8616 1 1 10 TYR HD2  H  -2.346   1.667   3.974 1.00 . A A . 10 TYR HD2  1 1 
        9  8617 1 1 10 TYR HE1  H  -6.488  -0.656   2.691 1.00 . A A . 10 TYR HE1  1 1 
        9  8618 1 1 10 TYR HE2  H  -4.409   2.955   3.612 1.00 . A A . 10 TYR HE2  1 1 
        9  8619 1 1 10 TYR HH   H  -6.516   2.789   2.521 1.00 . A A . 10 TYR HH   1 1 
        9  8620 1 1 10 TYR N    N  -0.504  -1.996   5.468 1.00 . A A . 10 TYR N    1 1 
        9  8621 1 1 10 TYR O    O  -3.948  -2.789   5.621 1.00 . A A . 10 TYR O    1 1 
        9  8622 1 1 10 TYR OH   O  -6.730   1.946   2.926 1.00 . A A . 10 TYR OH   1 1 
        9  8623 1 1 11 ALA C    C  -3.378  -5.693   6.223 1.00 . A A . 11 ALA C    1 1 
        9  8624 1 1 11 ALA CA   C  -3.028  -5.266   4.801 1.00 . A A . 11 ALA CA   1 1 
        9  8625 1 1 11 ALA CB   C  -2.251  -6.367   4.094 1.00 . A A . 11 ALA CB   1 1 
        9  8626 1 1 11 ALA H    H  -1.335  -4.037   4.476 1.00 . A A . 11 ALA H    1 1 
        9  8627 1 1 11 ALA HA   H  -3.943  -5.094   4.252 1.00 . A A . 11 ALA HA   1 1 
        9  8628 1 1 11 ALA HB1  H  -2.667  -7.328   4.361 1.00 . A A . 11 ALA HB1  1 1 
        9  8629 1 1 11 ALA HB2  H  -1.215  -6.326   4.393 1.00 . A A . 11 ALA HB2  1 1 
        9  8630 1 1 11 ALA HB3  H  -2.324  -6.229   3.026 1.00 . A A . 11 ALA HB3  1 1 
        9  8631 1 1 11 ALA N    N  -2.262  -4.025   4.796 1.00 . A A . 11 ALA N    1 1 
        9  8632 1 1 11 ALA O    O  -4.524  -6.036   6.514 1.00 . A A . 11 ALA O    1 1 
        9  8633 1 1 12 MET C    C  -3.221  -4.939   9.300 1.00 . A A . 12 MET C    1 1 
        9  8634 1 1 12 MET CA   C  -2.584  -6.066   8.492 1.00 . A A . 12 MET CA   1 1 
        9  8635 1 1 12 MET CB   C  -1.249  -6.475   9.123 1.00 . A A . 12 MET CB   1 1 
        9  8636 1 1 12 MET CE   C   1.000  -8.244   7.614 1.00 . A A . 12 MET CE   1 1 
        9  8637 1 1 12 MET CG   C  -1.126  -7.969   9.370 1.00 . A A . 12 MET CG   1 1 
        9  8638 1 1 12 MET H    H  -1.494  -5.398   6.813 1.00 . A A . 12 MET H    1 1 
        9  8639 1 1 12 MET HA   H  -3.244  -6.910   8.498 1.00 . A A . 12 MET HA   1 1 
        9  8640 1 1 12 MET HB2  H  -0.447  -6.174   8.466 1.00 . A A . 12 MET HB2  1 1 
        9  8641 1 1 12 MET HB3  H  -1.138  -5.965  10.069 1.00 . A A . 12 MET HB3  1 1 
        9  8642 1 1 12 MET HE1  H   0.141  -8.452   6.994 1.00 . A A . 12 MET HE1  1 1 
        9  8643 1 1 12 MET HE2  H   1.817  -8.888   7.325 1.00 . A A . 12 MET HE2  1 1 
        9  8644 1 1 12 MET HE3  H   1.295  -7.212   7.489 1.00 . A A . 12 MET HE3  1 1 
        9  8645 1 1 12 MET HG2  H  -1.543  -8.195  10.341 1.00 . A A . 12 MET HG2  1 1 
        9  8646 1 1 12 MET HG3  H  -1.684  -8.493   8.609 1.00 . A A . 12 MET HG3  1 1 
        9  8647 1 1 12 MET N    N  -2.383  -5.675   7.104 1.00 . A A . 12 MET N    1 1 
        9  8648 1 1 12 MET O    O  -3.881  -5.182  10.311 1.00 . A A . 12 MET O    1 1 
        9  8649 1 1 12 MET SD   S   0.583  -8.540   9.330 1.00 . A A . 12 MET SD   1 1 
        9  8650 1 1 13 ARG C    C  -5.015  -2.304   9.130 1.00 . A A . 13 ARG C    1 1 
        9  8651 1 1 13 ARG CA   C  -3.563  -2.540   9.531 1.00 . A A . 13 ARG CA   1 1 
        9  8652 1 1 13 ARG CB   C  -2.727  -1.299   9.211 1.00 . A A . 13 ARG CB   1 1 
        9  8653 1 1 13 ARG CD   C  -3.912   0.192  10.850 1.00 . A A . 13 ARG CD   1 1 
        9  8654 1 1 13 ARG CG   C  -2.569  -0.352  10.389 1.00 . A A . 13 ARG CG   1 1 
        9  8655 1 1 13 ARG CZ   C  -4.859   1.127  12.924 1.00 . A A . 13 ARG CZ   1 1 
        9  8656 1 1 13 ARG H    H  -2.478  -3.582   8.043 1.00 . A A . 13 ARG H    1 1 
        9  8657 1 1 13 ARG HA   H  -3.522  -2.724  10.592 1.00 . A A . 13 ARG HA   1 1 
        9  8658 1 1 13 ARG HB2  H  -1.741  -1.615   8.898 1.00 . A A . 13 ARG HB2  1 1 
        9  8659 1 1 13 ARG HB3  H  -3.200  -0.758   8.401 1.00 . A A . 13 ARG HB3  1 1 
        9  8660 1 1 13 ARG HD2  H  -4.274   0.894  10.113 1.00 . A A . 13 ARG HD2  1 1 
        9  8661 1 1 13 ARG HD3  H  -4.608  -0.629  10.937 1.00 . A A . 13 ARG HD3  1 1 
        9  8662 1 1 13 ARG HE   H  -2.923   1.148  12.439 1.00 . A A . 13 ARG HE   1 1 
        9  8663 1 1 13 ARG HG2  H  -2.109  -0.886  11.210 1.00 . A A . 13 ARG HG2  1 1 
        9  8664 1 1 13 ARG HG3  H  -1.938   0.475  10.091 1.00 . A A . 13 ARG HG3  1 1 
        9  8665 1 1 13 ARG HH11 H  -6.222   0.303  11.678 1.00 . A A . 13 ARG HH11 1 1 
        9  8666 1 1 13 ARG HH12 H  -6.862   0.963  13.145 1.00 . A A . 13 ARG HH12 1 1 
        9  8667 1 1 13 ARG HH21 H  -3.763   2.019  14.370 1.00 . A A . 13 ARG HH21 1 1 
        9  8668 1 1 13 ARG HH22 H  -5.466   1.938  14.673 1.00 . A A . 13 ARG HH22 1 1 
        9  8669 1 1 13 ARG N    N  -3.015  -3.709   8.851 1.00 . A A . 13 ARG N    1 1 
        9  8670 1 1 13 ARG NE   N  -3.814   0.871  12.140 1.00 . A A . 13 ARG NE   1 1 
        9  8671 1 1 13 ARG NH1  N  -6.082   0.769  12.552 1.00 . A A . 13 ARG NH1  1 1 
        9  8672 1 1 13 ARG NH2  N  -4.681   1.746  14.084 1.00 . A A . 13 ARG NH2  1 1 
        9  8673 1 1 13 ARG O    O  -5.920  -2.381   9.961 1.00 . A A . 13 ARG O    1 1 
        9  8674 1 1 14 PHE C    C  -7.274  -3.032   6.934 1.00 . A A . 14 PHE C    1 1 
        9  8675 1 1 14 PHE CA   C  -6.553  -1.743   7.334 1.00 . A A . 14 PHE CA   1 1 
        9  8676 1 1 14 PHE CB   C  -6.428  -0.811   6.140 1.00 . A A . 14 PHE CB   1 1 
        9  8677 1 1 14 PHE CD1  C  -6.684   1.541   6.967 1.00 . A A . 14 PHE CD1  1 1 
        9  8678 1 1 14 PHE CD2  C  -4.505   0.776   6.402 1.00 . A A . 14 PHE CD2  1 1 
        9  8679 1 1 14 PHE CE1  C  -6.167   2.765   7.310 1.00 . A A . 14 PHE CE1  1 1 
        9  8680 1 1 14 PHE CE2  C  -3.984   1.997   6.746 1.00 . A A . 14 PHE CE2  1 1 
        9  8681 1 1 14 PHE CG   C  -5.862   0.530   6.505 1.00 . A A . 14 PHE CG   1 1 
        9  8682 1 1 14 PHE CZ   C  -4.817   2.989   7.199 1.00 . A A . 14 PHE CZ   1 1 
        9  8683 1 1 14 PHE H    H  -4.469  -1.948   7.242 1.00 . A A . 14 PHE H    1 1 
        9  8684 1 1 14 PHE HA   H  -7.122  -1.247   8.105 1.00 . A A . 14 PHE HA   1 1 
        9  8685 1 1 14 PHE HB2  H  -5.777  -1.260   5.405 1.00 . A A . 14 PHE HB2  1 1 
        9  8686 1 1 14 PHE HB3  H  -7.396  -0.661   5.711 1.00 . A A . 14 PHE HB3  1 1 
        9  8687 1 1 14 PHE HD1  H  -7.736   1.369   7.056 1.00 . A A . 14 PHE HD1  1 1 
        9  8688 1 1 14 PHE HD2  H  -3.852   0.008   6.048 1.00 . A A . 14 PHE HD2  1 1 
        9  8689 1 1 14 PHE HE1  H  -6.820   3.547   7.668 1.00 . A A . 14 PHE HE1  1 1 
        9  8690 1 1 14 PHE HE2  H  -2.923   2.175   6.663 1.00 . A A . 14 PHE HE2  1 1 
        9  8691 1 1 14 PHE HZ   H  -4.417   3.933   7.465 1.00 . A A . 14 PHE HZ   1 1 
        9  8692 1 1 14 PHE N    N  -5.227  -2.006   7.854 1.00 . A A . 14 PHE N    1 1 
        9  8693 1 1 14 PHE O    O  -8.359  -2.987   6.352 1.00 . A A . 14 PHE O    1 1 
        9  8694 1 1 15 GLY C    C  -7.431  -5.653   5.420 1.00 . A A . 15 GLY C    1 1 
        9  8695 1 1 15 GLY CA   C  -7.283  -5.450   6.915 1.00 . A A . 15 GLY CA   1 1 
        9  8696 1 1 15 GLY H    H  -5.812  -4.159   7.715 1.00 . A A . 15 GLY H    1 1 
        9  8697 1 1 15 GLY HA2  H  -6.671  -6.246   7.314 1.00 . A A . 15 GLY HA2  1 1 
        9  8698 1 1 15 GLY HA3  H  -8.260  -5.500   7.372 1.00 . A A . 15 GLY HA3  1 1 
        9  8699 1 1 15 GLY N    N  -6.673  -4.177   7.250 1.00 . A A . 15 GLY N    1 1 
        9  8700 1 1 15 GLY O    O  -7.719  -4.709   4.683 1.00 . A A . 15 GLY O    1 1 
        9  8701 1 1 16 GLN C    C  -8.753  -6.920   3.037 1.00 . A A . 16 GLN C    1 1 
        9  8702 1 1 16 GLN CA   C  -7.349  -7.215   3.555 1.00 . A A . 16 GLN CA   1 1 
        9  8703 1 1 16 GLN CB   C  -7.006  -8.688   3.322 1.00 . A A . 16 GLN CB   1 1 
        9  8704 1 1 16 GLN CD   C  -5.439  -9.573   5.093 1.00 . A A . 16 GLN CD   1 1 
        9  8705 1 1 16 GLN CG   C  -5.572  -9.043   3.679 1.00 . A A . 16 GLN CG   1 1 
        9  8706 1 1 16 GLN H    H  -7.009  -7.598   5.608 1.00 . A A . 16 GLN H    1 1 
        9  8707 1 1 16 GLN HA   H  -6.642  -6.601   3.014 1.00 . A A . 16 GLN HA   1 1 
        9  8708 1 1 16 GLN HB2  H  -7.666  -9.297   3.920 1.00 . A A . 16 GLN HB2  1 1 
        9  8709 1 1 16 GLN HB3  H  -7.163  -8.921   2.278 1.00 . A A . 16 GLN HB3  1 1 
        9  8710 1 1 16 GLN HE21 H  -3.482  -9.836   4.833 1.00 . A A . 16 GLN HE21 1 1 
        9  8711 1 1 16 GLN HE22 H  -4.104 -10.280   6.391 1.00 . A A . 16 GLN HE22 1 1 
        9  8712 1 1 16 GLN HG2  H  -5.221  -9.801   2.993 1.00 . A A . 16 GLN HG2  1 1 
        9  8713 1 1 16 GLN HG3  H  -4.961  -8.159   3.582 1.00 . A A . 16 GLN HG3  1 1 
        9  8714 1 1 16 GLN N    N  -7.235  -6.888   4.971 1.00 . A A . 16 GLN N    1 1 
        9  8715 1 1 16 GLN NE2  N  -4.219  -9.933   5.478 1.00 . A A . 16 GLN NE2  1 1 
        9  8716 1 1 16 GLN O    O  -8.936  -6.593   1.863 1.00 . A A . 16 GLN O    1 1 
        9  8717 1 1 16 GLN OE1  O  -6.420  -9.660   5.832 1.00 . A A . 16 GLN OE1  1 1 
        9  8718 1 1 17 THR C    C -11.300  -5.364   3.013 1.00 . A A . 17 THR C    1 1 
        9  8719 1 1 17 THR CA   C -11.130  -6.782   3.548 1.00 . A A . 17 THR CA   1 1 
        9  8720 1 1 17 THR CB   C -12.040  -6.998   4.753 1.00 . A A . 17 THR CB   1 1 
        9  8721 1 1 17 THR CG2  C -13.510  -6.809   4.430 1.00 . A A . 17 THR CG2  1 1 
        9  8722 1 1 17 THR H    H  -9.533  -7.301   4.838 1.00 . A A . 17 THR H    1 1 
        9  8723 1 1 17 THR HA   H -11.390  -7.483   2.772 1.00 . A A . 17 THR HA   1 1 
        9  8724 1 1 17 THR HB   H -11.780  -6.288   5.525 1.00 . A A . 17 THR HB   1 1 
        9  8725 1 1 17 THR HG1  H -11.890  -8.268   6.236 1.00 . A A . 17 THR HG1  1 1 
        9  8726 1 1 17 THR HG21 H -13.740  -5.753   4.405 1.00 . A A . 17 THR HG21 1 1 
        9  8727 1 1 17 THR HG22 H -14.110  -7.289   5.187 1.00 . A A . 17 THR HG22 1 1 
        9  8728 1 1 17 THR HG23 H -13.730  -7.247   3.467 1.00 . A A . 17 THR HG23 1 1 
        9  8729 1 1 17 THR N    N  -9.742  -7.037   3.918 1.00 . A A . 17 THR N    1 1 
        9  8730 1 1 17 THR O    O -11.730  -5.168   1.876 1.00 . A A . 17 THR O    1 1 
        9  8731 1 1 17 THR OG1  O -11.880  -8.304   5.277 1.00 . A A . 17 THR OG1  1 1 
        9  8732 1 1 18 LYS C    C -10.000  -2.608   2.425 1.00 . A A . 18 LYS C    1 1 
        9  8733 1 1 18 LYS CA   C -11.070  -2.979   3.446 1.00 . A A . 18 LYS CA   1 1 
        9  8734 1 1 18 LYS CB   C -10.960  -2.073   4.673 1.00 . A A . 18 LYS CB   1 1 
        9  8735 1 1 18 LYS CD   C -10.690   0.399   4.298 1.00 . A A . 18 LYS CD   1 1 
        9  8736 1 1 18 LYS CE   C -11.230   1.716   4.824 1.00 . A A . 18 LYS CE   1 1 
        9  8737 1 1 18 LYS CG   C -11.670  -0.738   4.512 1.00 . A A . 18 LYS CG   1 1 
        9  8738 1 1 18 LYS H    H -10.620  -4.598   4.731 1.00 . A A . 18 LYS H    1 1 
        9  8739 1 1 18 LYS HA   H -12.050  -2.842   2.996 1.00 . A A . 18 LYS HA   1 1 
        9  8740 1 1 18 LYS HB2  H -11.390  -2.583   5.524 1.00 . A A . 18 LYS HB2  1 1 
        9  8741 1 1 18 LYS HB3  H  -9.922  -1.880   4.869 1.00 . A A . 18 LYS HB3  1 1 
        9  8742 1 1 18 LYS HD2  H  -9.773   0.169   4.817 1.00 . A A . 18 LYS HD2  1 1 
        9  8743 1 1 18 LYS HD3  H -10.490   0.497   3.240 1.00 . A A . 18 LYS HD3  1 1 
        9  8744 1 1 18 LYS HE2  H -11.360   1.636   5.893 1.00 . A A . 18 LYS HE2  1 1 
        9  8745 1 1 18 LYS HE3  H -10.520   2.499   4.607 1.00 . A A . 18 LYS HE3  1 1 
        9  8746 1 1 18 LYS HG2  H -12.330  -0.794   3.658 1.00 . A A . 18 LYS HG2  1 1 
        9  8747 1 1 18 LYS HG3  H -12.250  -0.540   5.402 1.00 . A A . 18 LYS HG3  1 1 
        9  8748 1 1 18 LYS HZ1  H -13.320   1.757   4.815 1.00 . A A . 18 LYS HZ1  1 1 
        9  8749 1 1 18 LYS HZ2  H -12.630   1.592   3.279 1.00 . A A . 18 LYS HZ2  1 1 
        9  8750 1 1 18 LYS HZ3  H -12.610   3.092   4.060 1.00 . A A . 18 LYS HZ3  1 1 
        9  8751 1 1 18 LYS N    N -10.960  -4.379   3.837 1.00 . A A . 18 LYS N    1 1 
        9  8752 1 1 18 LYS NZ   N -12.540   2.064   4.201 1.00 . A A . 18 LYS NZ   1 1 
        9  8753 1 1 18 LYS O    O -10.220  -1.755   1.565 1.00 . A A . 18 LYS O    1 1 
        9  8754 1 1 19 THR C    C  -8.080  -3.478   0.205 1.00 . A A . 19 THR C    1 1 
        9  8755 1 1 19 THR CA   C  -7.748  -2.994   1.613 1.00 . A A . 19 THR CA   1 1 
        9  8756 1 1 19 THR CB   C  -6.474  -3.679   2.112 1.00 . A A . 19 THR CB   1 1 
        9  8757 1 1 19 THR CG2  C  -5.268  -3.409   1.238 1.00 . A A . 19 THR CG2  1 1 
        9  8758 1 1 19 THR H    H  -8.739  -3.925   3.234 1.00 . A A . 19 THR H    1 1 
        9  8759 1 1 19 THR HA   H  -7.585  -1.927   1.586 1.00 . A A . 19 THR HA   1 1 
        9  8760 1 1 19 THR HB   H  -6.637  -4.747   2.131 1.00 . A A . 19 THR HB   1 1 
        9  8761 1 1 19 THR HG1  H  -6.040  -4.020   3.991 1.00 . A A . 19 THR HG1  1 1 
        9  8762 1 1 19 THR HG21 H  -4.384  -3.811   1.711 1.00 . A A . 19 THR HG21 1 1 
        9  8763 1 1 19 THR HG22 H  -5.152  -2.344   1.104 1.00 . A A . 19 THR HG22 1 1 
        9  8764 1 1 19 THR HG23 H  -5.407  -3.881   0.276 1.00 . A A . 19 THR HG23 1 1 
        9  8765 1 1 19 THR N    N  -8.853  -3.257   2.527 1.00 . A A . 19 THR N    1 1 
        9  8766 1 1 19 THR O    O  -8.049  -2.703  -0.751 1.00 . A A . 19 THR O    1 1 
        9  8767 1 1 19 THR OG1  O  -6.158  -3.253   3.425 1.00 . A A . 19 THR OG1  1 1 
        9  8768 1 1 20 ALA C    C  -9.963  -4.680  -1.809 1.00 . A A . 20 ALA C    1 1 
        9  8769 1 1 20 ALA CA   C  -8.734  -5.350  -1.205 1.00 . A A . 20 ALA CA   1 1 
        9  8770 1 1 20 ALA CB   C  -8.964  -6.847  -1.058 1.00 . A A . 20 ALA CB   1 1 
        9  8771 1 1 20 ALA H    H  -8.402  -5.329   0.885 1.00 . A A . 20 ALA H    1 1 
        9  8772 1 1 20 ALA HA   H  -7.894  -5.202  -1.868 1.00 . A A . 20 ALA HA   1 1 
        9  8773 1 1 20 ALA HB1  H  -8.658  -7.348  -1.965 1.00 . A A . 20 ALA HB1  1 1 
        9  8774 1 1 20 ALA HB2  H -10.010  -7.036  -0.880 1.00 . A A . 20 ALA HB2  1 1 
        9  8775 1 1 20 ALA HB3  H  -8.384  -7.220  -0.228 1.00 . A A . 20 ALA HB3  1 1 
        9  8776 1 1 20 ALA N    N  -8.396  -4.763   0.086 1.00 . A A . 20 ALA N    1 1 
        9  8777 1 1 20 ALA O    O -10.100  -4.603  -3.030 1.00 . A A . 20 ALA O    1 1 
        9  8778 1 1 21 LYS C    C -11.770  -2.126  -1.895 1.00 . A A . 21 LYS C    1 1 
        9  8779 1 1 21 LYS CA   C -12.070  -3.536  -1.397 1.00 . A A . 21 LYS CA   1 1 
        9  8780 1 1 21 LYS CB   C -13.090  -3.484  -0.262 1.00 . A A . 21 LYS CB   1 1 
        9  8781 1 1 21 LYS CD   C -14.630  -1.508  -0.472 1.00 . A A . 21 LYS CD   1 1 
        9  8782 1 1 21 LYS CE   C -15.480  -1.223   0.759 1.00 . A A . 21 LYS CE   1 1 
        9  8783 1 1 21 LYS CG   C -14.460  -3.002  -0.703 1.00 . A A . 21 LYS CG   1 1 
        9  8784 1 1 21 LYS H    H -10.680  -4.291   0.014 1.00 . A A . 21 LYS H    1 1 
        9  8785 1 1 21 LYS HA   H -12.480  -4.115  -2.212 1.00 . A A . 21 LYS HA   1 1 
        9  8786 1 1 21 LYS HB2  H -13.200  -4.473   0.158 1.00 . A A . 21 LYS HB2  1 1 
        9  8787 1 1 21 LYS HB3  H -12.730  -2.815   0.505 1.00 . A A . 21 LYS HB3  1 1 
        9  8788 1 1 21 LYS HD2  H -13.660  -1.063  -0.337 1.00 . A A . 21 LYS HD2  1 1 
        9  8789 1 1 21 LYS HD3  H -15.110  -1.072  -1.337 1.00 . A A . 21 LYS HD3  1 1 
        9  8790 1 1 21 LYS HE2  H -16.450  -0.882   0.440 1.00 . A A . 21 LYS HE2  1 1 
        9  8791 1 1 21 LYS HE3  H -15.580  -2.135   1.326 1.00 . A A . 21 LYS HE3  1 1 
        9  8792 1 1 21 LYS HG2  H -14.590  -3.210  -1.756 1.00 . A A . 21 LYS HG2  1 1 
        9  8793 1 1 21 LYS HG3  H -15.220  -3.531  -0.139 1.00 . A A . 21 LYS HG3  1 1 
        9  8794 1 1 21 LYS HZ1  H -14.180  -0.616   2.277 1.00 . A A . 21 LYS HZ1  1 1 
        9  8795 1 1 21 LYS HZ2  H -15.590   0.299   2.185 1.00 . A A . 21 LYS HZ2  1 1 
        9  8796 1 1 21 LYS HZ3  H -14.370   0.527   1.043 1.00 . A A . 21 LYS HZ3  1 1 
        9  8797 1 1 21 LYS N    N -10.850  -4.198  -0.948 1.00 . A A . 21 LYS N    1 1 
        9  8798 1 1 21 LYS NZ   N -14.860  -0.181   1.627 1.00 . A A . 21 LYS NZ   1 1 
        9  8799 1 1 21 LYS O    O -12.350  -1.670  -2.883 1.00 . A A . 21 LYS O    1 1 
        9  8800 1 1 22 ASP C    C  -9.608  -0.079  -2.818 1.00 . A A . 22 ASP C    1 1 
        9  8801 1 1 22 ASP CA   C -10.490  -0.079  -1.579 1.00 . A A . 22 ASP CA   1 1 
        9  8802 1 1 22 ASP CB   C  -9.779   0.608  -0.416 1.00 . A A . 22 ASP CB   1 1 
        9  8803 1 1 22 ASP CG   C -10.690   1.520   0.374 1.00 . A A . 22 ASP CG   1 1 
        9  8804 1 1 22 ASP H    H -10.440  -1.854  -0.429 1.00 . A A . 22 ASP H    1 1 
        9  8805 1 1 22 ASP HA   H -11.400   0.463  -1.800 1.00 . A A . 22 ASP HA   1 1 
        9  8806 1 1 22 ASP HB2  H  -9.389  -0.146   0.254 1.00 . A A . 22 ASP HB2  1 1 
        9  8807 1 1 22 ASP HB3  H  -8.960   1.198  -0.805 1.00 . A A . 22 ASP HB3  1 1 
        9  8808 1 1 22 ASP N    N -10.870  -1.438  -1.206 1.00 . A A . 22 ASP N    1 1 
        9  8809 1 1 22 ASP O    O  -9.663   0.841  -3.634 1.00 . A A . 22 ASP O    1 1 
        9  8810 1 1 22 ASP OD1  O -11.930   1.392   0.228 1.00 . A A . 22 ASP OD1  1 1 
        9  8811 1 1 22 ASP OD2  O -10.180   2.362   1.139 1.00 . A A . 22 ASP OD2  1 1 
        9  8812 1 1 23 LEU C    C  -8.625  -1.782  -5.314 1.00 . A A . 23 LEU C    1 1 
        9  8813 1 1 23 LEU CA   C  -7.888  -1.236  -4.094 1.00 . A A . 23 LEU CA   1 1 
        9  8814 1 1 23 LEU CB   C  -6.707  -2.145  -3.747 1.00 . A A . 23 LEU CB   1 1 
        9  8815 1 1 23 LEU CD1  C  -5.457  -1.539  -1.657 1.00 . A A . 23 LEU CD1  1 1 
        9  8816 1 1 23 LEU CD2  C  -4.203  -1.989  -3.773 1.00 . A A . 23 LEU CD2  1 1 
        9  8817 1 1 23 LEU CG   C  -5.483  -1.427  -3.173 1.00 . A A . 23 LEU CG   1 1 
        9  8818 1 1 23 LEU H    H  -8.791  -1.819  -2.271 1.00 . A A . 23 LEU H    1 1 
        9  8819 1 1 23 LEU HA   H  -7.515  -0.250  -4.326 1.00 . A A . 23 LEU HA   1 1 
        9  8820 1 1 23 LEU HB2  H  -7.044  -2.875  -3.022 1.00 . A A . 23 LEU HB2  1 1 
        9  8821 1 1 23 LEU HB3  H  -6.406  -2.666  -4.642 1.00 . A A . 23 LEU HB3  1 1 
        9  8822 1 1 23 LEU HD11 H  -5.843  -2.504  -1.361 1.00 . A A . 23 LEU HD11 1 1 
        9  8823 1 1 23 LEU HD12 H  -6.068  -0.760  -1.227 1.00 . A A . 23 LEU HD12 1 1 
        9  8824 1 1 23 LEU HD13 H  -4.441  -1.436  -1.306 1.00 . A A . 23 LEU HD13 1 1 
        9  8825 1 1 23 LEU HD21 H  -4.143  -1.713  -4.816 1.00 . A A . 23 LEU HD21 1 1 
        9  8826 1 1 23 LEU HD22 H  -4.208  -3.066  -3.687 1.00 . A A . 23 LEU HD22 1 1 
        9  8827 1 1 23 LEU HD23 H  -3.351  -1.590  -3.245 1.00 . A A . 23 LEU HD23 1 1 
        9  8828 1 1 23 LEU HG   H  -5.539  -0.378  -3.427 1.00 . A A . 23 LEU HG   1 1 
        9  8829 1 1 23 LEU N    N  -8.789  -1.117  -2.953 1.00 . A A . 23 LEU N    1 1 
        9  8830 1 1 23 LEU O    O  -8.270  -1.477  -6.453 1.00 . A A . 23 LEU O    1 1 
        9  8831 1 1 24 GLY C    C  -9.849  -4.492  -6.629 1.00 . A A . 24 GLY C    1 1 
        9  8832 1 1 24 GLY CA   C -10.410  -3.167  -6.157 1.00 . A A . 24 GLY CA   1 1 
        9  8833 1 1 24 GLY H    H  -9.886  -2.801  -4.141 1.00 . A A . 24 GLY H    1 1 
        9  8834 1 1 24 GLY HA2  H -11.430  -3.320  -5.825 1.00 . A A . 24 GLY HA2  1 1 
        9  8835 1 1 24 GLY HA3  H -10.420  -2.475  -6.985 1.00 . A A . 24 GLY HA3  1 1 
        9  8836 1 1 24 GLY N    N  -9.650  -2.592  -5.069 1.00 . A A . 24 GLY N    1 1 
        9  8837 1 1 24 GLY O    O  -9.996  -4.858  -7.794 1.00 . A A . 24 GLY O    1 1 
        9  8838 1 1 25 VAL C    C  -9.080  -7.582  -5.079 1.00 . A A . 25 VAL C    1 1 
        9  8839 1 1 25 VAL CA   C  -8.607  -6.500  -6.045 1.00 . A A . 25 VAL CA   1 1 
        9  8840 1 1 25 VAL CB   C  -7.068  -6.435  -6.011 1.00 . A A . 25 VAL CB   1 1 
        9  8841 1 1 25 VAL CG1  C  -6.541  -5.627  -7.187 1.00 . A A . 25 VAL CG1  1 1 
        9  8842 1 1 25 VAL CG2  C  -6.588  -5.850  -4.693 1.00 . A A . 25 VAL CG2  1 1 
        9  8843 1 1 25 VAL H    H  -9.117  -4.864  -4.806 1.00 . A A . 25 VAL H    1 1 
        9  8844 1 1 25 VAL HA   H  -8.914  -6.767  -7.046 1.00 . A A . 25 VAL HA   1 1 
        9  8845 1 1 25 VAL HB   H  -6.682  -7.441  -6.095 1.00 . A A . 25 VAL HB   1 1 
        9  8846 1 1 25 VAL HG11 H  -7.103  -4.709  -7.272 1.00 . A A . 25 VAL HG11 1 1 
        9  8847 1 1 25 VAL HG12 H  -6.649  -6.201  -8.096 1.00 . A A . 25 VAL HG12 1 1 
        9  8848 1 1 25 VAL HG13 H  -5.498  -5.397  -7.028 1.00 . A A . 25 VAL HG13 1 1 
        9  8849 1 1 25 VAL HG21 H  -5.698  -6.371  -4.370 1.00 . A A . 25 VAL HG21 1 1 
        9  8850 1 1 25 VAL HG22 H  -7.361  -5.960  -3.947 1.00 . A A . 25 VAL HG22 1 1 
        9  8851 1 1 25 VAL HG23 H  -6.362  -4.801  -4.826 1.00 . A A . 25 VAL HG23 1 1 
        9  8852 1 1 25 VAL N    N  -9.200  -5.210  -5.719 1.00 . A A . 25 VAL N    1 1 
        9  8853 1 1 25 VAL O    O  -9.876  -7.318  -4.179 1.00 . A A . 25 VAL O    1 1 
        9  8854 1 1 26 GLN C    C  -7.922 -10.115  -3.310 1.00 . A A . 26 GLN C    1 1 
        9  8855 1 1 26 GLN CA   C  -8.950  -9.919  -4.418 1.00 . A A . 26 GLN CA   1 1 
        9  8856 1 1 26 GLN CB   C  -9.077 -11.201  -5.244 1.00 . A A . 26 GLN CB   1 1 
        9  8857 1 1 26 GLN CD   C  -9.298 -10.317  -7.601 1.00 . A A . 26 GLN CD   1 1 
        9  8858 1 1 26 GLN CG   C  -9.976 -11.053  -6.461 1.00 . A A . 26 GLN CG   1 1 
        9  8859 1 1 26 GLN H    H  -7.951  -8.948  -6.003 1.00 . A A . 26 GLN H    1 1 
        9  8860 1 1 26 GLN HA   H  -9.906  -9.695  -3.969 1.00 . A A . 26 GLN HA   1 1 
        9  8861 1 1 26 GLN HB2  H  -8.094 -11.495  -5.583 1.00 . A A . 26 GLN HB2  1 1 
        9  8862 1 1 26 GLN HB3  H  -9.481 -11.981  -4.617 1.00 . A A . 26 GLN HB3  1 1 
        9  8863 1 1 26 GLN HE21 H  -7.876 -11.705  -7.682 1.00 . A A . 26 GLN HE21 1 1 
        9  8864 1 1 26 GLN HE22 H  -7.730 -10.413  -8.820 1.00 . A A . 26 GLN HE22 1 1 
        9  8865 1 1 26 GLN HG2  H -10.250 -12.035  -6.806 1.00 . A A . 26 GLN HG2  1 1 
        9  8866 1 1 26 GLN HG3  H -10.860 -10.504  -6.174 1.00 . A A . 26 GLN HG3  1 1 
        9  8867 1 1 26 GLN N    N  -8.582  -8.800  -5.271 1.00 . A A . 26 GLN N    1 1 
        9  8868 1 1 26 GLN NE2  N  -8.189 -10.867  -8.083 1.00 . A A . 26 GLN NE2  1 1 
        9  8869 1 1 26 GLN O    O  -6.723  -9.931  -3.521 1.00 . A A . 26 GLN O    1 1 
        9  8870 1 1 26 GLN OE1  O  -9.764  -9.268  -8.042 1.00 . A A . 26 GLN OE1  1 1 
        9  8871 1 1 27 GLN C    C  -6.425 -11.707  -1.310 1.00 . A A . 27 GLN C    1 1 
        9  8872 1 1 27 GLN CA   C  -7.527 -10.706  -0.981 1.00 . A A . 27 GLN CA   1 1 
        9  8873 1 1 27 GLN CB   C  -8.339 -11.199   0.217 1.00 . A A . 27 GLN CB   1 1 
        9  8874 1 1 27 GLN CD   C -10.680 -10.835   1.081 1.00 . A A . 27 GLN CD   1 1 
        9  8875 1 1 27 GLN CG   C  -9.362 -10.192   0.716 1.00 . A A . 27 GLN CG   1 1 
        9  8876 1 1 27 GLN H    H  -9.365 -10.614  -2.027 1.00 . A A . 27 GLN H    1 1 
        9  8877 1 1 27 GLN HA   H  -7.072  -9.763  -0.730 1.00 . A A . 27 GLN HA   1 1 
        9  8878 1 1 27 GLN HB2  H  -8.863 -12.102  -0.064 1.00 . A A . 27 GLN HB2  1 1 
        9  8879 1 1 27 GLN HB3  H  -7.662 -11.425   1.028 1.00 . A A . 27 GLN HB3  1 1 
        9  8880 1 1 27 GLN HE21 H  -9.757 -12.132   2.268 1.00 . A A . 27 GLN HE21 1 1 
        9  8881 1 1 27 GLN HE22 H -11.470 -12.291   2.182 1.00 . A A . 27 GLN HE22 1 1 
        9  8882 1 1 27 GLN HG2  H  -8.966  -9.700   1.593 1.00 . A A . 27 GLN HG2  1 1 
        9  8883 1 1 27 GLN HG3  H  -9.535  -9.461  -0.059 1.00 . A A . 27 GLN HG3  1 1 
        9  8884 1 1 27 GLN N    N  -8.400 -10.486  -2.129 1.00 . A A . 27 GLN N    1 1 
        9  8885 1 1 27 GLN NE2  N -10.630 -11.856   1.929 1.00 . A A . 27 GLN NE2  1 1 
        9  8886 1 1 27 GLN O    O  -5.362 -11.705  -0.686 1.00 . A A . 27 GLN O    1 1 
        9  8887 1 1 27 GLN OE1  O -11.740 -10.420   0.606 1.00 . A A . 27 GLN OE1  1 1 
        9  8888 1 1 28 SER C    C  -4.497 -12.918  -3.351 1.00 . A A . 28 SER C    1 1 
        9  8889 1 1 28 SER CA   C  -5.717 -13.568  -2.707 1.00 . A A . 28 SER CA   1 1 
        9  8890 1 1 28 SER CB   C  -6.361 -14.553  -3.684 1.00 . A A . 28 SER CB   1 1 
        9  8891 1 1 28 SER H    H  -7.546 -12.512  -2.748 1.00 . A A . 28 SER H    1 1 
        9  8892 1 1 28 SER HA   H  -5.402 -14.104  -1.825 1.00 . A A . 28 SER HA   1 1 
        9  8893 1 1 28 SER HB2  H  -6.835 -14.004  -4.485 1.00 . A A . 28 SER HB2  1 1 
        9  8894 1 1 28 SER HB3  H  -5.599 -15.201  -4.093 1.00 . A A . 28 SER HB3  1 1 
        9  8895 1 1 28 SER HG   H  -7.348 -16.225  -3.429 1.00 . A A . 28 SER HG   1 1 
        9  8896 1 1 28 SER N    N  -6.684 -12.561  -2.291 1.00 . A A . 28 SER N    1 1 
        9  8897 1 1 28 SER O    O  -3.384 -13.435  -3.257 1.00 . A A . 28 SER O    1 1 
        9  8898 1 1 28 SER OG   O  -7.339 -15.349  -3.038 1.00 . A A . 28 SER OG   1 1 
        9  8899 1 1 29 ALA C    C  -2.661 -10.474  -3.647 1.00 . A A . 29 ALA C    1 1 
        9  8900 1 1 29 ALA CA   C  -3.633 -11.061  -4.664 1.00 . A A . 29 ALA CA   1 1 
        9  8901 1 1 29 ALA CB   C  -4.196  -9.963  -5.555 1.00 . A A . 29 ALA CB   1 1 
        9  8902 1 1 29 ALA H    H  -5.624 -11.419  -4.045 1.00 . A A . 29 ALA H    1 1 
        9  8903 1 1 29 ALA HA   H  -3.099 -11.762  -5.290 1.00 . A A . 29 ALA HA   1 1 
        9  8904 1 1 29 ALA HB1  H  -4.329 -10.345  -6.557 1.00 . A A . 29 ALA HB1  1 1 
        9  8905 1 1 29 ALA HB2  H  -3.511  -9.129  -5.575 1.00 . A A . 29 ALA HB2  1 1 
        9  8906 1 1 29 ALA HB3  H  -5.148  -9.636  -5.164 1.00 . A A . 29 ALA HB3  1 1 
        9  8907 1 1 29 ALA N    N  -4.714 -11.782  -4.005 1.00 . A A . 29 ALA N    1 1 
        9  8908 1 1 29 ALA O    O  -1.449 -10.489  -3.852 1.00 . A A . 29 ALA O    1 1 
        9  8909 1 1 30 ILE C    C  -1.492 -10.443  -0.858 1.00 . A A . 30 ILE C    1 1 
        9  8910 1 1 30 ILE CA   C  -2.378  -9.377  -1.496 1.00 . A A . 30 ILE CA   1 1 
        9  8911 1 1 30 ILE CB   C  -3.245  -8.700  -0.408 1.00 . A A . 30 ILE CB   1 1 
        9  8912 1 1 30 ILE CD1  C  -4.930  -7.700  -2.037 1.00 . A A . 30 ILE CD1  1 1 
        9  8913 1 1 30 ILE CG1  C  -3.899  -7.432  -0.962 1.00 . A A . 30 ILE CG1  1 1 
        9  8914 1 1 30 ILE CG2  C  -2.411  -8.366   0.823 1.00 . A A . 30 ILE CG2  1 1 
        9  8915 1 1 30 ILE H    H  -4.176  -9.984  -2.435 1.00 . A A . 30 ILE H    1 1 
        9  8916 1 1 30 ILE HA   H  -1.748  -8.625  -1.948 1.00 . A A . 30 ILE HA   1 1 
        9  8917 1 1 30 ILE HB   H  -4.017  -9.393  -0.111 1.00 . A A . 30 ILE HB   1 1 
        9  8918 1 1 30 ILE HD11 H  -5.523  -6.811  -2.197 1.00 . A A . 30 ILE HD11 1 1 
        9  8919 1 1 30 ILE HD12 H  -5.572  -8.511  -1.727 1.00 . A A . 30 ILE HD12 1 1 
        9  8920 1 1 30 ILE HD13 H  -4.429  -7.968  -2.955 1.00 . A A . 30 ILE HD13 1 1 
        9  8921 1 1 30 ILE HG12 H  -4.392  -6.908  -0.157 1.00 . A A . 30 ILE HG12 1 1 
        9  8922 1 1 30 ILE HG13 H  -3.135  -6.796  -1.385 1.00 . A A . 30 ILE HG13 1 1 
        9  8923 1 1 30 ILE HG21 H  -1.555  -7.775   0.529 1.00 . A A . 30 ILE HG21 1 1 
        9  8924 1 1 30 ILE HG22 H  -2.074  -9.280   1.289 1.00 . A A . 30 ILE HG22 1 1 
        9  8925 1 1 30 ILE HG23 H  -3.011  -7.805   1.523 1.00 . A A . 30 ILE HG23 1 1 
        9  8926 1 1 30 ILE N    N  -3.202  -9.962  -2.545 1.00 . A A . 30 ILE N    1 1 
        9  8927 1 1 30 ILE O    O  -0.372 -10.161  -0.431 1.00 . A A . 30 ILE O    1 1 
        9  8928 1 1 31 ASN C    C  -0.076 -13.158  -1.103 1.00 . A A . 31 ASN C    1 1 
        9  8929 1 1 31 ASN CA   C  -1.261 -12.778  -0.220 1.00 . A A . 31 ASN CA   1 1 
        9  8930 1 1 31 ASN CB   C  -2.178 -13.988  -0.030 1.00 . A A . 31 ASN CB   1 1 
        9  8931 1 1 31 ASN CG   C  -1.767 -14.843   1.153 1.00 . A A . 31 ASN CG   1 1 
        9  8932 1 1 31 ASN H    H  -2.898 -11.831  -1.158 1.00 . A A . 31 ASN H    1 1 
        9  8933 1 1 31 ASN HA   H  -0.892 -12.462   0.742 1.00 . A A . 31 ASN HA   1 1 
        9  8934 1 1 31 ASN HB2  H  -3.188 -13.645   0.134 1.00 . A A . 31 ASN HB2  1 1 
        9  8935 1 1 31 ASN HB3  H  -2.148 -14.599  -0.921 1.00 . A A . 31 ASN HB3  1 1 
        9  8936 1 1 31 ASN HD21 H  -2.922 -16.331   0.506 1.00 . A A . 31 ASN HD21 1 1 
        9  8937 1 1 31 ASN HD22 H  -2.049 -16.634   1.975 1.00 . A A . 31 ASN HD22 1 1 
        9  8938 1 1 31 ASN N    N  -2.002 -11.669  -0.800 1.00 . A A . 31 ASN N    1 1 
        9  8939 1 1 31 ASN ND2  N  -2.300 -16.058   1.218 1.00 . A A . 31 ASN ND2  1 1 
        9  8940 1 1 31 ASN O    O   1.027 -13.391  -0.608 1.00 . A A . 31 ASN O    1 1 
        9  8941 1 1 31 ASN OD1  O  -0.980 -14.419   1.997 1.00 . A A . 31 ASN OD1  1 1 
        9  8942 1 1 32 LYS C    C   1.732 -12.432  -3.525 1.00 . A A . 32 LYS C    1 1 
        9  8943 1 1 32 LYS CA   C   0.733 -13.568  -3.360 1.00 . A A . 32 LYS CA   1 1 
        9  8944 1 1 32 LYS CB   C   0.121 -13.922  -4.718 1.00 . A A . 32 LYS CB   1 1 
        9  8945 1 1 32 LYS CD   C  -1.060 -15.964  -5.591 1.00 . A A . 32 LYS CD   1 1 
        9  8946 1 1 32 LYS CE   C  -1.859 -15.677  -6.853 1.00 . A A . 32 LYS CE   1 1 
        9  8947 1 1 32 LYS CG   C  -1.119 -14.797  -4.619 1.00 . A A . 32 LYS CG   1 1 
        9  8948 1 1 32 LYS H    H  -1.213 -13.022  -2.742 1.00 . A A . 32 LYS H    1 1 
        9  8949 1 1 32 LYS HA   H   1.247 -14.428  -2.974 1.00 . A A . 32 LYS HA   1 1 
        9  8950 1 1 32 LYS HB2  H  -0.150 -13.008  -5.226 1.00 . A A . 32 LYS HB2  1 1 
        9  8951 1 1 32 LYS HB3  H   0.860 -14.446  -5.306 1.00 . A A . 32 LYS HB3  1 1 
        9  8952 1 1 32 LYS HD2  H  -0.030 -16.143  -5.863 1.00 . A A . 32 LYS HD2  1 1 
        9  8953 1 1 32 LYS HD3  H  -1.466 -16.842  -5.111 1.00 . A A . 32 LYS HD3  1 1 
        9  8954 1 1 32 LYS HE2  H  -2.906 -15.847  -6.648 1.00 . A A . 32 LYS HE2  1 1 
        9  8955 1 1 32 LYS HE3  H  -1.711 -14.644  -7.130 1.00 . A A . 32 LYS HE3  1 1 
        9  8956 1 1 32 LYS HG2  H  -1.194 -15.186  -3.614 1.00 . A A . 32 LYS HG2  1 1 
        9  8957 1 1 32 LYS HG3  H  -1.989 -14.197  -4.840 1.00 . A A . 32 LYS HG3  1 1 
        9  8958 1 1 32 LYS HZ1  H  -1.081 -17.454  -7.625 1.00 . A A . 32 LYS HZ1  1 1 
        9  8959 1 1 32 LYS HZ2  H  -0.689 -16.083  -8.534 1.00 . A A . 32 LYS HZ2  1 1 
        9  8960 1 1 32 LYS HZ3  H  -2.250 -16.731  -8.613 1.00 . A A . 32 LYS HZ3  1 1 
        9  8961 1 1 32 LYS N    N  -0.313 -13.217  -2.409 1.00 . A A . 32 LYS N    1 1 
        9  8962 1 1 32 LYS NZ   N  -1.440 -16.547  -7.986 1.00 . A A . 32 LYS NZ   1 1 
        9  8963 1 1 32 LYS O    O   2.890 -12.654  -3.877 1.00 . A A . 32 LYS O    1 1 
        9  8964 1 1 33 TRP C    C   3.191 -10.014  -2.320 1.00 . A A . 33 TRP C    1 1 
        9  8965 1 1 33 TRP CA   C   2.109 -10.038  -3.396 1.00 . A A . 33 TRP CA   1 1 
        9  8966 1 1 33 TRP CB   C   1.223  -8.805  -3.290 1.00 . A A . 33 TRP CB   1 1 
        9  8967 1 1 33 TRP CD1  C   0.557  -9.167  -5.704 1.00 . A A . 33 TRP CD1  1 1 
        9  8968 1 1 33 TRP CD2  C  -0.725  -7.698  -4.629 1.00 . A A . 33 TRP CD2  1 1 
        9  8969 1 1 33 TRP CE2  C  -1.187  -7.803  -5.953 1.00 . A A . 33 TRP CE2  1 1 
        9  8970 1 1 33 TRP CE3  C  -1.375  -6.836  -3.752 1.00 . A A . 33 TRP CE3  1 1 
        9  8971 1 1 33 TRP CG   C   0.397  -8.571  -4.505 1.00 . A A . 33 TRP CG   1 1 
        9  8972 1 1 33 TRP CH2  C  -2.898  -6.233  -5.540 1.00 . A A . 33 TRP CH2  1 1 
        9  8973 1 1 33 TRP CZ2  C  -2.273  -7.074  -6.422 1.00 . A A . 33 TRP CZ2  1 1 
        9  8974 1 1 33 TRP CZ3  C  -2.459  -6.111  -4.213 1.00 . A A . 33 TRP CZ3  1 1 
        9  8975 1 1 33 TRP H    H   0.341 -11.096  -3.003 1.00 . A A . 33 TRP H    1 1 
        9  8976 1 1 33 TRP HA   H   2.575 -10.054  -4.369 1.00 . A A . 33 TRP HA   1 1 
        9  8977 1 1 33 TRP HB2  H   0.548  -8.945  -2.474 1.00 . A A . 33 TRP HB2  1 1 
        9  8978 1 1 33 TRP HB3  H   1.833  -7.938  -3.117 1.00 . A A . 33 TRP HB3  1 1 
        9  8979 1 1 33 TRP HD1  H   1.323  -9.889  -5.903 1.00 . A A . 33 TRP HD1  1 1 
        9  8980 1 1 33 TRP HE1  H  -0.467  -8.985  -7.529 1.00 . A A . 33 TRP HE1  1 1 
        9  8981 1 1 33 TRP HE3  H  -1.049  -6.738  -2.727 1.00 . A A . 33 TRP HE3  1 1 
        9  8982 1 1 33 TRP HH2  H  -3.748  -5.648  -5.859 1.00 . A A . 33 TRP HH2  1 1 
        9  8983 1 1 33 TRP HZ2  H  -2.622  -7.159  -7.439 1.00 . A A . 33 TRP HZ2  1 1 
        9  8984 1 1 33 TRP HZ3  H  -2.978  -5.436  -3.548 1.00 . A A . 33 TRP HZ3  1 1 
        9  8985 1 1 33 TRP N    N   1.273 -11.213  -3.274 1.00 . A A . 33 TRP N    1 1 
        9  8986 1 1 33 TRP NE1  N  -0.383  -8.709  -6.594 1.00 . A A . 33 TRP NE1  1 1 
        9  8987 1 1 33 TRP O    O   4.367  -9.801  -2.614 1.00 . A A . 33 TRP O    1 1 
        9  8988 1 1 34 ILE C    C   4.466 -11.576   0.126 1.00 . A A . 34 ILE C    1 1 
        9  8989 1 1 34 ILE CA   C   3.722 -10.246   0.044 1.00 . A A . 34 ILE CA   1 1 
        9  8990 1 1 34 ILE CB   C   3.003  -9.988   1.383 1.00 . A A . 34 ILE CB   1 1 
        9  8991 1 1 34 ILE CD1  C   0.925  -8.779   2.221 1.00 . A A . 34 ILE CD1  1 1 
        9  8992 1 1 34 ILE CG1  C   2.114  -8.747   1.284 1.00 . A A . 34 ILE CG1  1 1 
        9  8993 1 1 34 ILE CG2  C   4.016  -9.833   2.507 1.00 . A A . 34 ILE CG2  1 1 
        9  8994 1 1 34 ILE H    H   1.835 -10.404  -0.904 1.00 . A A . 34 ILE H    1 1 
        9  8995 1 1 34 ILE HA   H   4.438  -9.452  -0.115 1.00 . A A . 34 ILE HA   1 1 
        9  8996 1 1 34 ILE HB   H   2.387 -10.848   1.605 1.00 . A A . 34 ILE HB   1 1 
        9  8997 1 1 34 ILE HD11 H   0.617  -7.769   2.443 1.00 . A A . 34 ILE HD11 1 1 
        9  8998 1 1 34 ILE HD12 H   1.203  -9.280   3.136 1.00 . A A . 34 ILE HD12 1 1 
        9  8999 1 1 34 ILE HD13 H   0.111  -9.310   1.750 1.00 . A A . 34 ILE HD13 1 1 
        9  9000 1 1 34 ILE HG12 H   2.701  -7.873   1.524 1.00 . A A . 34 ILE HG12 1 1 
        9  9001 1 1 34 ILE HG13 H   1.741  -8.659   0.274 1.00 . A A . 34 ILE HG13 1 1 
        9  9002 1 1 34 ILE HG21 H   4.636  -8.968   2.316 1.00 . A A . 34 ILE HG21 1 1 
        9  9003 1 1 34 ILE HG22 H   4.636 -10.716   2.559 1.00 . A A . 34 ILE HG22 1 1 
        9  9004 1 1 34 ILE HG23 H   3.496  -9.703   3.445 1.00 . A A . 34 ILE HG23 1 1 
        9  9005 1 1 34 ILE N    N   2.785 -10.238  -1.074 1.00 . A A . 34 ILE N    1 1 
        9  9006 1 1 34 ILE O    O   5.583 -11.642   0.638 1.00 . A A . 34 ILE O    1 1 
        9  9007 1 1 35 HIS C    C   5.743 -13.979  -1.153 1.00 . A A . 35 HIS C    1 1 
        9  9008 1 1 35 HIS CA   C   4.440 -13.960  -0.368 1.00 . A A . 35 HIS CA   1 1 
        9  9009 1 1 35 HIS CB   C   3.468 -14.983  -0.956 1.00 . A A . 35 HIS CB   1 1 
        9  9010 1 1 35 HIS CD2  C   2.061 -16.959  -0.051 1.00 . A A . 35 HIS CD2  1 1 
        9  9011 1 1 35 HIS CE1  C   2.024 -16.389   2.067 1.00 . A A . 35 HIS CE1  1 1 
        9  9012 1 1 35 HIS CG   C   2.760 -15.807   0.072 1.00 . A A . 35 HIS CG   1 1 
        9  9013 1 1 35 HIS H    H   2.951 -12.517  -0.778 1.00 . A A . 35 HIS H    1 1 
        9  9014 1 1 35 HIS HA   H   4.648 -14.219   0.654 1.00 . A A . 35 HIS HA   1 1 
        9  9015 1 1 35 HIS HB2  H   2.719 -14.464  -1.536 1.00 . A A . 35 HIS HB2  1 1 
        9  9016 1 1 35 HIS HB3  H   4.011 -15.654  -1.604 1.00 . A A . 35 HIS HB3  1 1 
        9  9017 1 1 35 HIS HD1  H   3.133 -14.688   1.820 1.00 . A A . 35 HIS HD1  1 1 
        9  9018 1 1 35 HIS HD2  H   1.886 -17.505  -0.966 1.00 . A A . 35 HIS HD2  1 1 
        9  9019 1 1 35 HIS HE1  H   1.825 -16.391   3.128 1.00 . A A . 35 HIS HE1  1 1 
        9  9020 1 1 35 HIS HE2  H   1.162 -18.137   1.437 1.00 . A A . 35 HIS HE2  1 1 
        9  9021 1 1 35 HIS N    N   3.839 -12.632  -0.383 1.00 . A A . 35 HIS N    1 1 
        9  9022 1 1 35 HIS ND1  N   2.717 -15.476   1.411 1.00 . A A . 35 HIS ND1  1 1 
        9  9023 1 1 35 HIS NE2  N   1.613 -17.300   1.202 1.00 . A A . 35 HIS NE2  1 1 
        9  9024 1 1 35 HIS O    O   6.695 -14.669  -0.788 1.00 . A A . 35 HIS O    1 1 
        9  9025 1 1 36 ALA C    C   7.789 -11.910  -2.781 1.00 . A A . 36 ALA C    1 1 
        9  9026 1 1 36 ALA CA   C   6.945 -13.145  -3.092 1.00 . A A . 36 ALA CA   1 1 
        9  9027 1 1 36 ALA CB   C   6.522 -13.146  -4.552 1.00 . A A . 36 ALA CB   1 1 
        9  9028 1 1 36 ALA H    H   4.972 -12.705  -2.466 1.00 . A A . 36 ALA H    1 1 
        9  9029 1 1 36 ALA HA   H   7.541 -14.028  -2.918 1.00 . A A . 36 ALA HA   1 1 
        9  9030 1 1 36 ALA HB1  H   5.856 -12.314  -4.734 1.00 . A A . 36 ALA HB1  1 1 
        9  9031 1 1 36 ALA HB2  H   6.011 -14.070  -4.779 1.00 . A A . 36 ALA HB2  1 1 
        9  9032 1 1 36 ALA HB3  H   7.395 -13.052  -5.181 1.00 . A A . 36 ALA HB3  1 1 
        9  9033 1 1 36 ALA N    N   5.768 -13.222  -2.236 1.00 . A A . 36 ALA N    1 1 
        9  9034 1 1 36 ALA O    O   8.745 -11.608  -3.494 1.00 . A A . 36 ALA O    1 1 
        9  9035 1 1 37 GLY C    C   8.078  -8.908  -2.369 1.00 . A A . 37 GLY C    1 1 
        9  9036 1 1 37 GLY CA   C   8.175 -10.013  -1.334 1.00 . A A . 37 GLY CA   1 1 
        9  9037 1 1 37 GLY H    H   6.665 -11.485  -1.179 1.00 . A A . 37 GLY H    1 1 
        9  9038 1 1 37 GLY HA2  H   7.789  -9.646  -0.395 1.00 . A A . 37 GLY HA2  1 1 
        9  9039 1 1 37 GLY HA3  H   9.214 -10.278  -1.204 1.00 . A A . 37 GLY HA3  1 1 
        9  9040 1 1 37 GLY N    N   7.434 -11.200  -1.714 1.00 . A A . 37 GLY N    1 1 
        9  9041 1 1 37 GLY O    O   8.974  -8.072  -2.478 1.00 . A A . 37 GLY O    1 1 
        9  9042 1 1 38 ARG C    C   6.555  -6.517  -3.518 1.00 . A A . 38 ARG C    1 1 
        9  9043 1 1 38 ARG CA   C   6.776  -7.887  -4.151 1.00 . A A . 38 ARG CA   1 1 
        9  9044 1 1 38 ARG CB   C   5.578  -8.257  -5.029 1.00 . A A . 38 ARG CB   1 1 
        9  9045 1 1 38 ARG CD   C   4.379  -7.829  -7.196 1.00 . A A . 38 ARG CD   1 1 
        9  9046 1 1 38 ARG CG   C   5.301  -7.251  -6.135 1.00 . A A . 38 ARG CG   1 1 
        9  9047 1 1 38 ARG CZ   C   3.240  -7.008  -9.222 1.00 . A A . 38 ARG CZ   1 1 
        9  9048 1 1 38 ARG H    H   6.303  -9.592  -2.988 1.00 . A A . 38 ARG H    1 1 
        9  9049 1 1 38 ARG HA   H   7.664  -7.849  -4.765 1.00 . A A . 38 ARG HA   1 1 
        9  9050 1 1 38 ARG HB2  H   5.764  -9.218  -5.485 1.00 . A A . 38 ARG HB2  1 1 
        9  9051 1 1 38 ARG HB3  H   4.699  -8.328  -4.407 1.00 . A A . 38 ARG HB3  1 1 
        9  9052 1 1 38 ARG HD2  H   4.950  -8.492  -7.829 1.00 . A A . 38 ARG HD2  1 1 
        9  9053 1 1 38 ARG HD3  H   3.594  -8.387  -6.708 1.00 . A A . 38 ARG HD3  1 1 
        9  9054 1 1 38 ARG HE   H   3.770  -5.874  -7.668 1.00 . A A . 38 ARG HE   1 1 
        9  9055 1 1 38 ARG HG2  H   4.835  -6.378  -5.705 1.00 . A A . 38 ARG HG2  1 1 
        9  9056 1 1 38 ARG HG3  H   6.236  -6.971  -6.597 1.00 . A A . 38 ARG HG3  1 1 
        9  9057 1 1 38 ARG HH11 H   3.620  -8.995  -9.222 1.00 . A A . 38 ARG HH11 1 1 
        9  9058 1 1 38 ARG HH12 H   2.824  -8.392 -10.636 1.00 . A A . 38 ARG HH12 1 1 
        9  9059 1 1 38 ARG HH21 H   2.721  -5.078  -9.527 1.00 . A A . 38 ARG HH21 1 1 
        9  9060 1 1 38 ARG HH22 H   2.313  -6.169 -10.810 1.00 . A A . 38 ARG HH22 1 1 
        9  9061 1 1 38 ARG N    N   6.985  -8.901  -3.126 1.00 . A A . 38 ARG N    1 1 
        9  9062 1 1 38 ARG NE   N   3.775  -6.787  -8.024 1.00 . A A . 38 ARG NE   1 1 
        9  9063 1 1 38 ARG NH1  N   3.227  -8.232  -9.735 1.00 . A A . 38 ARG NH1  1 1 
        9  9064 1 1 38 ARG NH2  N   2.714  -6.003  -9.909 1.00 . A A . 38 ARG NH2  1 1 
        9  9065 1 1 38 ARG O    O   5.482  -6.235  -2.987 1.00 . A A . 38 ARG O    1 1 
        9  9066 1 1 39 LYS C    C   6.361  -3.534  -3.635 1.00 . A A . 39 LYS C    1 1 
        9  9067 1 1 39 LYS CA   C   7.497  -4.334  -3.000 1.00 . A A . 39 LYS CA   1 1 
        9  9068 1 1 39 LYS CB   C   8.830  -3.595  -3.171 1.00 . A A . 39 LYS CB   1 1 
        9  9069 1 1 39 LYS CD   C   9.439  -4.312  -5.506 1.00 . A A . 39 LYS CD   1 1 
        9  9070 1 1 39 LYS CE   C  10.340  -3.893  -6.656 1.00 . A A . 39 LYS CE   1 1 
        9  9071 1 1 39 LYS CG   C   9.114  -3.138  -4.596 1.00 . A A . 39 LYS CG   1 1 
        9  9072 1 1 39 LYS H    H   8.411  -5.958  -4.007 1.00 . A A . 39 LYS H    1 1 
        9  9073 1 1 39 LYS HA   H   7.294  -4.443  -1.946 1.00 . A A . 39 LYS HA   1 1 
        9  9074 1 1 39 LYS HB2  H   8.827  -2.723  -2.534 1.00 . A A . 39 LYS HB2  1 1 
        9  9075 1 1 39 LYS HB3  H   9.631  -4.250  -2.862 1.00 . A A . 39 LYS HB3  1 1 
        9  9076 1 1 39 LYS HD2  H   9.941  -5.074  -4.930 1.00 . A A . 39 LYS HD2  1 1 
        9  9077 1 1 39 LYS HD3  H   8.518  -4.709  -5.907 1.00 . A A . 39 LYS HD3  1 1 
        9  9078 1 1 39 LYS HE2  H   9.731  -3.734  -7.534 1.00 . A A . 39 LYS HE2  1 1 
        9  9079 1 1 39 LYS HE3  H  10.836  -2.971  -6.392 1.00 . A A . 39 LYS HE3  1 1 
        9  9080 1 1 39 LYS HG2  H   8.246  -2.627  -4.981 1.00 . A A . 39 LYS HG2  1 1 
        9  9081 1 1 39 LYS HG3  H   9.956  -2.461  -4.584 1.00 . A A . 39 LYS HG3  1 1 
        9  9082 1 1 39 LYS HZ1  H  12.082  -4.538  -7.609 1.00 . A A . 39 LYS HZ1  1 1 
        9  9083 1 1 39 LYS HZ2  H  10.922  -5.752  -7.408 1.00 . A A . 39 LYS HZ2  1 1 
        9  9084 1 1 39 LYS HZ3  H  11.837  -5.232  -6.085 1.00 . A A . 39 LYS HZ3  1 1 
        9  9085 1 1 39 LYS N    N   7.580  -5.673  -3.574 1.00 . A A . 39 LYS N    1 1 
        9  9086 1 1 39 LYS NZ   N  11.367  -4.927  -6.961 1.00 . A A . 39 LYS NZ   1 1 
        9  9087 1 1 39 LYS O    O   6.232  -3.481  -4.857 1.00 . A A . 39 LYS O    1 1 
        9  9088 1 1 40 ILE C    C   4.008  -1.079  -2.224 1.00 . A A . 40 ILE C    1 1 
        9  9089 1 1 40 ILE CA   C   4.413  -2.118  -3.262 1.00 . A A . 40 ILE CA   1 1 
        9  9090 1 1 40 ILE CB   C   3.191  -3.001  -3.590 1.00 . A A . 40 ILE CB   1 1 
        9  9091 1 1 40 ILE CD1  C   2.392  -4.914  -5.068 1.00 . A A . 40 ILE CD1  1 1 
        9  9092 1 1 40 ILE CG1  C   3.570  -4.089  -4.596 1.00 . A A . 40 ILE CG1  1 1 
        9  9093 1 1 40 ILE CG2  C   2.048  -2.148  -4.126 1.00 . A A . 40 ILE CG2  1 1 
        9  9094 1 1 40 ILE H    H   5.695  -2.999  -1.828 1.00 . A A . 40 ILE H    1 1 
        9  9095 1 1 40 ILE HA   H   4.718  -1.612  -4.166 1.00 . A A . 40 ILE HA   1 1 
        9  9096 1 1 40 ILE HB   H   2.858  -3.467  -2.674 1.00 . A A . 40 ILE HB   1 1 
        9  9097 1 1 40 ILE HD11 H   1.696  -4.279  -5.594 1.00 . A A . 40 ILE HD11 1 1 
        9  9098 1 1 40 ILE HD12 H   1.900  -5.360  -4.216 1.00 . A A . 40 ILE HD12 1 1 
        9  9099 1 1 40 ILE HD13 H   2.740  -5.692  -5.731 1.00 . A A . 40 ILE HD13 1 1 
        9  9100 1 1 40 ILE HG12 H   4.019  -3.629  -5.463 1.00 . A A . 40 ILE HG12 1 1 
        9  9101 1 1 40 ILE HG13 H   4.282  -4.760  -4.140 1.00 . A A . 40 ILE HG13 1 1 
        9  9102 1 1 40 ILE HG21 H   1.682  -1.502  -3.341 1.00 . A A . 40 ILE HG21 1 1 
        9  9103 1 1 40 ILE HG22 H   1.248  -2.790  -4.466 1.00 . A A . 40 ILE HG22 1 1 
        9  9104 1 1 40 ILE HG23 H   2.403  -1.548  -4.951 1.00 . A A . 40 ILE HG23 1 1 
        9  9105 1 1 40 ILE N    N   5.540  -2.917  -2.791 1.00 . A A . 40 ILE N    1 1 
        9  9106 1 1 40 ILE O    O   4.272  -1.240  -1.032 1.00 . A A . 40 ILE O    1 1 
        9  9107 1 1 41 PHE C    C   1.591   1.641  -2.276 1.00 . A A . 41 PHE C    1 1 
        9  9108 1 1 41 PHE CA   C   2.908   1.048  -1.792 1.00 . A A . 41 PHE CA   1 1 
        9  9109 1 1 41 PHE CB   C   3.961   2.154  -1.690 1.00 . A A . 41 PHE CB   1 1 
        9  9110 1 1 41 PHE CD1  C   6.131   0.899  -1.555 1.00 . A A . 41 PHE CD1  1 1 
        9  9111 1 1 41 PHE CD2  C   5.451   2.190   0.330 1.00 . A A . 41 PHE CD2  1 1 
        9  9112 1 1 41 PHE CE1  C   7.276   0.516  -0.884 1.00 . A A . 41 PHE CE1  1 1 
        9  9113 1 1 41 PHE CE2  C   6.595   1.812   1.007 1.00 . A A . 41 PHE CE2  1 1 
        9  9114 1 1 41 PHE CG   C   5.205   1.739  -0.956 1.00 . A A . 41 PHE CG   1 1 
        9  9115 1 1 41 PHE CZ   C   7.509   0.973   0.399 1.00 . A A . 41 PHE CZ   1 1 
        9  9116 1 1 41 PHE H    H   3.171   0.053  -3.643 1.00 . A A . 41 PHE H    1 1 
        9  9117 1 1 41 PHE HA   H   2.757   0.615  -0.816 1.00 . A A . 41 PHE HA   1 1 
        9  9118 1 1 41 PHE HB2  H   4.250   2.459  -2.685 1.00 . A A . 41 PHE HB2  1 1 
        9  9119 1 1 41 PHE HB3  H   3.534   3.002  -1.169 1.00 . A A . 41 PHE HB3  1 1 
        9  9120 1 1 41 PHE HD1  H   5.950   0.541  -2.559 1.00 . A A . 41 PHE HD1  1 1 
        9  9121 1 1 41 PHE HD2  H   4.737   2.846   0.807 1.00 . A A . 41 PHE HD2  1 1 
        9  9122 1 1 41 PHE HE1  H   7.989  -0.140  -1.362 1.00 . A A . 41 PHE HE1  1 1 
        9  9123 1 1 41 PHE HE2  H   6.773   2.169   2.010 1.00 . A A . 41 PHE HE2  1 1 
        9  9124 1 1 41 PHE HZ   H   8.403   0.675   0.925 1.00 . A A . 41 PHE HZ   1 1 
        9  9125 1 1 41 PHE N    N   3.358  -0.015  -2.683 1.00 . A A . 41 PHE N    1 1 
        9  9126 1 1 41 PHE O    O   1.477   2.065  -3.426 1.00 . A A . 41 PHE O    1 1 
        9  9127 1 1 42 LEU C    C  -0.806   3.681  -1.302 1.00 . A A . 42 LEU C    1 1 
        9  9128 1 1 42 LEU CA   C  -0.702   2.224  -1.736 1.00 . A A . 42 LEU CA   1 1 
        9  9129 1 1 42 LEU CB   C  -1.839   1.407  -1.105 1.00 . A A . 42 LEU CB   1 1 
        9  9130 1 1 42 LEU CD1  C  -0.578  -0.575  -0.196 1.00 . A A . 42 LEU CD1  1 1 
        9  9131 1 1 42 LEU CD2  C  -0.844   1.489   1.208 1.00 . A A . 42 LEU CD2  1 1 
        9  9132 1 1 42 LEU CG   C  -1.483   0.600   0.150 1.00 . A A . 42 LEU CG   1 1 
        9  9133 1 1 42 LEU H    H   0.752   1.326  -0.489 1.00 . A A . 42 LEU H    1 1 
        9  9134 1 1 42 LEU HA   H  -0.798   2.181  -2.811 1.00 . A A . 42 LEU HA   1 1 
        9  9135 1 1 42 LEU HB2  H  -2.635   2.089  -0.846 1.00 . A A . 42 LEU HB2  1 1 
        9  9136 1 1 42 LEU HB3  H  -2.210   0.719  -1.850 1.00 . A A . 42 LEU HB3  1 1 
        9  9137 1 1 42 LEU HD11 H   0.293  -0.561   0.442 1.00 . A A . 42 LEU HD11 1 1 
        9  9138 1 1 42 LEU HD12 H  -0.270  -0.502  -1.227 1.00 . A A . 42 LEU HD12 1 1 
        9  9139 1 1 42 LEU HD13 H  -1.118  -1.499  -0.046 1.00 . A A . 42 LEU HD13 1 1 
        9  9140 1 1 42 LEU HD21 H  -1.605   1.838   1.891 1.00 . A A . 42 LEU HD21 1 1 
        9  9141 1 1 42 LEU HD22 H  -0.373   2.335   0.735 1.00 . A A . 42 LEU HD22 1 1 
        9  9142 1 1 42 LEU HD23 H  -0.104   0.924   1.754 1.00 . A A . 42 LEU HD23 1 1 
        9  9143 1 1 42 LEU HG   H  -2.389   0.200   0.564 1.00 . A A . 42 LEU HG   1 1 
        9  9144 1 1 42 LEU N    N   0.601   1.674  -1.391 1.00 . A A . 42 LEU N    1 1 
        9  9145 1 1 42 LEU O    O  -0.089   4.124  -0.406 1.00 . A A . 42 LEU O    1 1 
        9  9146 1 1 43 THR C    C  -3.353   6.108  -1.272 1.00 . A A . 43 THR C    1 1 
        9  9147 1 1 43 THR CA   C  -1.896   5.829  -1.614 1.00 . A A . 43 THR CA   1 1 
        9  9148 1 1 43 THR CB   C  -1.453   6.715  -2.778 1.00 . A A . 43 THR CB   1 1 
        9  9149 1 1 43 THR CG2  C  -0.852   8.030  -2.328 1.00 . A A . 43 THR CG2  1 1 
        9  9150 1 1 43 THR H    H  -2.245   4.014  -2.646 1.00 . A A . 43 THR H    1 1 
        9  9151 1 1 43 THR HA   H  -1.289   6.053  -0.752 1.00 . A A . 43 THR HA   1 1 
        9  9152 1 1 43 THR HB   H  -2.312   6.938  -3.394 1.00 . A A . 43 THR HB   1 1 
        9  9153 1 1 43 THR HG1  H   0.255   5.790  -3.029 1.00 . A A . 43 THR HG1  1 1 
        9  9154 1 1 43 THR HG21 H  -0.373   8.512  -3.166 1.00 . A A . 43 THR HG21 1 1 
        9  9155 1 1 43 THR HG22 H  -0.122   7.845  -1.553 1.00 . A A . 43 THR HG22 1 1 
        9  9156 1 1 43 THR HG23 H  -1.633   8.669  -1.942 1.00 . A A . 43 THR HG23 1 1 
        9  9157 1 1 43 THR N    N  -1.701   4.422  -1.941 1.00 . A A . 43 THR N    1 1 
        9  9158 1 1 43 THR O    O  -4.248   5.905  -2.096 1.00 . A A . 43 THR O    1 1 
        9  9159 1 1 43 THR OG1  O  -0.489   6.052  -3.576 1.00 . A A . 43 THR OG1  1 1 
        9  9160 1 1 44 ILE C    C  -5.342   8.291  -0.007 1.00 . A A . 44 ILE C    1 1 
        9  9161 1 1 44 ILE CA   C  -4.937   6.881   0.406 1.00 . A A . 44 ILE CA   1 1 
        9  9162 1 1 44 ILE CB   C  -5.063   6.750   1.936 1.00 . A A . 44 ILE CB   1 1 
        9  9163 1 1 44 ILE CD1  C  -4.135   5.423   3.900 1.00 . A A . 44 ILE CD1  1 1 
        9  9164 1 1 44 ILE CG1  C  -4.436   5.441   2.418 1.00 . A A . 44 ILE CG1  1 1 
        9  9165 1 1 44 ILE CG2  C  -6.524   6.827   2.352 1.00 . A A . 44 ILE CG2  1 1 
        9  9166 1 1 44 ILE H    H  -2.831   6.711   0.562 1.00 . A A . 44 ILE H    1 1 
        9  9167 1 1 44 ILE HA   H  -5.612   6.174  -0.053 1.00 . A A . 44 ILE HA   1 1 
        9  9168 1 1 44 ILE HB   H  -4.543   7.580   2.390 1.00 . A A . 44 ILE HB   1 1 
        9  9169 1 1 44 ILE HD11 H  -4.252   6.418   4.302 1.00 . A A . 44 ILE HD11 1 1 
        9  9170 1 1 44 ILE HD12 H  -3.121   5.086   4.058 1.00 . A A . 44 ILE HD12 1 1 
        9  9171 1 1 44 ILE HD13 H  -4.819   4.751   4.398 1.00 . A A . 44 ILE HD13 1 1 
        9  9172 1 1 44 ILE HG12 H  -5.112   4.626   2.207 1.00 . A A . 44 ILE HG12 1 1 
        9  9173 1 1 44 ILE HG13 H  -3.508   5.278   1.888 1.00 . A A . 44 ILE HG13 1 1 
        9  9174 1 1 44 ILE HG21 H  -7.045   7.524   1.713 1.00 . A A . 44 ILE HG21 1 1 
        9  9175 1 1 44 ILE HG22 H  -6.589   7.163   3.378 1.00 . A A . 44 ILE HG22 1 1 
        9  9176 1 1 44 ILE HG23 H  -6.975   5.850   2.265 1.00 . A A . 44 ILE HG23 1 1 
        9  9177 1 1 44 ILE N    N  -3.586   6.572  -0.049 1.00 . A A . 44 ILE N    1 1 
        9  9178 1 1 44 ILE O    O  -4.720   9.273   0.402 1.00 . A A . 44 ILE O    1 1 
        9  9179 1 1 45 ASN C    C  -7.735  10.355  -0.223 1.00 . A A . 45 ASN C    1 1 
        9  9180 1 1 45 ASN CA   C  -6.878   9.679  -1.287 1.00 . A A . 45 ASN CA   1 1 
        9  9181 1 1 45 ASN CB   C  -7.684   9.507  -2.576 1.00 . A A . 45 ASN CB   1 1 
        9  9182 1 1 45 ASN CG   C  -6.878   8.846  -3.678 1.00 . A A . 45 ASN CG   1 1 
        9  9183 1 1 45 ASN H    H  -6.843   7.569  -1.112 1.00 . A A . 45 ASN H    1 1 
        9  9184 1 1 45 ASN HA   H  -6.019  10.304  -1.490 1.00 . A A . 45 ASN HA   1 1 
        9  9185 1 1 45 ASN HB2  H  -8.550   8.896  -2.374 1.00 . A A . 45 ASN HB2  1 1 
        9  9186 1 1 45 ASN HB3  H  -8.006  10.477  -2.925 1.00 . A A . 45 ASN HB3  1 1 
        9  9187 1 1 45 ASN HD21 H  -8.552   8.332  -4.624 1.00 . A A . 45 ASN HD21 1 1 
        9  9188 1 1 45 ASN HD22 H  -7.072   7.849  -5.391 1.00 . A A . 45 ASN HD22 1 1 
        9  9189 1 1 45 ASN N    N  -6.389   8.387  -0.820 1.00 . A A . 45 ASN N    1 1 
        9  9190 1 1 45 ASN ND2  N  -7.571   8.287  -4.663 1.00 . A A . 45 ASN ND2  1 1 
        9  9191 1 1 45 ASN O    O  -8.162   9.720   0.742 1.00 . A A . 45 ASN O    1 1 
        9  9192 1 1 45 ASN OD1  O  -5.648   8.838  -3.644 1.00 . A A . 45 ASN OD1  1 1 
        9  9193 1 1 46 ALA C    C -10.270  12.082   0.406 1.00 . A A . 46 ALA C    1 1 
        9  9194 1 1 46 ALA CA   C  -8.792  12.413   0.542 1.00 . A A . 46 ALA CA   1 1 
        9  9195 1 1 46 ALA CB   C  -8.565  13.904   0.341 1.00 . A A . 46 ALA CB   1 1 
        9  9196 1 1 46 ALA H    H  -7.616  12.100  -1.192 1.00 . A A . 46 ALA H    1 1 
        9  9197 1 1 46 ALA HA   H  -8.468  12.155   1.539 1.00 . A A . 46 ALA HA   1 1 
        9  9198 1 1 46 ALA HB1  H  -9.140  14.456   1.068 1.00 . A A . 46 ALA HB1  1 1 
        9  9199 1 1 46 ALA HB2  H  -8.876  14.185  -0.654 1.00 . A A . 46 ALA HB2  1 1 
        9  9200 1 1 46 ALA HB3  H  -7.516  14.127   0.467 1.00 . A A . 46 ALA HB3  1 1 
        9  9201 1 1 46 ALA N    N  -7.985  11.648  -0.403 1.00 . A A . 46 ALA N    1 1 
        9  9202 1 1 46 ALA O    O -11.090  12.546   1.197 1.00 . A A . 46 ALA O    1 1 
        9  9203 1 1 47 ASP C    C -12.300   9.529  -0.201 1.00 . A A . 47 ASP C    1 1 
        9  9204 1 1 47 ASP CA   C -12.000  10.888  -0.827 1.00 . A A . 47 ASP CA   1 1 
        9  9205 1 1 47 ASP CB   C -12.310  10.847  -2.329 1.00 . A A . 47 ASP CB   1 1 
        9  9206 1 1 47 ASP CG   C -11.090  10.606  -3.191 1.00 . A A . 47 ASP CG   1 1 
        9  9207 1 1 47 ASP H    H  -9.930  10.933  -1.195 1.00 . A A . 47 ASP H    1 1 
        9  9208 1 1 47 ASP HA   H -12.630  11.630  -0.360 1.00 . A A . 47 ASP HA   1 1 
        9  9209 1 1 47 ASP HB2  H -13.010  10.048  -2.515 1.00 . A A . 47 ASP HB2  1 1 
        9  9210 1 1 47 ASP HB3  H -12.760  11.787  -2.622 1.00 . A A . 47 ASP HB3  1 1 
        9  9211 1 1 47 ASP N    N -10.620  11.276  -0.596 1.00 . A A . 47 ASP N    1 1 
        9  9212 1 1 47 ASP O    O -13.460   9.170   0.001 1.00 . A A . 47 ASP O    1 1 
        9  9213 1 1 47 ASP OD1  O -10.190  11.474  -3.203 1.00 . A A . 47 ASP OD1  1 1 
        9  9214 1 1 47 ASP OD2  O -11.020   9.549  -3.854 1.00 . A A . 47 ASP OD2  1 1 
        9  9215 1 1 48 GLY C    C -10.940   6.346  -0.222 1.00 . A A . 48 GLY C    1 1 
        9  9216 1 1 48 GLY CA   C -11.420   7.460   0.688 1.00 . A A . 48 GLY CA   1 1 
        9  9217 1 1 48 GLY H    H -10.350   9.107  -0.091 1.00 . A A . 48 GLY H    1 1 
        9  9218 1 1 48 GLY HA2  H -10.870   7.419   1.616 1.00 . A A . 48 GLY HA2  1 1 
        9  9219 1 1 48 GLY HA3  H -12.470   7.307   0.900 1.00 . A A . 48 GLY HA3  1 1 
        9  9220 1 1 48 GLY N    N -11.250   8.773   0.096 1.00 . A A . 48 GLY N    1 1 
        9  9221 1 1 48 GLY O    O -11.170   5.167   0.058 1.00 . A A . 48 GLY O    1 1 
        9  9222 1 1 49 SER C    C  -8.366   5.274  -1.863 1.00 . A A . 49 SER C    1 1 
        9  9223 1 1 49 SER CA   C  -9.763   5.736  -2.262 1.00 . A A . 49 SER CA   1 1 
        9  9224 1 1 49 SER CB   C  -9.741   6.326  -3.669 1.00 . A A . 49 SER CB   1 1 
        9  9225 1 1 49 SER H    H -10.120   7.668  -1.483 1.00 . A A . 49 SER H    1 1 
        9  9226 1 1 49 SER HA   H -10.420   4.889  -2.254 1.00 . A A . 49 SER HA   1 1 
        9  9227 1 1 49 SER HB2  H -10.070   7.349  -3.631 1.00 . A A . 49 SER HB2  1 1 
        9  9228 1 1 49 SER HB3  H  -8.735   6.292  -4.054 1.00 . A A . 49 SER HB3  1 1 
        9  9229 1 1 49 SER HG   H -11.500   5.712  -4.265 1.00 . A A . 49 SER HG   1 1 
        9  9230 1 1 49 SER N    N -10.270   6.714  -1.312 1.00 . A A . 49 SER N    1 1 
        9  9231 1 1 49 SER O    O  -7.662   5.960  -1.122 1.00 . A A . 49 SER O    1 1 
        9  9232 1 1 49 SER OG   O -10.590   5.600  -4.541 1.00 . A A . 49 SER OG   1 1 
        9  9233 1 1 50 VAL C    C  -6.149   2.694  -3.206 1.00 . A A . 50 VAL C    1 1 
        9  9234 1 1 50 VAL CA   C  -6.657   3.551  -2.054 1.00 . A A . 50 VAL CA   1 1 
        9  9235 1 1 50 VAL CB   C  -6.679   2.698  -0.767 1.00 . A A . 50 VAL CB   1 1 
        9  9236 1 1 50 VAL CG1  C  -5.312   2.709  -0.103 1.00 . A A . 50 VAL CG1  1 1 
        9  9237 1 1 50 VAL CG2  C  -7.747   3.192   0.197 1.00 . A A . 50 VAL CG2  1 1 
        9  9238 1 1 50 VAL H    H  -8.578   3.605  -2.942 1.00 . A A . 50 VAL H    1 1 
        9  9239 1 1 50 VAL HA   H  -5.972   4.373  -1.902 1.00 . A A . 50 VAL HA   1 1 
        9  9240 1 1 50 VAL HB   H  -6.913   1.679  -1.041 1.00 . A A . 50 VAL HB   1 1 
        9  9241 1 1 50 VAL HG11 H  -4.947   3.724  -0.047 1.00 . A A . 50 VAL HG11 1 1 
        9  9242 1 1 50 VAL HG12 H  -4.626   2.110  -0.682 1.00 . A A . 50 VAL HG12 1 1 
        9  9243 1 1 50 VAL HG13 H  -5.394   2.302   0.893 1.00 . A A . 50 VAL HG13 1 1 
        9  9244 1 1 50 VAL HG21 H  -8.700   3.235  -0.309 1.00 . A A . 50 VAL HG21 1 1 
        9  9245 1 1 50 VAL HG22 H  -7.485   4.177   0.553 1.00 . A A . 50 VAL HG22 1 1 
        9  9246 1 1 50 VAL HG23 H  -7.817   2.514   1.036 1.00 . A A . 50 VAL HG23 1 1 
        9  9247 1 1 50 VAL N    N  -7.971   4.107  -2.358 1.00 . A A . 50 VAL N    1 1 
        9  9248 1 1 50 VAL O    O  -6.595   1.563  -3.392 1.00 . A A . 50 VAL O    1 1 
        9  9249 1 1 51 TYR C    C  -3.276   1.953  -4.764 1.00 . A A . 51 TYR C    1 1 
        9  9250 1 1 51 TYR CA   C  -4.648   2.517  -5.113 1.00 . A A . 51 TYR CA   1 1 
        9  9251 1 1 51 TYR CB   C  -4.550   3.430  -6.337 1.00 . A A . 51 TYR CB   1 1 
        9  9252 1 1 51 TYR CD1  C  -2.233   4.433  -6.277 1.00 . A A . 51 TYR CD1  1 1 
        9  9253 1 1 51 TYR CD2  C  -4.092   5.869  -5.869 1.00 . A A . 51 TYR CD2  1 1 
        9  9254 1 1 51 TYR CE1  C  -1.369   5.499  -6.116 1.00 . A A . 51 TYR CE1  1 1 
        9  9255 1 1 51 TYR CE2  C  -3.233   6.940  -5.709 1.00 . A A . 51 TYR CE2  1 1 
        9  9256 1 1 51 TYR CG   C  -3.607   4.599  -6.156 1.00 . A A . 51 TYR CG   1 1 
        9  9257 1 1 51 TYR CZ   C  -1.873   6.750  -5.833 1.00 . A A . 51 TYR CZ   1 1 
        9  9258 1 1 51 TYR H    H  -4.897   4.146  -3.781 1.00 . A A . 51 TYR H    1 1 
        9  9259 1 1 51 TYR HA   H  -5.311   1.695  -5.342 1.00 . A A . 51 TYR HA   1 1 
        9  9260 1 1 51 TYR HB2  H  -4.203   2.853  -7.180 1.00 . A A . 51 TYR HB2  1 1 
        9  9261 1 1 51 TYR HB3  H  -5.530   3.827  -6.559 1.00 . A A . 51 TYR HB3  1 1 
        9  9262 1 1 51 TYR HD1  H  -1.840   3.452  -6.501 1.00 . A A . 51 TYR HD1  1 1 
        9  9263 1 1 51 TYR HD2  H  -5.157   6.015  -5.771 1.00 . A A . 51 TYR HD2  1 1 
        9  9264 1 1 51 TYR HE1  H  -0.303   5.350  -6.215 1.00 . A A . 51 TYR HE1  1 1 
        9  9265 1 1 51 TYR HE2  H  -3.629   7.920  -5.485 1.00 . A A . 51 TYR HE2  1 1 
        9  9266 1 1 51 TYR HH   H  -0.392   7.620  -4.969 1.00 . A A . 51 TYR HH   1 1 
        9  9267 1 1 51 TYR N    N  -5.215   3.239  -3.978 1.00 . A A . 51 TYR N    1 1 
        9  9268 1 1 51 TYR O    O  -2.837   2.033  -3.617 1.00 . A A . 51 TYR O    1 1 
        9  9269 1 1 51 TYR OH   O  -1.016   7.815  -5.672 1.00 . A A . 51 TYR OH   1 1 
        9  9270 1 1 52 ALA C    C  -0.317   1.211  -6.656 1.00 . A A . 52 ALA C    1 1 
        9  9271 1 1 52 ALA CA   C  -1.281   0.803  -5.546 1.00 . A A . 52 ALA CA   1 1 
        9  9272 1 1 52 ALA CB   C  -1.376  -0.712  -5.458 1.00 . A A . 52 ALA CB   1 1 
        9  9273 1 1 52 ALA H    H  -3.005   1.345  -6.649 1.00 . A A . 52 ALA H    1 1 
        9  9274 1 1 52 ALA HA   H  -0.903   1.171  -4.604 1.00 . A A . 52 ALA HA   1 1 
        9  9275 1 1 52 ALA HB1  H  -1.539  -1.004  -4.431 1.00 . A A . 52 ALA HB1  1 1 
        9  9276 1 1 52 ALA HB2  H  -0.458  -1.153  -5.816 1.00 . A A . 52 ALA HB2  1 1 
        9  9277 1 1 52 ALA HB3  H  -2.201  -1.058  -6.066 1.00 . A A . 52 ALA HB3  1 1 
        9  9278 1 1 52 ALA N    N  -2.603   1.381  -5.756 1.00 . A A . 52 ALA N    1 1 
        9  9279 1 1 52 ALA O    O  -0.723   1.419  -7.800 1.00 . A A . 52 ALA O    1 1 
        9  9280 1 1 53 GLU C    C   3.264   0.901  -7.055 1.00 . A A . 53 GLU C    1 1 
        9  9281 1 1 53 GLU CA   C   1.985   1.700  -7.277 1.00 . A A . 53 GLU CA   1 1 
        9  9282 1 1 53 GLU CB   C   2.281   3.198  -7.173 1.00 . A A . 53 GLU CB   1 1 
        9  9283 1 1 53 GLU CD   C   3.272   5.051  -5.770 1.00 . A A . 53 GLU CD   1 1 
        9  9284 1 1 53 GLU CG   C   2.728   3.635  -5.788 1.00 . A A . 53 GLU CG   1 1 
        9  9285 1 1 53 GLU H    H   1.223   1.139  -5.384 1.00 . A A . 53 GLU H    1 1 
        9  9286 1 1 53 GLU HA   H   1.607   1.484  -8.264 1.00 . A A . 53 GLU HA   1 1 
        9  9287 1 1 53 GLU HB2  H   3.064   3.447  -7.875 1.00 . A A . 53 GLU HB2  1 1 
        9  9288 1 1 53 GLU HB3  H   1.389   3.748  -7.431 1.00 . A A . 53 GLU HB3  1 1 
        9  9289 1 1 53 GLU HG2  H   1.883   3.582  -5.118 1.00 . A A . 53 GLU HG2  1 1 
        9  9290 1 1 53 GLU HG3  H   3.500   2.964  -5.443 1.00 . A A . 53 GLU HG3  1 1 
        9  9291 1 1 53 GLU N    N   0.962   1.319  -6.311 1.00 . A A . 53 GLU N    1 1 
        9  9292 1 1 53 GLU O    O   3.362   0.116  -6.111 1.00 . A A . 53 GLU O    1 1 
        9  9293 1 1 53 GLU OE1  O   2.702   5.913  -6.472 1.00 . A A . 53 GLU OE1  1 1 
        9  9294 1 1 53 GLU OE2  O   4.266   5.296  -5.056 1.00 . A A . 53 GLU OE2  1 1 
        9  9295 1 1 54 GLU C    C   6.686   1.382  -7.836 1.00 . A A . 54 GLU C    1 1 
        9  9296 1 1 54 GLU CA   C   5.519   0.401  -7.828 1.00 . A A . 54 GLU CA   1 1 
        9  9297 1 1 54 GLU CB   C   5.668  -0.597  -8.980 1.00 . A A . 54 GLU CB   1 1 
        9  9298 1 1 54 GLU CD   C   6.812  -2.691  -9.807 1.00 . A A . 54 GLU CD   1 1 
        9  9299 1 1 54 GLU CG   C   6.438  -1.851  -8.601 1.00 . A A . 54 GLU CG   1 1 
        9  9300 1 1 54 GLU H    H   4.107   1.741  -8.661 1.00 . A A . 54 GLU H    1 1 
        9  9301 1 1 54 GLU HA   H   5.525  -0.140  -6.893 1.00 . A A . 54 GLU HA   1 1 
        9  9302 1 1 54 GLU HB2  H   4.683  -0.892  -9.314 1.00 . A A . 54 GLU HB2  1 1 
        9  9303 1 1 54 GLU HB3  H   6.186  -0.113  -9.795 1.00 . A A . 54 GLU HB3  1 1 
        9  9304 1 1 54 GLU HG2  H   7.343  -1.561  -8.090 1.00 . A A . 54 GLU HG2  1 1 
        9  9305 1 1 54 GLU HG3  H   5.826  -2.448  -7.940 1.00 . A A . 54 GLU HG3  1 1 
        9  9306 1 1 54 GLU N    N   4.245   1.105  -7.930 1.00 . A A . 54 GLU N    1 1 
        9  9307 1 1 54 GLU O    O   6.621   2.438  -8.467 1.00 . A A . 54 GLU O    1 1 
        9  9308 1 1 54 GLU OE1  O   6.982  -2.115 -10.901 1.00 . A A . 54 GLU OE1  1 1 
        9  9309 1 1 54 GLU OE2  O   6.932  -3.925  -9.655 1.00 . A A . 54 GLU OE2  1 1 
        9  9310 1 1 55 VAL C    C  10.195   1.094  -7.449 1.00 . A A . 55 VAL C    1 1 
        9  9311 1 1 55 VAL CA   C   8.941   1.871  -7.058 1.00 . A A . 55 VAL CA   1 1 
        9  9312 1 1 55 VAL CB   C   9.129   2.452  -5.644 1.00 . A A . 55 VAL CB   1 1 
        9  9313 1 1 55 VAL CG1  C  10.246   3.484  -5.632 1.00 . A A . 55 VAL CG1  1 1 
        9  9314 1 1 55 VAL CG2  C   7.829   3.060  -5.140 1.00 . A A . 55 VAL CG2  1 1 
        9  9315 1 1 55 VAL H    H   7.750   0.171  -6.653 1.00 . A A . 55 VAL H    1 1 
        9  9316 1 1 55 VAL HA   H   8.809   2.692  -7.749 1.00 . A A . 55 VAL HA   1 1 
        9  9317 1 1 55 VAL HB   H   9.407   1.647  -4.979 1.00 . A A . 55 VAL HB   1 1 
        9  9318 1 1 55 VAL HG11 H  10.893   3.323  -6.483 1.00 . A A . 55 VAL HG11 1 1 
        9  9319 1 1 55 VAL HG12 H  10.818   3.386  -4.722 1.00 . A A . 55 VAL HG12 1 1 
        9  9320 1 1 55 VAL HG13 H   9.822   4.476  -5.685 1.00 . A A . 55 VAL HG13 1 1 
        9  9321 1 1 55 VAL HG21 H   7.431   3.731  -5.887 1.00 . A A . 55 VAL HG21 1 1 
        9  9322 1 1 55 VAL HG22 H   8.015   3.604  -4.228 1.00 . A A . 55 VAL HG22 1 1 
        9  9323 1 1 55 VAL HG23 H   7.114   2.272  -4.949 1.00 . A A . 55 VAL HG23 1 1 
        9  9324 1 1 55 VAL N    N   7.756   1.025  -7.134 1.00 . A A . 55 VAL N    1 1 
        9  9325 1 1 55 VAL O    O  10.941   0.628  -6.586 1.00 . A A . 55 VAL O    1 1 
        9  9326 1 1 56 LYS C    C  12.144   0.914 -10.501 1.00 . A A . 56 LYS C    1 1 
        9  9327 1 1 56 LYS CA   C  11.579   0.234  -9.256 1.00 . A A . 56 LYS CA   1 1 
        9  9328 1 1 56 LYS CB   C  11.203  -1.212  -9.578 1.00 . A A . 56 LYS CB   1 1 
        9  9329 1 1 56 LYS CD   C  10.600  -1.872 -11.928 1.00 . A A . 56 LYS CD   1 1 
        9  9330 1 1 56 LYS CE   C   9.732  -1.410 -13.089 1.00 . A A . 56 LYS CE   1 1 
        9  9331 1 1 56 LYS CG   C  10.086  -1.337 -10.601 1.00 . A A . 56 LYS CG   1 1 
        9  9332 1 1 56 LYS H    H   9.785   1.350  -9.387 1.00 . A A . 56 LYS H    1 1 
        9  9333 1 1 56 LYS HA   H  12.334   0.237  -8.483 1.00 . A A . 56 LYS HA   1 1 
        9  9334 1 1 56 LYS HB2  H  12.076  -1.722  -9.964 1.00 . A A . 56 LYS HB2  1 1 
        9  9335 1 1 56 LYS HB3  H  10.886  -1.701  -8.667 1.00 . A A . 56 LYS HB3  1 1 
        9  9336 1 1 56 LYS HD2  H  11.606  -1.517 -12.083 1.00 . A A . 56 LYS HD2  1 1 
        9  9337 1 1 56 LYS HD3  H  10.597  -2.952 -11.896 1.00 . A A . 56 LYS HD3  1 1 
        9  9338 1 1 56 LYS HE2  H   9.214  -0.509 -12.797 1.00 . A A . 56 LYS HE2  1 1 
        9  9339 1 1 56 LYS HE3  H  10.368  -1.199 -13.936 1.00 . A A . 56 LYS HE3  1 1 
        9  9340 1 1 56 LYS HG2  H   9.335  -2.013 -10.219 1.00 . A A . 56 LYS HG2  1 1 
        9  9341 1 1 56 LYS HG3  H   9.647  -0.363 -10.760 1.00 . A A . 56 LYS HG3  1 1 
        9  9342 1 1 56 LYS HZ1  H   8.606  -2.444 -14.511 1.00 . A A . 56 LYS HZ1  1 1 
        9  9343 1 1 56 LYS HZ2  H   7.814  -2.236 -13.032 1.00 . A A . 56 LYS HZ2  1 1 
        9  9344 1 1 56 LYS HZ3  H   9.049  -3.383 -13.175 1.00 . A A . 56 LYS HZ3  1 1 
        9  9345 1 1 56 LYS N    N  10.418   0.957  -8.751 1.00 . A A . 56 LYS N    1 1 
        9  9346 1 1 56 LYS NZ   N   8.730  -2.440 -13.478 1.00 . A A . 56 LYS NZ   1 1 
        9  9347 1 1 56 LYS O    O  11.664   0.687 -11.612 1.00 . A A . 56 LYS O    1 1 
        9  9348 1 1 57 PRO C    C  14.565   1.534 -12.382 1.00 . A A . 57 PRO C    1 1 
        9  9349 1 1 57 PRO CA   C  13.799   2.474 -11.458 1.00 . A A . 57 PRO CA   1 1 
        9  9350 1 1 57 PRO CB   C  14.758   3.451 -10.775 1.00 . A A . 57 PRO CB   1 1 
        9  9351 1 1 57 PRO CD   C  13.813   2.097  -9.049 1.00 . A A . 57 PRO CD   1 1 
        9  9352 1 1 57 PRO CG   C  15.062   2.827  -9.459 1.00 . A A . 57 PRO CG   1 1 
        9  9353 1 1 57 PRO HA   H  13.066   3.023 -12.032 1.00 . A A . 57 PRO HA   1 1 
        9  9354 1 1 57 PRO HB2  H  15.649   3.563 -11.375 1.00 . A A . 57 PRO HB2  1 1 
        9  9355 1 1 57 PRO HB3  H  14.274   4.409 -10.654 1.00 . A A . 57 PRO HB3  1 1 
        9  9356 1 1 57 PRO HD2  H  14.063   1.202  -8.498 1.00 . A A . 57 PRO HD2  1 1 
        9  9357 1 1 57 PRO HD3  H  13.177   2.739  -8.458 1.00 . A A . 57 PRO HD3  1 1 
        9  9358 1 1 57 PRO HG2  H  15.885   2.134  -9.562 1.00 . A A . 57 PRO HG2  1 1 
        9  9359 1 1 57 PRO HG3  H  15.303   3.592  -8.735 1.00 . A A . 57 PRO HG3  1 1 
        9  9360 1 1 57 PRO N    N  13.175   1.763 -10.336 1.00 . A A . 57 PRO N    1 1 
        9  9361 1 1 57 PRO O    O  14.697   0.342 -12.102 1.00 . A A . 57 PRO O    1 1 
        9  9362 1 1 58 ASP C    C  16.677   2.183 -15.342 1.00 . A A . 58 ASP C    1 1 
        9  9363 1 1 58 ASP CA   C  15.819   1.286 -14.453 1.00 . A A . 58 ASP CA   1 1 
        9  9364 1 1 58 ASP CB   C  14.868   0.454 -15.314 1.00 . A A . 58 ASP CB   1 1 
        9  9365 1 1 58 ASP CG   C  15.566  -0.711 -15.987 1.00 . A A . 58 ASP CG   1 1 
        9  9366 1 1 58 ASP H    H  14.927   3.032 -13.656 1.00 . A A . 58 ASP H    1 1 
        9  9367 1 1 58 ASP HA   H  16.468   0.620 -13.903 1.00 . A A . 58 ASP HA   1 1 
        9  9368 1 1 58 ASP HB2  H  14.076   0.061 -14.690 1.00 . A A . 58 ASP HB2  1 1 
        9  9369 1 1 58 ASP HB3  H  14.442   1.087 -16.082 1.00 . A A . 58 ASP HB3  1 1 
        9  9370 1 1 58 ASP N    N  15.067   2.076 -13.487 1.00 . A A . 58 ASP N    1 1 
        9  9371 1 1 58 ASP O    O  16.315   2.470 -16.484 1.00 . A A . 58 ASP O    1 1 
        9  9372 1 1 58 ASP OD1  O  16.808  -0.663 -16.118 1.00 . A A . 58 ASP OD1  1 1 
        9  9373 1 1 58 ASP OD2  O  14.873  -1.671 -16.385 1.00 . A A . 58 ASP OD2  1 1 
        9  9374 1 1 59 PRO C    C  19.443   2.764 -16.718 1.00 . A A . 59 PRO C    1 1 
        9  9375 1 1 59 PRO CA   C  18.743   3.506 -15.584 1.00 . A A . 59 PRO CA   1 1 
        9  9376 1 1 59 PRO CB   C  19.757   3.959 -14.533 1.00 . A A . 59 PRO CB   1 1 
        9  9377 1 1 59 PRO CD   C  18.344   2.346 -13.477 1.00 . A A . 59 PRO CD   1 1 
        9  9378 1 1 59 PRO CG   C  19.751   2.876 -13.513 1.00 . A A . 59 PRO CG   1 1 
        9  9379 1 1 59 PRO HA   H  18.226   4.367 -15.986 1.00 . A A . 59 PRO HA   1 1 
        9  9380 1 1 59 PRO HB2  H  20.730   4.068 -14.992 1.00 . A A . 59 PRO HB2  1 1 
        9  9381 1 1 59 PRO HB3  H  19.444   4.901 -14.110 1.00 . A A . 59 PRO HB3  1 1 
        9  9382 1 1 59 PRO HD2  H  18.345   1.283 -13.289 1.00 . A A . 59 PRO HD2  1 1 
        9  9383 1 1 59 PRO HD3  H  17.765   2.864 -12.727 1.00 . A A . 59 PRO HD3  1 1 
        9  9384 1 1 59 PRO HG2  H  20.438   2.094 -13.803 1.00 . A A . 59 PRO HG2  1 1 
        9  9385 1 1 59 PRO HG3  H  20.024   3.277 -12.548 1.00 . A A . 59 PRO HG3  1 1 
        9  9386 1 1 59 PRO N    N  17.833   2.639 -14.831 1.00 . A A . 59 PRO N    1 1 
        9  9387 1 1 59 PRO O    O  20.549   2.251 -16.546 1.00 . A A . 59 PRO O    1 1 
        9  9388 1 1 60 SER C    C  18.904   2.706 -20.332 1.00 . A A . 60 SER C    1 1 
        9  9389 1 1 60 SER CA   C  19.356   2.035 -19.039 1.00 . A A . 60 SER CA   1 1 
        9  9390 1 1 60 SER CB   C  18.944   0.562 -19.045 1.00 . A A . 60 SER CB   1 1 
        9  9391 1 1 60 SER H    H  17.916   3.143 -17.952 1.00 . A A . 60 SER H    1 1 
        9  9392 1 1 60 SER HA   H  20.431   2.100 -18.972 1.00 . A A . 60 SER HA   1 1 
        9  9393 1 1 60 SER HB2  H  18.905   0.205 -20.064 1.00 . A A . 60 SER HB2  1 1 
        9  9394 1 1 60 SER HB3  H  19.669  -0.014 -18.489 1.00 . A A . 60 SER HB3  1 1 
        9  9395 1 1 60 SER HG   H  17.294  -0.450 -18.740 1.00 . A A . 60 SER HG   1 1 
        9  9396 1 1 60 SER N    N  18.793   2.714 -17.876 1.00 . A A . 60 SER N    1 1 
        9  9397 1 1 60 SER O    O  18.003   2.220 -21.014 1.00 . A A . 60 SER O    1 1 
        9  9398 1 1 60 SER OG   O  17.669   0.386 -18.452 1.00 . A A . 60 SER OG   1 1 
        9  9399 1 1 61 ASN C    C  20.437   4.793 -22.735 1.00 . A A . 61 ASN C    1 1 
        9  9400 1 1 61 ASN CA   C  19.199   4.567 -21.873 1.00 . A A . 61 ASN CA   1 1 
        9  9401 1 1 61 ASN CB   C  18.560   5.909 -21.516 1.00 . A A . 61 ASN CB   1 1 
        9  9402 1 1 61 ASN CG   C  17.117   5.764 -21.070 1.00 . A A . 61 ASN CG   1 1 
        9  9403 1 1 61 ASN H    H  20.247   4.167 -20.078 1.00 . A A . 61 ASN H    1 1 
        9  9404 1 1 61 ASN HA   H  18.488   3.979 -22.435 1.00 . A A . 61 ASN HA   1 1 
        9  9405 1 1 61 ASN HB2  H  19.121   6.366 -20.712 1.00 . A A . 61 ASN HB2  1 1 
        9  9406 1 1 61 ASN HB3  H  18.587   6.556 -22.381 1.00 . A A . 61 ASN HB3  1 1 
        9  9407 1 1 61 ASN HD21 H  17.695   4.739 -19.464 1.00 . A A . 61 ASN HD21 1 1 
        9  9408 1 1 61 ASN HD22 H  15.986   4.988 -19.628 1.00 . A A . 61 ASN HD22 1 1 
        9  9409 1 1 61 ASN N    N  19.536   3.827 -20.663 1.00 . A A . 61 ASN N    1 1 
        9  9410 1 1 61 ASN ND2  N  16.912   5.097 -19.940 1.00 . A A . 61 ASN ND2  1 1 
        9  9411 1 1 61 ASN O    O  21.510   5.114 -22.223 1.00 . A A . 61 ASN O    1 1 
        9  9412 1 1 61 ASN OD1  O  16.200   6.246 -21.733 1.00 . A A . 61 ASN OD1  1 1 
        9  9413 1 1 62 LYS C    C  20.972   5.701 -26.143 1.00 . A A . 62 LYS C    1 1 
        9  9414 1 1 62 LYS CA   C  21.387   4.811 -24.975 1.00 . A A . 62 LYS CA   1 1 
        9  9415 1 1 62 LYS CB   C  21.875   3.459 -25.498 1.00 . A A . 62 LYS CB   1 1 
        9  9416 1 1 62 LYS CD   C  23.871   1.947 -25.718 1.00 . A A . 62 LYS CD   1 1 
        9  9417 1 1 62 LYS CE   C  25.370   1.873 -25.953 1.00 . A A . 62 LYS CE   1 1 
        9  9418 1 1 62 LYS CG   C  23.381   3.386 -25.683 1.00 . A A . 62 LYS CG   1 1 
        9  9419 1 1 62 LYS H    H  19.401   4.368 -24.391 1.00 . A A . 62 LYS H    1 1 
        9  9420 1 1 62 LYS HA   H  22.193   5.292 -24.441 1.00 . A A . 62 LYS HA   1 1 
        9  9421 1 1 62 LYS HB2  H  21.582   2.689 -24.799 1.00 . A A . 62 LYS HB2  1 1 
        9  9422 1 1 62 LYS HB3  H  21.406   3.264 -26.452 1.00 . A A . 62 LYS HB3  1 1 
        9  9423 1 1 62 LYS HD2  H  23.641   1.477 -24.772 1.00 . A A . 62 LYS HD2  1 1 
        9  9424 1 1 62 LYS HD3  H  23.363   1.424 -26.516 1.00 . A A . 62 LYS HD3  1 1 
        9  9425 1 1 62 LYS HE2  H  25.554   1.864 -27.017 1.00 . A A . 62 LYS HE2  1 1 
        9  9426 1 1 62 LYS HE3  H  25.834   2.745 -25.516 1.00 . A A . 62 LYS HE3  1 1 
        9  9427 1 1 62 LYS HG2  H  23.644   3.866 -26.614 1.00 . A A . 62 LYS HG2  1 1 
        9  9428 1 1 62 LYS HG3  H  23.860   3.900 -24.862 1.00 . A A . 62 LYS HG3  1 1 
        9  9429 1 1 62 LYS HZ1  H  25.371   0.312 -24.565 1.00 . A A . 62 LYS HZ1  1 1 
        9  9430 1 1 62 LYS HZ2  H  26.916   0.862 -24.980 1.00 . A A . 62 LYS HZ2  1 1 
        9  9431 1 1 62 LYS HZ3  H  26.045  -0.101 -26.062 1.00 . A A . 62 LYS HZ3  1 1 
        9  9432 1 1 62 LYS N    N  20.281   4.624 -24.043 1.00 . A A . 62 LYS N    1 1 
        9  9433 1 1 62 LYS NZ   N  25.968   0.651 -25.348 1.00 . A A . 62 LYS NZ   1 1 
        9  9434 1 1 62 LYS O    O  21.451   6.825 -26.281 1.00 . A A . 62 LYS O    1 1 
        9  9435 1 1 63 LYS C    C  18.154   6.395 -27.927 1.00 . A A . 63 LYS C    1 1 
        9  9436 1 1 63 LYS CA   C  19.594   5.936 -28.136 1.00 . A A . 63 LYS CA   1 1 
        9  9437 1 1 63 LYS CB   C  19.690   5.081 -29.401 1.00 . A A . 63 LYS CB   1 1 
        9  9438 1 1 63 LYS CD   C  21.312   3.948 -30.948 1.00 . A A . 63 LYS CD   1 1 
        9  9439 1 1 63 LYS CE   C  21.767   2.773 -30.099 1.00 . A A . 63 LYS CE   1 1 
        9  9440 1 1 63 LYS CG   C  21.036   5.177 -30.098 1.00 . A A . 63 LYS CG   1 1 
        9  9441 1 1 63 LYS H    H  19.729   4.287 -26.817 1.00 . A A . 63 LYS H    1 1 
        9  9442 1 1 63 LYS HA   H  20.222   6.807 -28.253 1.00 . A A . 63 LYS HA   1 1 
        9  9443 1 1 63 LYS HB2  H  19.519   4.047 -29.136 1.00 . A A . 63 LYS HB2  1 1 
        9  9444 1 1 63 LYS HB3  H  18.925   5.396 -30.095 1.00 . A A . 63 LYS HB3  1 1 
        9  9445 1 1 63 LYS HD2  H  20.406   3.672 -31.470 1.00 . A A . 63 LYS HD2  1 1 
        9  9446 1 1 63 LYS HD3  H  22.085   4.183 -31.666 1.00 . A A . 63 LYS HD3  1 1 
        9  9447 1 1 63 LYS HE2  H  22.459   3.131 -29.353 1.00 . A A . 63 LYS HE2  1 1 
        9  9448 1 1 63 LYS HE3  H  20.905   2.341 -29.611 1.00 . A A . 63 LYS HE3  1 1 
        9  9449 1 1 63 LYS HG2  H  21.041   6.050 -30.734 1.00 . A A . 63 LYS HG2  1 1 
        9  9450 1 1 63 LYS HG3  H  21.812   5.268 -29.352 1.00 . A A . 63 LYS HG3  1 1 
        9  9451 1 1 63 LYS HZ1  H  22.204   0.779 -30.547 1.00 . A A . 63 LYS HZ1  1 1 
        9  9452 1 1 63 LYS HZ2  H  23.469   1.849 -30.883 1.00 . A A . 63 LYS HZ2  1 1 
        9  9453 1 1 63 LYS HZ3  H  22.123   1.784 -31.905 1.00 . A A . 63 LYS HZ3  1 1 
        9  9454 1 1 63 LYS N    N  20.074   5.188 -26.980 1.00 . A A . 63 LYS N    1 1 
        9  9455 1 1 63 LYS NZ   N  22.438   1.723 -30.915 1.00 . A A . 63 LYS NZ   1 1 
        9  9456 1 1 63 LYS O    O  17.341   5.677 -27.343 1.00 . A A . 63 LYS O    1 1 
        9  9457 1 1 64 THR C    C  15.754   8.089 -29.602 1.00 . A A . 64 THR C    1 1 
        9  9458 1 1 64 THR CA   C  16.502   8.149 -28.273 1.00 . A A . 64 THR CA   1 1 
        9  9459 1 1 64 THR CB   C  16.572   9.595 -27.779 1.00 . A A . 64 THR CB   1 1 
        9  9460 1 1 64 THR CG2  C  17.520  10.457 -28.583 1.00 . A A . 64 THR CG2  1 1 
        9  9461 1 1 64 THR H    H  18.535   8.119 -28.863 1.00 . A A . 64 THR H    1 1 
        9  9462 1 1 64 THR HA   H  15.970   7.554 -27.547 1.00 . A A . 64 THR HA   1 1 
        9  9463 1 1 64 THR HB   H  16.912   9.598 -26.754 1.00 . A A . 64 THR HB   1 1 
        9  9464 1 1 64 THR HG1  H  14.644   9.613 -27.434 1.00 . A A . 64 THR HG1  1 1 
        9  9465 1 1 64 THR HG21 H  18.482  10.490 -28.094 1.00 . A A . 64 THR HG21 1 1 
        9  9466 1 1 64 THR HG22 H  17.119  11.458 -28.660 1.00 . A A . 64 THR HG22 1 1 
        9  9467 1 1 64 THR HG23 H  17.635  10.039 -29.574 1.00 . A A . 64 THR HG23 1 1 
        9  9468 1 1 64 THR N    N  17.845   7.594 -28.408 1.00 . A A . 64 THR N    1 1 
        9  9469 1 1 64 THR O    O  16.200   8.650 -30.602 1.00 . A A . 64 THR O    1 1 
        9  9470 1 1 64 THR OG1  O  15.293  10.202 -27.826 1.00 . A A . 64 THR OG1  1 1 
        9  9471 1 1 65 THR C    C  12.418   7.872 -30.601 1.00 . A A . 65 THR C    1 1 
        9  9472 1 1 65 THR CA   C  13.804   7.270 -30.809 1.00 . A A . 65 THR CA   1 1 
        9  9473 1 1 65 THR CB   C  13.680   5.798 -31.203 1.00 . A A . 65 THR CB   1 1 
        9  9474 1 1 65 THR CG2  C  15.001   5.169 -31.589 1.00 . A A . 65 THR CG2  1 1 
        9  9475 1 1 65 THR H    H  14.312   6.978 -28.774 1.00 . A A . 65 THR H    1 1 
        9  9476 1 1 65 THR HA   H  14.302   7.806 -31.603 1.00 . A A . 65 THR HA   1 1 
        9  9477 1 1 65 THR HB   H  13.015   5.717 -32.050 1.00 . A A . 65 THR HB   1 1 
        9  9478 1 1 65 THR HG1  H  13.741   5.054 -29.392 1.00 . A A . 65 THR HG1  1 1 
        9  9479 1 1 65 THR HG21 H  15.403   4.629 -30.746 1.00 . A A . 65 THR HG21 1 1 
        9  9480 1 1 65 THR HG22 H  15.695   5.942 -31.887 1.00 . A A . 65 THR HG22 1 1 
        9  9481 1 1 65 THR HG23 H  14.848   4.486 -32.413 1.00 . A A . 65 THR HG23 1 1 
        9  9482 1 1 65 THR N    N  14.615   7.404 -29.603 1.00 . A A . 65 THR N    1 1 
        9  9483 1 1 65 THR O    O  11.437   7.410 -31.186 1.00 . A A . 65 THR O    1 1 
        9  9484 1 1 65 THR OG1  O  13.138   5.038 -30.138 1.00 . A A . 65 THR OG1  1 1 
        9  9485 1 1 66 ALA C    C  11.286  10.790 -28.598 1.00 . A A . 66 ALA C    1 1 
        9  9486 1 1 66 ALA CA   C  11.078   9.568 -29.484 1.00 . A A . 66 ALA CA   1 1 
        9  9487 1 1 66 ALA CB   C  10.108   8.596 -28.829 1.00 . A A . 66 ALA CB   1 1 
        9  9488 1 1 66 ALA H    H  13.161   9.227 -29.333 1.00 . A A . 66 ALA H    1 1 
        9  9489 1 1 66 ALA HA   H  10.652   9.887 -30.424 1.00 . A A . 66 ALA HA   1 1 
        9  9490 1 1 66 ALA HB1  H  10.663   7.841 -28.293 1.00 . A A . 66 ALA HB1  1 1 
        9  9491 1 1 66 ALA HB2  H   9.501   8.127 -29.588 1.00 . A A . 66 ALA HB2  1 1 
        9  9492 1 1 66 ALA HB3  H   9.472   9.133 -28.140 1.00 . A A . 66 ALA HB3  1 1 
        9  9493 1 1 66 ALA N    N  12.345   8.904 -29.766 1.00 . A A . 66 ALA N    1 1 
        9  9494 1 1 66 ALA O    O  12.155  10.731 -27.702 1.00 . A A . 66 ALA O    1 1 
        9  9495 1 1 66 ALA OXT  O  10.579  11.799 -28.805 1.00 . A A . 66 ALA OXT  1 1 
       10  9496 1 1  1 MET C    C   2.898  12.967   4.270 1.00 . A A .  1 MET C    1 1 
       10  9497 1 1  1 MET CA   C   3.039  14.010   5.374 1.00 . A A .  1 MET CA   1 1 
       10  9498 1 1  1 MET CB   C   4.405  14.693   5.282 1.00 . A A .  1 MET CB   1 1 
       10  9499 1 1  1 MET CE   C   5.906  17.173   8.101 1.00 . A A .  1 MET CE   1 1 
       10  9500 1 1  1 MET CG   C   4.474  16.015   6.030 1.00 . A A .  1 MET CG   1 1 
       10  9501 1 1  1 MET H1   H   2.123  12.712   6.680 1.00 . A A .  1 MET H1   1 1 
       10  9502 1 1  1 MET H2   H   2.714  14.154   7.401 1.00 . A A .  1 MET H2   1 1 
       10  9503 1 1  1 MET H3   H   3.806  12.913   6.936 1.00 . A A .  1 MET H3   1 1 
       10  9504 1 1  1 MET HA   H   2.262  14.752   5.258 1.00 . A A .  1 MET HA   1 1 
       10  9505 1 1  1 MET HB2  H   5.152  14.032   5.694 1.00 . A A .  1 MET HB2  1 1 
       10  9506 1 1  1 MET HB3  H   4.632  14.880   4.244 1.00 . A A .  1 MET HB3  1 1 
       10  9507 1 1  1 MET HE1  H   6.929  16.842   7.989 1.00 . A A .  1 MET HE1  1 1 
       10  9508 1 1  1 MET HE2  H   5.754  17.539   9.106 1.00 . A A .  1 MET HE2  1 1 
       10  9509 1 1  1 MET HE3  H   5.704  17.965   7.395 1.00 . A A .  1 MET HE3  1 1 
       10  9510 1 1  1 MET HG2  H   5.267  16.613   5.604 1.00 . A A .  1 MET HG2  1 1 
       10  9511 1 1  1 MET HG3  H   3.533  16.531   5.912 1.00 . A A .  1 MET HG3  1 1 
       10  9512 1 1  1 MET N    N   2.909  13.391   6.719 1.00 . A A .  1 MET N    1 1 
       10  9513 1 1  1 MET O    O   2.040  13.084   3.396 1.00 . A A .  1 MET O    1 1 
       10  9514 1 1  1 MET SD   S   4.799  15.800   7.792 1.00 . A A .  1 MET SD   1 1 
       10  9515 1 1  2 GLU C    C   2.498   9.989   3.515 1.00 . A A .  2 GLU C    1 1 
       10  9516 1 1  2 GLU CA   C   3.719  10.880   3.324 1.00 . A A .  2 GLU CA   1 1 
       10  9517 1 1  2 GLU CB   C   4.996  10.039   3.415 1.00 . A A .  2 GLU CB   1 1 
       10  9518 1 1  2 GLU CD   C   6.523   8.410   2.238 1.00 . A A .  2 GLU CD   1 1 
       10  9519 1 1  2 GLU CG   C   5.139   9.028   2.292 1.00 . A A .  2 GLU CG   1 1 
       10  9520 1 1  2 GLU H    H   4.409  11.909   5.041 1.00 . A A .  2 GLU H    1 1 
       10  9521 1 1  2 GLU HA   H   3.669  11.338   2.348 1.00 . A A .  2 GLU HA   1 1 
       10  9522 1 1  2 GLU HB2  H   5.849  10.700   3.388 1.00 . A A .  2 GLU HB2  1 1 
       10  9523 1 1  2 GLU HB3  H   4.993   9.506   4.354 1.00 . A A .  2 GLU HB3  1 1 
       10  9524 1 1  2 GLU HG2  H   4.417   8.238   2.440 1.00 . A A .  2 GLU HG2  1 1 
       10  9525 1 1  2 GLU HG3  H   4.943   9.521   1.351 1.00 . A A .  2 GLU HG3  1 1 
       10  9526 1 1  2 GLU N    N   3.748  11.946   4.319 1.00 . A A .  2 GLU N    1 1 
       10  9527 1 1  2 GLU O    O   2.270   9.454   4.601 1.00 . A A .  2 GLU O    1 1 
       10  9528 1 1  2 GLU OE1  O   7.508   9.142   2.471 1.00 . A A .  2 GLU OE1  1 1 
       10  9529 1 1  2 GLU OE2  O   6.622   7.197   1.959 1.00 . A A .  2 GLU OE2  1 1 
       10  9530 1 1  3 GLN C    C   0.643   7.792   1.598 1.00 . A A .  3 GLN C    1 1 
       10  9531 1 1  3 GLN CA   C   0.510   9.008   2.508 1.00 . A A .  3 GLN CA   1 1 
       10  9532 1 1  3 GLN CB   C  -0.718   9.828   2.109 1.00 . A A .  3 GLN CB   1 1 
       10  9533 1 1  3 GLN CD   C  -2.885  10.539   3.196 1.00 . A A .  3 GLN CD   1 1 
       10  9534 1 1  3 GLN CG   C  -1.998   9.378   2.796 1.00 . A A .  3 GLN CG   1 1 
       10  9535 1 1  3 GLN H    H   1.943  10.286   1.617 1.00 . A A .  3 GLN H    1 1 
       10  9536 1 1  3 GLN HA   H   0.390   8.666   3.524 1.00 . A A .  3 GLN HA   1 1 
       10  9537 1 1  3 GLN HB2  H  -0.544  10.863   2.363 1.00 . A A .  3 GLN HB2  1 1 
       10  9538 1 1  3 GLN HB3  H  -0.860   9.747   1.042 1.00 . A A .  3 GLN HB3  1 1 
       10  9539 1 1  3 GLN HE21 H  -4.397   9.293   3.544 1.00 . A A .  3 GLN HE21 1 1 
       10  9540 1 1  3 GLN HE22 H  -4.723  10.976   3.821 1.00 . A A .  3 GLN HE22 1 1 
       10  9541 1 1  3 GLN HG2  H  -2.549   8.740   2.120 1.00 . A A .  3 GLN HG2  1 1 
       10  9542 1 1  3 GLN HG3  H  -1.738   8.820   3.683 1.00 . A A .  3 GLN HG3  1 1 
       10  9543 1 1  3 GLN N    N   1.711   9.835   2.454 1.00 . A A .  3 GLN N    1 1 
       10  9544 1 1  3 GLN NE2  N  -4.127  10.238   3.556 1.00 . A A .  3 GLN NE2  1 1 
       10  9545 1 1  3 GLN O    O  -0.323   7.366   0.967 1.00 . A A .  3 GLN O    1 1 
       10  9546 1 1  3 GLN OE1  O  -2.458  11.694   3.182 1.00 . A A .  3 GLN OE1  1 1 
       10  9547 1 1  4 ARG C    C   2.656   4.921   1.568 1.00 . A A .  4 ARG C    1 1 
       10  9548 1 1  4 ARG CA   C   2.119   6.065   0.716 1.00 . A A .  4 ARG CA   1 1 
       10  9549 1 1  4 ARG CB   C   3.115   6.399  -0.403 1.00 . A A .  4 ARG CB   1 1 
       10  9550 1 1  4 ARG CD   C   4.665   8.148  -1.325 1.00 . A A .  4 ARG CD   1 1 
       10  9551 1 1  4 ARG CG   C   4.084   7.522  -0.067 1.00 . A A .  4 ARG CG   1 1 
       10  9552 1 1  4 ARG CZ   C   6.893   8.792  -2.156 1.00 . A A .  4 ARG CZ   1 1 
       10  9553 1 1  4 ARG H    H   2.574   7.624   2.075 1.00 . A A .  4 ARG H    1 1 
       10  9554 1 1  4 ARG HA   H   1.186   5.752   0.271 1.00 . A A .  4 ARG HA   1 1 
       10  9555 1 1  4 ARG HB2  H   3.692   5.514  -0.628 1.00 . A A .  4 ARG HB2  1 1 
       10  9556 1 1  4 ARG HB3  H   2.559   6.686  -1.285 1.00 . A A .  4 ARG HB3  1 1 
       10  9557 1 1  4 ARG HD2  H   4.607   7.429  -2.129 1.00 . A A .  4 ARG HD2  1 1 
       10  9558 1 1  4 ARG HD3  H   4.080   9.019  -1.581 1.00 . A A .  4 ARG HD3  1 1 
       10  9559 1 1  4 ARG HE   H   6.391   8.639  -0.231 1.00 . A A .  4 ARG HE   1 1 
       10  9560 1 1  4 ARG HG2  H   3.561   8.284   0.491 1.00 . A A .  4 ARG HG2  1 1 
       10  9561 1 1  4 ARG HG3  H   4.890   7.123   0.533 1.00 . A A .  4 ARG HG3  1 1 
       10  9562 1 1  4 ARG HH11 H   5.537   8.406  -3.607 1.00 . A A .  4 ARG HH11 1 1 
       10  9563 1 1  4 ARG HH12 H   7.110   8.861  -4.165 1.00 . A A .  4 ARG HH12 1 1 
       10  9564 1 1  4 ARG HH21 H   8.462   9.239  -0.963 1.00 . A A .  4 ARG HH21 1 1 
       10  9565 1 1  4 ARG HH22 H   8.771   9.335  -2.665 1.00 . A A .  4 ARG HH22 1 1 
       10  9566 1 1  4 ARG N    N   1.849   7.237   1.542 1.00 . A A .  4 ARG N    1 1 
       10  9567 1 1  4 ARG NE   N   6.059   8.547  -1.148 1.00 . A A .  4 ARG NE   1 1 
       10  9568 1 1  4 ARG NH1  N   6.480   8.676  -3.413 1.00 . A A .  4 ARG NH1  1 1 
       10  9569 1 1  4 ARG NH2  N   8.145   9.151  -1.907 1.00 . A A .  4 ARG NH2  1 1 
       10  9570 1 1  4 ARG O    O   3.861   4.670   1.605 1.00 . A A .  4 ARG O    1 1 
       10  9571 1 1  5 ILE C    C   2.367   1.861   2.330 1.00 . A A .  5 ILE C    1 1 
       10  9572 1 1  5 ILE CA   C   2.123   3.128   3.125 1.00 . A A .  5 ILE CA   1 1 
       10  9573 1 1  5 ILE CB   C   1.028   2.846   4.167 1.00 . A A .  5 ILE CB   1 1 
       10  9574 1 1  5 ILE CD1  C  -0.900   4.170   5.161 1.00 . A A .  5 ILE CD1  1 1 
       10  9575 1 1  5 ILE CG1  C   0.567   4.152   4.794 1.00 . A A .  5 ILE CG1  1 1 
       10  9576 1 1  5 ILE CG2  C   1.533   1.887   5.235 1.00 . A A .  5 ILE CG2  1 1 
       10  9577 1 1  5 ILE H    H   0.810   4.494   2.203 1.00 . A A .  5 ILE H    1 1 
       10  9578 1 1  5 ILE HA   H   3.029   3.397   3.649 1.00 . A A .  5 ILE HA   1 1 
       10  9579 1 1  5 ILE HB   H   0.193   2.382   3.662 1.00 . A A .  5 ILE HB   1 1 
       10  9580 1 1  5 ILE HD11 H  -1.399   4.953   4.613 1.00 . A A .  5 ILE HD11 1 1 
       10  9581 1 1  5 ILE HD12 H  -1.003   4.350   6.222 1.00 . A A .  5 ILE HD12 1 1 
       10  9582 1 1  5 ILE HD13 H  -1.344   3.217   4.914 1.00 . A A .  5 ILE HD13 1 1 
       10  9583 1 1  5 ILE HG12 H   1.138   4.333   5.686 1.00 . A A .  5 ILE HG12 1 1 
       10  9584 1 1  5 ILE HG13 H   0.747   4.948   4.096 1.00 . A A .  5 ILE HG13 1 1 
       10  9585 1 1  5 ILE HG21 H   1.423   0.871   4.886 1.00 . A A .  5 ILE HG21 1 1 
       10  9586 1 1  5 ILE HG22 H   0.957   2.021   6.140 1.00 . A A .  5 ILE HG22 1 1 
       10  9587 1 1  5 ILE HG23 H   2.574   2.088   5.438 1.00 . A A .  5 ILE HG23 1 1 
       10  9588 1 1  5 ILE N    N   1.752   4.237   2.262 1.00 . A A .  5 ILE N    1 1 
       10  9589 1 1  5 ILE O    O   1.950   1.738   1.180 1.00 . A A .  5 ILE O    1 1 
       10  9590 1 1  6 THR C    C   2.172  -1.300   2.386 1.00 . A A .  6 THR C    1 1 
       10  9591 1 1  6 THR CA   C   3.368  -0.354   2.335 1.00 . A A .  6 THR CA   1 1 
       10  9592 1 1  6 THR CB   C   4.571  -0.997   3.026 1.00 . A A .  6 THR CB   1 1 
       10  9593 1 1  6 THR CG2  C   5.832  -0.166   2.926 1.00 . A A .  6 THR CG2  1 1 
       10  9594 1 1  6 THR H    H   3.345   1.100   3.878 1.00 . A A .  6 THR H    1 1 
       10  9595 1 1  6 THR HA   H   3.617  -0.163   1.302 1.00 . A A .  6 THR HA   1 1 
       10  9596 1 1  6 THR HB   H   4.769  -1.954   2.566 1.00 . A A .  6 THR HB   1 1 
       10  9597 1 1  6 THR HG1  H   4.266  -0.367   4.855 1.00 . A A .  6 THR HG1  1 1 
       10  9598 1 1  6 THR HG21 H   6.588  -0.580   3.577 1.00 . A A .  6 THR HG21 1 1 
       10  9599 1 1  6 THR HG22 H   5.618   0.850   3.225 1.00 . A A .  6 THR HG22 1 1 
       10  9600 1 1  6 THR HG23 H   6.189  -0.174   1.908 1.00 . A A .  6 THR HG23 1 1 
       10  9601 1 1  6 THR N    N   3.049   0.924   2.962 1.00 . A A .  6 THR N    1 1 
       10  9602 1 1  6 THR O    O   1.402  -1.292   3.346 1.00 . A A .  6 THR O    1 1 
       10  9603 1 1  6 THR OG1  O   4.304  -1.211   4.401 1.00 . A A .  6 THR OG1  1 1 
       10  9604 1 1  7 LEU C    C   0.911  -3.985   2.491 1.00 . A A .  7 LEU C    1 1 
       10  9605 1 1  7 LEU CA   C   0.924  -3.069   1.270 1.00 . A A .  7 LEU CA   1 1 
       10  9606 1 1  7 LEU CB   C   1.034  -3.905  -0.006 1.00 . A A .  7 LEU CB   1 1 
       10  9607 1 1  7 LEU CD1  C  -1.200  -4.150  -1.117 1.00 . A A .  7 LEU CD1  1 1 
       10  9608 1 1  7 LEU CD2  C   0.331  -6.119  -0.948 1.00 . A A .  7 LEU CD2  1 1 
       10  9609 1 1  7 LEU CG   C  -0.145  -4.843  -0.270 1.00 . A A .  7 LEU CG   1 1 
       10  9610 1 1  7 LEU H    H   2.672  -2.072   0.609 1.00 . A A .  7 LEU H    1 1 
       10  9611 1 1  7 LEU HA   H   0.001  -2.510   1.245 1.00 . A A .  7 LEU HA   1 1 
       10  9612 1 1  7 LEU HB2  H   1.125  -3.231  -0.846 1.00 . A A .  7 LEU HB2  1 1 
       10  9613 1 1  7 LEU HB3  H   1.932  -4.501   0.054 1.00 . A A .  7 LEU HB3  1 1 
       10  9614 1 1  7 LEU HD11 H  -0.750  -3.795  -2.032 1.00 . A A .  7 LEU HD11 1 1 
       10  9615 1 1  7 LEU HD12 H  -1.611  -3.314  -0.569 1.00 . A A .  7 LEU HD12 1 1 
       10  9616 1 1  7 LEU HD13 H  -1.990  -4.849  -1.353 1.00 . A A .  7 LEU HD13 1 1 
       10  9617 1 1  7 LEU HD21 H   1.153  -6.540  -0.389 1.00 . A A .  7 LEU HD21 1 1 
       10  9618 1 1  7 LEU HD22 H   0.657  -5.893  -1.953 1.00 . A A .  7 LEU HD22 1 1 
       10  9619 1 1  7 LEU HD23 H  -0.480  -6.832  -0.987 1.00 . A A .  7 LEU HD23 1 1 
       10  9620 1 1  7 LEU HG   H  -0.600  -5.114   0.672 1.00 . A A .  7 LEU HG   1 1 
       10  9621 1 1  7 LEU N    N   2.026  -2.114   1.345 1.00 . A A .  7 LEU N    1 1 
       10  9622 1 1  7 LEU O    O  -0.150  -4.306   3.027 1.00 . A A .  7 LEU O    1 1 
       10  9623 1 1  8 LYS C    C   1.664  -4.602   5.334 1.00 . A A .  8 LYS C    1 1 
       10  9624 1 1  8 LYS CA   C   2.223  -5.273   4.084 1.00 . A A .  8 LYS CA   1 1 
       10  9625 1 1  8 LYS CB   C   3.689  -5.652   4.306 1.00 . A A .  8 LYS CB   1 1 
       10  9626 1 1  8 LYS CD   C   5.178  -6.267   6.236 1.00 . A A .  8 LYS CD   1 1 
       10  9627 1 1  8 LYS CE   C   6.296  -7.242   5.905 1.00 . A A .  8 LYS CE   1 1 
       10  9628 1 1  8 LYS CG   C   3.903  -6.598   5.477 1.00 . A A .  8 LYS CG   1 1 
       10  9629 1 1  8 LYS H    H   2.906  -4.106   2.457 1.00 . A A .  8 LYS H    1 1 
       10  9630 1 1  8 LYS HA   H   1.656  -6.170   3.886 1.00 . A A .  8 LYS HA   1 1 
       10  9631 1 1  8 LYS HB2  H   4.065  -6.129   3.413 1.00 . A A .  8 LYS HB2  1 1 
       10  9632 1 1  8 LYS HB3  H   4.257  -4.752   4.490 1.00 . A A .  8 LYS HB3  1 1 
       10  9633 1 1  8 LYS HD2  H   5.495  -5.269   5.972 1.00 . A A .  8 LYS HD2  1 1 
       10  9634 1 1  8 LYS HD3  H   4.975  -6.312   7.297 1.00 . A A .  8 LYS HD3  1 1 
       10  9635 1 1  8 LYS HE2  H   6.833  -7.477   6.812 1.00 . A A .  8 LYS HE2  1 1 
       10  9636 1 1  8 LYS HE3  H   5.861  -8.144   5.501 1.00 . A A .  8 LYS HE3  1 1 
       10  9637 1 1  8 LYS HG2  H   3.063  -6.518   6.150 1.00 . A A .  8 LYS HG2  1 1 
       10  9638 1 1  8 LYS HG3  H   3.970  -7.609   5.102 1.00 . A A .  8 LYS HG3  1 1 
       10  9639 1 1  8 LYS HZ1  H   7.630  -7.435   4.309 1.00 . A A .  8 LYS HZ1  1 1 
       10  9640 1 1  8 LYS HZ2  H   8.037  -6.207   5.398 1.00 . A A .  8 LYS HZ2  1 1 
       10  9641 1 1  8 LYS HZ3  H   6.765  -5.981   4.308 1.00 . A A .  8 LYS HZ3  1 1 
       10  9642 1 1  8 LYS N    N   2.098  -4.397   2.926 1.00 . A A .  8 LYS N    1 1 
       10  9643 1 1  8 LYS NZ   N   7.250  -6.677   4.910 1.00 . A A .  8 LYS NZ   1 1 
       10  9644 1 1  8 LYS O    O   0.954  -5.226   6.123 1.00 . A A .  8 LYS O    1 1 
       10  9645 1 1  9 ASP C    C   0.021  -2.312   6.573 1.00 . A A .  9 ASP C    1 1 
       10  9646 1 1  9 ASP CA   C   1.521  -2.566   6.662 1.00 . A A .  9 ASP CA   1 1 
       10  9647 1 1  9 ASP CB   C   2.268  -1.235   6.760 1.00 . A A .  9 ASP CB   1 1 
       10  9648 1 1  9 ASP CG   C   3.739  -1.419   7.077 1.00 . A A .  9 ASP CG   1 1 
       10  9649 1 1  9 ASP H    H   2.559  -2.883   4.845 1.00 . A A .  9 ASP H    1 1 
       10  9650 1 1  9 ASP HA   H   1.725  -3.150   7.548 1.00 . A A .  9 ASP HA   1 1 
       10  9651 1 1  9 ASP HB2  H   2.185  -0.713   5.818 1.00 . A A .  9 ASP HB2  1 1 
       10  9652 1 1  9 ASP HB3  H   1.821  -0.636   7.539 1.00 . A A .  9 ASP HB3  1 1 
       10  9653 1 1  9 ASP N    N   1.990  -3.326   5.509 1.00 . A A .  9 ASP N    1 1 
       10  9654 1 1  9 ASP O    O  -0.684  -2.336   7.580 1.00 . A A .  9 ASP O    1 1 
       10  9655 1 1  9 ASP OD1  O   4.283  -2.500   6.764 1.00 . A A .  9 ASP OD1  1 1 
       10  9656 1 1  9 ASP OD2  O   4.347  -0.483   7.637 1.00 . A A .  9 ASP OD2  1 1 
       10  9657 1 1 10 TYR C    C  -2.713  -3.041   5.453 1.00 . A A . 10 TYR C    1 1 
       10  9658 1 1 10 TYR CA   C  -1.876  -1.806   5.137 1.00 . A A . 10 TYR CA   1 1 
       10  9659 1 1 10 TYR CB   C  -2.115  -1.370   3.690 1.00 . A A . 10 TYR CB   1 1 
       10  9660 1 1 10 TYR CD1  C  -4.628  -1.530   3.504 1.00 . A A . 10 TYR CD1  1 1 
       10  9661 1 1 10 TYR CD2  C  -3.610   0.605   3.203 1.00 . A A . 10 TYR CD2  1 1 
       10  9662 1 1 10 TYR CE1  C  -5.874  -0.969   3.296 1.00 . A A . 10 TYR CE1  1 1 
       10  9663 1 1 10 TYR CE2  C  -4.854   1.172   2.993 1.00 . A A . 10 TYR CE2  1 1 
       10  9664 1 1 10 TYR CG   C  -3.478  -0.753   3.461 1.00 . A A . 10 TYR CG   1 1 
       10  9665 1 1 10 TYR CZ   C  -5.981   0.381   3.040 1.00 . A A . 10 TYR CZ   1 1 
       10  9666 1 1 10 TYR H    H   0.152  -2.060   4.594 1.00 . A A . 10 TYR H    1 1 
       10  9667 1 1 10 TYR HA   H  -2.172  -1.007   5.798 1.00 . A A . 10 TYR HA   1 1 
       10  9668 1 1 10 TYR HB2  H  -1.372  -0.639   3.415 1.00 . A A . 10 TYR HB2  1 1 
       10  9669 1 1 10 TYR HB3  H  -2.027  -2.230   3.044 1.00 . A A . 10 TYR HB3  1 1 
       10  9670 1 1 10 TYR HD1  H  -4.541  -2.587   3.705 1.00 . A A . 10 TYR HD1  1 1 
       10  9671 1 1 10 TYR HD2  H  -2.725   1.222   3.166 1.00 . A A . 10 TYR HD2  1 1 
       10  9672 1 1 10 TYR HE1  H  -6.757  -1.590   3.332 1.00 . A A . 10 TYR HE1  1 1 
       10  9673 1 1 10 TYR HE2  H  -4.936   2.230   2.792 1.00 . A A . 10 TYR HE2  1 1 
       10  9674 1 1 10 TYR HH   H  -7.740   0.879   3.637 1.00 . A A . 10 TYR HH   1 1 
       10  9675 1 1 10 TYR N    N  -0.460  -2.067   5.359 1.00 . A A . 10 TYR N    1 1 
       10  9676 1 1 10 TYR O    O  -3.798  -2.938   6.025 1.00 . A A . 10 TYR O    1 1 
       10  9677 1 1 10 TYR OH   O  -7.220   0.943   2.831 1.00 . A A . 10 TYR OH   1 1 
       10  9678 1 1 11 ALA C    C  -2.856  -5.839   6.800 1.00 . A A . 11 ALA C    1 1 
       10  9679 1 1 11 ALA CA   C  -2.903  -5.464   5.322 1.00 . A A . 11 ALA CA   1 1 
       10  9680 1 1 11 ALA CB   C  -2.304  -6.575   4.473 1.00 . A A . 11 ALA CB   1 1 
       10  9681 1 1 11 ALA H    H  -1.333  -4.227   4.626 1.00 . A A . 11 ALA H    1 1 
       10  9682 1 1 11 ALA HA   H  -3.933  -5.332   5.027 1.00 . A A . 11 ALA HA   1 1 
       10  9683 1 1 11 ALA HB1  H  -1.446  -6.991   4.978 1.00 . A A . 11 ALA HB1  1 1 
       10  9684 1 1 11 ALA HB2  H  -2.001  -6.174   3.517 1.00 . A A . 11 ALA HB2  1 1 
       10  9685 1 1 11 ALA HB3  H  -3.043  -7.350   4.320 1.00 . A A . 11 ALA HB3  1 1 
       10  9686 1 1 11 ALA N    N  -2.202  -4.208   5.078 1.00 . A A . 11 ALA N    1 1 
       10  9687 1 1 11 ALA O    O  -3.795  -6.432   7.330 1.00 . A A . 11 ALA O    1 1 
       10  9688 1 1 12 MET C    C  -2.217  -4.719   9.745 1.00 . A A . 12 MET C    1 1 
       10  9689 1 1 12 MET CA   C  -1.584  -5.797   8.871 1.00 . A A . 12 MET CA   1 1 
       10  9690 1 1 12 MET CB   C  -0.098  -5.940   9.206 1.00 . A A . 12 MET CB   1 1 
       10  9691 1 1 12 MET CE   C   2.881  -6.297   9.421 1.00 . A A . 12 MET CE   1 1 
       10  9692 1 1 12 MET CG   C   0.328  -7.372   9.484 1.00 . A A . 12 MET CG   1 1 
       10  9693 1 1 12 MET H    H  -1.041  -5.031   6.984 1.00 . A A . 12 MET H    1 1 
       10  9694 1 1 12 MET HA   H  -2.076  -6.731   9.062 1.00 . A A . 12 MET HA   1 1 
       10  9695 1 1 12 MET HB2  H   0.484  -5.570   8.375 1.00 . A A . 12 MET HB2  1 1 
       10  9696 1 1 12 MET HB3  H   0.122  -5.345  10.080 1.00 . A A . 12 MET HB3  1 1 
       10  9697 1 1 12 MET HE1  H   2.950  -5.369   9.971 1.00 . A A . 12 MET HE1  1 1 
       10  9698 1 1 12 MET HE2  H   2.410  -6.114   8.466 1.00 . A A . 12 MET HE2  1 1 
       10  9699 1 1 12 MET HE3  H   3.871  -6.695   9.264 1.00 . A A . 12 MET HE3  1 1 
       10  9700 1 1 12 MET HG2  H  -0.431  -7.847  10.089 1.00 . A A . 12 MET HG2  1 1 
       10  9701 1 1 12 MET HG3  H   0.416  -7.895   8.544 1.00 . A A . 12 MET HG3  1 1 
       10  9702 1 1 12 MET N    N  -1.755  -5.495   7.458 1.00 . A A . 12 MET N    1 1 
       10  9703 1 1 12 MET O    O  -2.597  -4.975  10.887 1.00 . A A . 12 MET O    1 1 
       10  9704 1 1 12 MET SD   S   1.905  -7.472  10.355 1.00 . A A . 12 MET SD   1 1 
       10  9705 1 1 13 ARG C    C  -4.413  -2.308   9.697 1.00 . A A . 13 ARG C    1 1 
       10  9706 1 1 13 ARG CA   C  -2.907  -2.392   9.927 1.00 . A A . 13 ARG CA   1 1 
       10  9707 1 1 13 ARG CB   C  -2.239  -1.083   9.501 1.00 . A A . 13 ARG CB   1 1 
       10  9708 1 1 13 ARG CD   C  -1.378   0.943  10.718 1.00 . A A . 13 ARG CD   1 1 
       10  9709 1 1 13 ARG CG   C  -2.600   0.099  10.387 1.00 . A A . 13 ARG CG   1 1 
       10  9710 1 1 13 ARG CZ   C  -0.755   3.324  10.806 1.00 . A A . 13 ARG CZ   1 1 
       10  9711 1 1 13 ARG H    H  -2.000  -3.376   8.287 1.00 . A A . 13 ARG H    1 1 
       10  9712 1 1 13 ARG HA   H  -2.726  -2.549  10.978 1.00 . A A . 13 ARG HA   1 1 
       10  9713 1 1 13 ARG HB2  H  -1.165  -1.215   9.531 1.00 . A A . 13 ARG HB2  1 1 
       10  9714 1 1 13 ARG HB3  H  -2.539  -0.851   8.487 1.00 . A A . 13 ARG HB3  1 1 
       10  9715 1 1 13 ARG HD2  H  -1.025   0.671  11.701 1.00 . A A . 13 ARG HD2  1 1 
       10  9716 1 1 13 ARG HD3  H  -0.607   0.737   9.989 1.00 . A A . 13 ARG HD3  1 1 
       10  9717 1 1 13 ARG HE   H  -2.617   2.636  10.605 1.00 . A A . 13 ARG HE   1 1 
       10  9718 1 1 13 ARG HG2  H  -3.321   0.717   9.871 1.00 . A A . 13 ARG HG2  1 1 
       10  9719 1 1 13 ARG HG3  H  -3.030  -0.272  11.308 1.00 . A A . 13 ARG HG3  1 1 
       10  9720 1 1 13 ARG HH11 H   0.804   2.043  10.955 1.00 . A A . 13 ARG HH11 1 1 
       10  9721 1 1 13 ARG HH12 H   1.216   3.725  11.013 1.00 . A A . 13 ARG HH12 1 1 
       10  9722 1 1 13 ARG HH21 H  -2.078   4.847  10.683 1.00 . A A . 13 ARG HH21 1 1 
       10  9723 1 1 13 ARG HH22 H  -0.419   5.316  10.862 1.00 . A A . 13 ARG HH22 1 1 
       10  9724 1 1 13 ARG N    N  -2.324  -3.514   9.200 1.00 . A A . 13 ARG N    1 1 
       10  9725 1 1 13 ARG NE   N  -1.678   2.371  10.701 1.00 . A A . 13 ARG NE   1 1 
       10  9726 1 1 13 ARG NH1  N   0.527   3.005  10.935 1.00 . A A . 13 ARG NH1  1 1 
       10  9727 1 1 13 ARG NH2  N  -1.113   4.601  10.781 1.00 . A A . 13 ARG NH2  1 1 
       10  9728 1 1 13 ARG O    O  -5.204  -2.570  10.602 1.00 . A A . 13 ARG O    1 1 
       10  9729 1 1 14 PHE C    C  -6.826  -3.152   7.814 1.00 . A A . 14 PHE C    1 1 
       10  9730 1 1 14 PHE CA   C  -6.198  -1.798   8.129 1.00 . A A . 14 PHE CA   1 1 
       10  9731 1 1 14 PHE CB   C  -6.310  -0.867   6.930 1.00 . A A . 14 PHE CB   1 1 
       10  9732 1 1 14 PHE CD1  C  -6.372   1.481   7.802 1.00 . A A . 14 PHE CD1  1 1 
       10  9733 1 1 14 PHE CD2  C  -4.376   0.719   6.756 1.00 . A A . 14 PHE CD2  1 1 
       10  9734 1 1 14 PHE CE1  C  -5.791   2.703   8.024 1.00 . A A . 14 PHE CE1  1 1 
       10  9735 1 1 14 PHE CE2  C  -3.793   1.940   6.978 1.00 . A A . 14 PHE CE2  1 1 
       10  9736 1 1 14 PHE CG   C  -5.675   0.471   7.164 1.00 . A A . 14 PHE CG   1 1 
       10  9737 1 1 14 PHE CZ   C  -4.502   2.929   7.611 1.00 . A A . 14 PHE CZ   1 1 
       10  9738 1 1 14 PHE H    H  -4.129  -1.726   7.806 1.00 . A A . 14 PHE H    1 1 
       10  9739 1 1 14 PHE HA   H  -6.716  -1.354   8.965 1.00 . A A . 14 PHE HA   1 1 
       10  9740 1 1 14 PHE HB2  H  -5.824  -1.325   6.080 1.00 . A A . 14 PHE HB2  1 1 
       10  9741 1 1 14 PHE HB3  H  -7.344  -0.713   6.705 1.00 . A A . 14 PHE HB3  1 1 
       10  9742 1 1 14 PHE HD1  H  -7.376   1.306   8.126 1.00 . A A . 14 PHE HD1  1 1 
       10  9743 1 1 14 PHE HD2  H  -3.819  -0.048   6.261 1.00 . A A . 14 PHE HD2  1 1 
       10  9744 1 1 14 PHE HE1  H  -6.347   3.484   8.523 1.00 . A A . 14 PHE HE1  1 1 
       10  9745 1 1 14 PHE HE2  H  -2.777   2.121   6.657 1.00 . A A . 14 PHE HE2  1 1 
       10  9746 1 1 14 PHE HZ   H  -4.052   3.873   7.783 1.00 . A A . 14 PHE HZ   1 1 
       10  9747 1 1 14 PHE N    N  -4.801  -1.931   8.483 1.00 . A A . 14 PHE N    1 1 
       10  9748 1 1 14 PHE O    O  -8.017  -3.363   8.044 1.00 . A A . 14 PHE O    1 1 
       10  9749 1 1 15 GLY C    C  -6.364  -5.707   5.474 1.00 . A A . 15 GLY C    1 1 
       10  9750 1 1 15 GLY CA   C  -6.517  -5.387   6.947 1.00 . A A . 15 GLY CA   1 1 
       10  9751 1 1 15 GLY H    H  -5.079  -3.843   7.121 1.00 . A A . 15 GLY H    1 1 
       10  9752 1 1 15 GLY HA2  H  -5.977  -6.123   7.523 1.00 . A A . 15 GLY HA2  1 1 
       10  9753 1 1 15 GLY HA3  H  -7.564  -5.442   7.208 1.00 . A A . 15 GLY HA3  1 1 
       10  9754 1 1 15 GLY N    N  -6.020  -4.067   7.285 1.00 . A A . 15 GLY N    1 1 
       10  9755 1 1 15 GLY O    O  -6.513  -4.830   4.622 1.00 . A A . 15 GLY O    1 1 
       10  9756 1 1 16 GLN C    C  -7.210  -7.309   3.022 1.00 . A A . 16 GLN C    1 1 
       10  9757 1 1 16 GLN CA   C  -5.893  -7.398   3.788 1.00 . A A . 16 GLN CA   1 1 
       10  9758 1 1 16 GLN CB   C  -5.360  -8.831   3.742 1.00 . A A . 16 GLN CB   1 1 
       10  9759 1 1 16 GLN CD   C  -5.737 -10.122   5.880 1.00 . A A . 16 GLN CD   1 1 
       10  9760 1 1 16 GLN CG   C  -6.236  -9.831   4.479 1.00 . A A . 16 GLN CG   1 1 
       10  9761 1 1 16 GLN H    H  -5.960  -7.620   5.892 1.00 . A A . 16 GLN H    1 1 
       10  9762 1 1 16 GLN HA   H  -5.175  -6.740   3.322 1.00 . A A . 16 GLN HA   1 1 
       10  9763 1 1 16 GLN HB2  H  -5.285  -9.141   2.710 1.00 . A A . 16 GLN HB2  1 1 
       10  9764 1 1 16 GLN HB3  H  -4.376  -8.851   4.186 1.00 . A A . 16 GLN HB3  1 1 
       10  9765 1 1 16 GLN HE21 H  -4.501 -11.514   5.173 1.00 . A A . 16 GLN HE21 1 1 
       10  9766 1 1 16 GLN HE22 H  -4.468 -11.274   6.892 1.00 . A A . 16 GLN HE22 1 1 
       10  9767 1 1 16 GLN HG2  H  -7.237  -9.433   4.544 1.00 . A A . 16 GLN HG2  1 1 
       10  9768 1 1 16 GLN HG3  H  -6.254 -10.755   3.919 1.00 . A A . 16 GLN HG3  1 1 
       10  9769 1 1 16 GLN N    N  -6.066  -6.966   5.170 1.00 . A A . 16 GLN N    1 1 
       10  9770 1 1 16 GLN NE2  N  -4.808 -11.065   5.993 1.00 . A A . 16 GLN NE2  1 1 
       10  9771 1 1 16 GLN O    O  -7.224  -7.056   1.818 1.00 . A A . 16 GLN O    1 1 
       10  9772 1 1 16 GLN OE1  O  -6.181  -9.508   6.850 1.00 . A A . 16 GLN OE1  1 1 
       10  9773 1 1 17 THR C    C -10.000  -6.027   2.744 1.00 . A A . 17 THR C    1 1 
       10  9774 1 1 17 THR CA   C  -9.637  -7.458   3.120 1.00 . A A . 17 THR CA   1 1 
       10  9775 1 1 17 THR CB   C -10.680  -8.028   4.074 1.00 . A A . 17 THR CB   1 1 
       10  9776 1 1 17 THR CG2  C -12.080  -8.035   3.494 1.00 . A A . 17 THR CG2  1 1 
       10  9777 1 1 17 THR H    H  -8.239  -7.713   4.688 1.00 . A A . 17 THR H    1 1 
       10  9778 1 1 17 THR HA   H  -9.614  -8.060   2.224 1.00 . A A . 17 THR HA   1 1 
       10  9779 1 1 17 THR HB   H -10.700  -7.428   4.973 1.00 . A A . 17 THR HB   1 1 
       10  9780 1 1 17 THR HG1  H -10.980  -9.669   5.104 1.00 . A A . 17 THR HG1  1 1 
       10  9781 1 1 17 THR HG21 H -12.780  -8.393   4.237 1.00 . A A . 17 THR HG21 1 1 
       10  9782 1 1 17 THR HG22 H -12.110  -8.684   2.631 1.00 . A A . 17 THR HG22 1 1 
       10  9783 1 1 17 THR HG23 H -12.350  -7.033   3.200 1.00 . A A . 17 THR HG23 1 1 
       10  9784 1 1 17 THR N    N  -8.314  -7.516   3.732 1.00 . A A . 17 THR N    1 1 
       10  9785 1 1 17 THR O    O -10.460  -5.764   1.633 1.00 . A A . 17 THR O    1 1 
       10  9786 1 1 17 THR OG1  O -10.360  -9.360   4.437 1.00 . A A . 17 THR OG1  1 1 
       10  9787 1 1 18 LYS C    C  -9.307  -3.161   2.248 1.00 . A A . 18 LYS C    1 1 
       10  9788 1 1 18 LYS CA   C -10.080  -3.696   3.442 1.00 . A A . 18 LYS CA   1 1 
       10  9789 1 1 18 LYS CB   C  -9.766  -2.872   4.689 1.00 . A A . 18 LYS CB   1 1 
       10  9790 1 1 18 LYS CD   C -10.340  -0.887   6.117 1.00 . A A . 18 LYS CD   1 1 
       10  9791 1 1 18 LYS CE   C -10.510   0.621   6.013 1.00 . A A . 18 LYS CE   1 1 
       10  9792 1 1 18 LYS CG   C -10.530  -1.561   4.766 1.00 . A A . 18 LYS CG   1 1 
       10  9793 1 1 18 LYS H    H  -9.414  -5.375   4.541 1.00 . A A . 18 LYS H    1 1 
       10  9794 1 1 18 LYS HA   H -11.140  -3.615   3.231 1.00 . A A . 18 LYS HA   1 1 
       10  9795 1 1 18 LYS HB2  H -10.000  -3.456   5.566 1.00 . A A . 18 LYS HB2  1 1 
       10  9796 1 1 18 LYS HB3  H  -8.710  -2.647   4.696 1.00 . A A . 18 LYS HB3  1 1 
       10  9797 1 1 18 LYS HD2  H -11.090  -1.271   6.803 1.00 . A A . 18 LYS HD2  1 1 
       10  9798 1 1 18 LYS HD3  H  -9.360  -1.111   6.489 1.00 . A A . 18 LYS HD3  1 1 
       10  9799 1 1 18 LYS HE2  H  -9.789   1.092   6.663 1.00 . A A . 18 LYS HE2  1 1 
       10  9800 1 1 18 LYS HE3  H -10.320   0.920   4.992 1.00 . A A . 18 LYS HE3  1 1 
       10  9801 1 1 18 LYS HG2  H -10.170  -0.898   3.994 1.00 . A A . 18 LYS HG2  1 1 
       10  9802 1 1 18 LYS HG3  H -11.580  -1.760   4.612 1.00 . A A . 18 LYS HG3  1 1 
       10  9803 1 1 18 LYS HZ1  H -12.080   0.753   7.378 1.00 . A A . 18 LYS HZ1  1 1 
       10  9804 1 1 18 LYS HZ2  H -12.580   0.653   5.764 1.00 . A A . 18 LYS HZ2  1 1 
       10  9805 1 1 18 LYS HZ3  H -11.940   2.099   6.362 1.00 . A A . 18 LYS HZ3  1 1 
       10  9806 1 1 18 LYS N    N  -9.786  -5.104   3.675 1.00 . A A . 18 LYS N    1 1 
       10  9807 1 1 18 LYS NZ   N -11.870   1.063   6.406 1.00 . A A . 18 LYS NZ   1 1 
       10  9808 1 1 18 LYS O    O  -9.770  -2.265   1.541 1.00 . A A . 18 LYS O    1 1 
       10  9809 1 1 19 THR C    C  -7.874  -3.725  -0.419 1.00 . A A . 19 THR C    1 1 
       10  9810 1 1 19 THR CA   C  -7.274  -3.293   0.915 1.00 . A A . 19 THR CA   1 1 
       10  9811 1 1 19 THR CB   C  -5.868  -3.874   1.067 1.00 . A A . 19 THR CB   1 1 
       10  9812 1 1 19 THR CG2  C  -4.785  -2.972   0.516 1.00 . A A . 19 THR CG2  1 1 
       10  9813 1 1 19 THR H    H  -7.805  -4.426   2.622 1.00 . A A . 19 THR H    1 1 
       10  9814 1 1 19 THR HA   H  -7.213  -2.216   0.937 1.00 . A A . 19 THR HA   1 1 
       10  9815 1 1 19 THR HB   H  -5.819  -4.813   0.535 1.00 . A A . 19 THR HB   1 1 
       10  9816 1 1 19 THR HG1  H  -4.763  -4.634   2.494 1.00 . A A . 19 THR HG1  1 1 
       10  9817 1 1 19 THR HG21 H  -4.675  -3.148  -0.544 1.00 . A A . 19 THR HG21 1 1 
       10  9818 1 1 19 THR HG22 H  -3.851  -3.183   1.014 1.00 . A A . 19 THR HG22 1 1 
       10  9819 1 1 19 THR HG23 H  -5.056  -1.939   0.682 1.00 . A A . 19 THR HG23 1 1 
       10  9820 1 1 19 THR N    N  -8.119  -3.715   2.025 1.00 . A A . 19 THR N    1 1 
       10  9821 1 1 19 THR O    O  -8.017  -2.917  -1.336 1.00 . A A . 19 THR O    1 1 
       10  9822 1 1 19 THR OG1  O  -5.570  -4.119   2.429 1.00 . A A . 19 THR OG1  1 1 
       10  9823 1 1 20 ALA C    C -10.090  -4.802  -2.112 1.00 . A A . 20 ALA C    1 1 
       10  9824 1 1 20 ALA CA   C  -8.810  -5.542  -1.742 1.00 . A A . 20 ALA CA   1 1 
       10  9825 1 1 20 ALA CB   C  -9.083  -7.030  -1.583 1.00 . A A . 20 ALA CB   1 1 
       10  9826 1 1 20 ALA H    H  -8.086  -5.598   0.247 1.00 . A A . 20 ALA H    1 1 
       10  9827 1 1 20 ALA HA   H  -8.090  -5.417  -2.538 1.00 . A A . 20 ALA HA   1 1 
       10  9828 1 1 20 ALA HB1  H  -9.907  -7.314  -2.220 1.00 . A A . 20 ALA HB1  1 1 
       10  9829 1 1 20 ALA HB2  H  -9.336  -7.241  -0.553 1.00 . A A . 20 ALA HB2  1 1 
       10  9830 1 1 20 ALA HB3  H  -8.203  -7.591  -1.861 1.00 . A A . 20 ALA HB3  1 1 
       10  9831 1 1 20 ALA N    N  -8.225  -5.003  -0.519 1.00 . A A . 20 ALA N    1 1 
       10  9832 1 1 20 ALA O    O -10.410  -4.655  -3.289 1.00 . A A . 20 ALA O    1 1 
       10  9833 1 1 21 LYS C    C -11.780  -2.173  -1.736 1.00 . A A . 21 LYS C    1 1 
       10  9834 1 1 21 LYS CA   C -12.060  -3.615  -1.316 1.00 . A A . 21 LYS CA   1 1 
       10  9835 1 1 21 LYS CB   C -12.910  -3.639  -0.049 1.00 . A A . 21 LYS CB   1 1 
       10  9836 1 1 21 LYS CD   C -15.180  -2.676  -0.543 1.00 . A A . 21 LYS CD   1 1 
       10  9837 1 1 21 LYS CE   C -16.350  -2.923  -1.477 1.00 . A A . 21 LYS CE   1 1 
       10  9838 1 1 21 LYS CG   C -14.380  -3.945  -0.309 1.00 . A A . 21 LYS CG   1 1 
       10  9839 1 1 21 LYS H    H -10.500  -4.488  -0.181 1.00 . A A . 21 LYS H    1 1 
       10  9840 1 1 21 LYS HA   H -12.590  -4.113  -2.111 1.00 . A A . 21 LYS HA   1 1 
       10  9841 1 1 21 LYS HB2  H -12.520  -4.392   0.620 1.00 . A A . 21 LYS HB2  1 1 
       10  9842 1 1 21 LYS HB3  H -12.850  -2.675   0.436 1.00 . A A . 21 LYS HB3  1 1 
       10  9843 1 1 21 LYS HD2  H -15.560  -2.320   0.405 1.00 . A A . 21 LYS HD2  1 1 
       10  9844 1 1 21 LYS HD3  H -14.530  -1.929  -0.981 1.00 . A A . 21 LYS HD3  1 1 
       10  9845 1 1 21 LYS HE2  H -15.990  -3.389  -2.380 1.00 . A A . 21 LYS HE2  1 1 
       10  9846 1 1 21 LYS HE3  H -17.050  -3.585  -0.990 1.00 . A A . 21 LYS HE3  1 1 
       10  9847 1 1 21 LYS HG2  H -14.450  -4.574  -1.183 1.00 . A A . 21 LYS HG2  1 1 
       10  9848 1 1 21 LYS HG3  H -14.780  -4.464   0.547 1.00 . A A . 21 LYS HG3  1 1 
       10  9849 1 1 21 LYS HZ1  H -16.490  -1.120  -2.525 1.00 . A A . 21 LYS HZ1  1 1 
       10  9850 1 1 21 LYS HZ2  H -17.190  -1.074  -0.989 1.00 . A A . 21 LYS HZ2  1 1 
       10  9851 1 1 21 LYS HZ3  H -17.980  -1.870  -2.257 1.00 . A A . 21 LYS HZ3  1 1 
       10  9852 1 1 21 LYS N    N -10.810  -4.339  -1.098 1.00 . A A . 21 LYS N    1 1 
       10  9853 1 1 21 LYS NZ   N -17.050  -1.658  -1.837 1.00 . A A . 21 LYS NZ   1 1 
       10  9854 1 1 21 LYS O    O -12.490  -1.618  -2.579 1.00 . A A . 21 LYS O    1 1 
       10  9855 1 1 22 ASP C    C  -9.672  -0.117  -2.795 1.00 . A A . 22 ASP C    1 1 
       10  9856 1 1 22 ASP CA   C -10.390  -0.198  -1.454 1.00 . A A . 22 ASP CA   1 1 
       10  9857 1 1 22 ASP CB   C  -9.510   0.374  -0.345 1.00 . A A . 22 ASP CB   1 1 
       10  9858 1 1 22 ASP CG   C -10.280   1.253   0.618 1.00 . A A . 22 ASP CG   1 1 
       10  9859 1 1 22 ASP H    H -10.230  -2.069  -0.478 1.00 . A A . 22 ASP H    1 1 
       10  9860 1 1 22 ASP HA   H -11.300   0.382  -1.511 1.00 . A A . 22 ASP HA   1 1 
       10  9861 1 1 22 ASP HB2  H  -9.073  -0.441   0.215 1.00 . A A . 22 ASP HB2  1 1 
       10  9862 1 1 22 ASP HB3  H  -8.722   0.966  -0.790 1.00 . A A . 22 ASP HB3  1 1 
       10  9863 1 1 22 ASP N    N -10.760  -1.575  -1.142 1.00 . A A . 22 ASP N    1 1 
       10  9864 1 1 22 ASP O    O  -9.891   0.811  -3.573 1.00 . A A . 22 ASP O    1 1 
       10  9865 1 1 22 ASP OD1  O -10.890   2.240   0.159 1.00 . A A . 22 ASP OD1  1 1 
       10  9866 1 1 22 ASP OD2  O -10.280   0.952   1.829 1.00 . A A . 22 ASP OD2  1 1 
       10  9867 1 1 23 LEU C    C  -8.906  -1.679  -5.442 1.00 . A A . 23 LEU C    1 1 
       10  9868 1 1 23 LEU CA   C  -8.052  -1.129  -4.302 1.00 . A A . 23 LEU CA   1 1 
       10  9869 1 1 23 LEU CB   C  -6.793  -1.981  -4.133 1.00 . A A . 23 LEU CB   1 1 
       10  9870 1 1 23 LEU CD1  C  -4.769  -1.513  -2.721 1.00 . A A . 23 LEU CD1  1 1 
       10  9871 1 1 23 LEU CD2  C  -4.586  -1.467  -5.216 1.00 . A A . 23 LEU CD2  1 1 
       10  9872 1 1 23 LEU CG   C  -5.487  -1.187  -4.022 1.00 . A A . 23 LEU CG   1 1 
       10  9873 1 1 23 LEU H    H  -8.676  -1.803  -2.395 1.00 . A A . 23 LEU H    1 1 
       10  9874 1 1 23 LEU HA   H  -7.761  -0.117  -4.543 1.00 . A A . 23 LEU HA   1 1 
       10  9875 1 1 23 LEU HB2  H  -6.906  -2.577  -3.239 1.00 . A A . 23 LEU HB2  1 1 
       10  9876 1 1 23 LEU HB3  H  -6.713  -2.645  -4.980 1.00 . A A . 23 LEU HB3  1 1 
       10  9877 1 1 23 LEU HD11 H  -3.811  -1.015  -2.705 1.00 . A A . 23 LEU HD11 1 1 
       10  9878 1 1 23 LEU HD12 H  -4.622  -2.580  -2.650 1.00 . A A . 23 LEU HD12 1 1 
       10  9879 1 1 23 LEU HD13 H  -5.365  -1.176  -1.887 1.00 . A A . 23 LEU HD13 1 1 
       10  9880 1 1 23 LEU HD21 H  -4.295  -2.508  -5.209 1.00 . A A . 23 LEU HD21 1 1 
       10  9881 1 1 23 LEU HD22 H  -3.706  -0.847  -5.155 1.00 . A A . 23 LEU HD22 1 1 
       10  9882 1 1 23 LEU HD23 H  -5.120  -1.249  -6.129 1.00 . A A . 23 LEU HD23 1 1 
       10  9883 1 1 23 LEU HG   H  -5.716  -0.131  -4.017 1.00 . A A . 23 LEU HG   1 1 
       10  9884 1 1 23 LEU N    N  -8.808  -1.091  -3.056 1.00 . A A . 23 LEU N    1 1 
       10  9885 1 1 23 LEU O    O  -8.764  -1.267  -6.593 1.00 . A A . 23 LEU O    1 1 
       10  9886 1 1 24 GLY C    C -10.090  -4.497  -6.675 1.00 . A A . 24 GLY C    1 1 
       10  9887 1 1 24 GLY CA   C -10.650  -3.204  -6.117 1.00 . A A . 24 GLY CA   1 1 
       10  9888 1 1 24 GLY H    H  -9.862  -2.903  -4.177 1.00 . A A . 24 GLY H    1 1 
       10  9889 1 1 24 GLY HA2  H -11.610  -3.407  -5.674 1.00 . A A . 24 GLY HA2  1 1 
       10  9890 1 1 24 GLY HA3  H -10.780  -2.502  -6.926 1.00 . A A . 24 GLY HA3  1 1 
       10  9891 1 1 24 GLY N    N  -9.793  -2.612  -5.111 1.00 . A A . 24 GLY N    1 1 
       10  9892 1 1 24 GLY O    O -10.280  -4.809  -7.850 1.00 . A A . 24 GLY O    1 1 
       10  9893 1 1 25 VAL C    C  -9.299  -7.664  -5.379 1.00 . A A . 25 VAL C    1 1 
       10  9894 1 1 25 VAL CA   C  -8.796  -6.512  -6.244 1.00 . A A . 25 VAL CA   1 1 
       10  9895 1 1 25 VAL CB   C  -7.259  -6.461  -6.166 1.00 . A A . 25 VAL CB   1 1 
       10  9896 1 1 25 VAL CG1  C  -6.694  -5.614  -7.297 1.00 . A A . 25 VAL CG1  1 1 
       10  9897 1 1 25 VAL CG2  C  -6.810  -5.927  -4.814 1.00 . A A . 25 VAL CG2  1 1 
       10  9898 1 1 25 VAL H    H  -9.274  -4.943  -4.905 1.00 . A A . 25 VAL H    1 1 
       10  9899 1 1 25 VAL HA   H  -9.079  -6.693  -7.270 1.00 . A A . 25 VAL HA   1 1 
       10  9900 1 1 25 VAL HB   H  -6.879  -7.465  -6.277 1.00 . A A . 25 VAL HB   1 1 
       10  9901 1 1 25 VAL HG11 H  -7.417  -5.554  -8.098 1.00 . A A . 25 VAL HG11 1 1 
       10  9902 1 1 25 VAL HG12 H  -5.786  -6.065  -7.666 1.00 . A A . 25 VAL HG12 1 1 
       10  9903 1 1 25 VAL HG13 H  -6.479  -4.621  -6.929 1.00 . A A . 25 VAL HG13 1 1 
       10  9904 1 1 25 VAL HG21 H  -7.225  -6.542  -4.029 1.00 . A A . 25 VAL HG21 1 1 
       10  9905 1 1 25 VAL HG22 H  -7.154  -4.911  -4.696 1.00 . A A . 25 VAL HG22 1 1 
       10  9906 1 1 25 VAL HG23 H  -5.732  -5.950  -4.758 1.00 . A A . 25 VAL HG23 1 1 
       10  9907 1 1 25 VAL N    N  -9.392  -5.248  -5.830 1.00 . A A . 25 VAL N    1 1 
       10  9908 1 1 25 VAL O    O -10.110  -7.467  -4.476 1.00 . A A . 25 VAL O    1 1 
       10  9909 1 1 26 GLN C    C  -8.238 -10.310  -3.763 1.00 . A A . 26 GLN C    1 1 
       10  9910 1 1 26 GLN CA   C  -9.205 -10.049  -4.911 1.00 . A A . 26 GLN CA   1 1 
       10  9911 1 1 26 GLN CB   C  -9.264 -11.269  -5.833 1.00 . A A . 26 GLN CB   1 1 
       10  9912 1 1 26 GLN CD   C  -9.449 -10.289  -8.154 1.00 . A A . 26 GLN CD   1 1 
       10  9913 1 1 26 GLN CG   C -10.140 -11.067  -7.054 1.00 . A A . 26 GLN CG   1 1 
       10  9914 1 1 26 GLN H    H  -8.163  -8.961  -6.389 1.00 . A A . 26 GLN H    1 1 
       10  9915 1 1 26 GLN HA   H -10.190  -9.869  -4.504 1.00 . A A . 26 GLN HA   1 1 
       10  9916 1 1 26 GLN HB2  H  -8.263 -11.498  -6.171 1.00 . A A . 26 GLN HB2  1 1 
       10  9917 1 1 26 GLN HB3  H  -9.646 -12.110  -5.273 1.00 . A A . 26 GLN HB3  1 1 
       10  9918 1 1 26 GLN HE21 H -11.200  -9.764  -8.928 1.00 . A A . 26 GLN HE21 1 1 
       10  9919 1 1 26 GLN HE22 H  -9.810  -9.169  -9.757 1.00 . A A . 26 GLN HE22 1 1 
       10  9920 1 1 26 GLN HG2  H -10.420 -12.034  -7.442 1.00 . A A . 26 GLN HG2  1 1 
       10  9921 1 1 26 GLN HG3  H -11.030 -10.527  -6.757 1.00 . A A . 26 GLN HG3  1 1 
       10  9922 1 1 26 GLN N    N  -8.808  -8.865  -5.662 1.00 . A A . 26 GLN N    1 1 
       10  9923 1 1 26 GLN NE2  N -10.230  -9.679  -9.035 1.00 . A A . 26 GLN NE2  1 1 
       10  9924 1 1 26 GLN O    O  -7.027 -10.150  -3.908 1.00 . A A . 26 GLN O    1 1 
       10  9925 1 1 26 GLN OE1  O  -8.221 -10.236  -8.210 1.00 . A A . 26 GLN OE1  1 1 
       10  9926 1 1 27 GLN C    C  -6.888 -12.022  -1.749 1.00 . A A . 27 GLN C    1 1 
       10  9927 1 1 27 GLN CA   C  -7.974 -10.995  -1.441 1.00 . A A . 27 GLN CA   1 1 
       10  9928 1 1 27 GLN CB   C  -8.858 -11.499  -0.300 1.00 . A A . 27 GLN CB   1 1 
       10  9929 1 1 27 GLN CD   C -10.850 -11.068   1.194 1.00 . A A . 27 GLN CD   1 1 
       10  9930 1 1 27 GLN CG   C  -9.999 -10.555   0.050 1.00 . A A . 27 GLN CG   1 1 
       10  9931 1 1 27 GLN H    H  -9.756 -10.818  -2.572 1.00 . A A . 27 GLN H    1 1 
       10  9932 1 1 27 GLN HA   H  -7.502 -10.076  -1.139 1.00 . A A . 27 GLN HA   1 1 
       10  9933 1 1 27 GLN HB2  H  -9.283 -12.451  -0.581 1.00 . A A . 27 GLN HB2  1 1 
       10  9934 1 1 27 GLN HB3  H  -8.249 -11.632   0.582 1.00 . A A . 27 GLN HB3  1 1 
       10  9935 1 1 27 GLN HE21 H -12.470 -10.969   0.060 1.00 . A A . 27 GLN HE21 1 1 
       10  9936 1 1 27 GLN HE22 H -12.720 -11.534   1.674 1.00 . A A . 27 GLN HE22 1 1 
       10  9937 1 1 27 GLN HG2  H  -9.584  -9.598   0.330 1.00 . A A . 27 GLN HG2  1 1 
       10  9938 1 1 27 GLN HG3  H -10.620 -10.433  -0.821 1.00 . A A . 27 GLN HG3  1 1 
       10  9939 1 1 27 GLN N    N  -8.784 -10.711  -2.621 1.00 . A A . 27 GLN N    1 1 
       10  9940 1 1 27 GLN NE2  N -12.140 -11.204   0.951 1.00 . A A . 27 GLN NE2  1 1 
       10  9941 1 1 27 GLN O    O  -5.862 -12.078  -1.073 1.00 . A A . 27 GLN O    1 1 
       10  9942 1 1 27 GLN OE1  O -10.340 -11.339   2.285 1.00 . A A . 27 GLN OE1  1 1 
       10  9943 1 1 28 SER C    C  -4.878 -13.225  -3.693 1.00 . A A . 28 SER C    1 1 
       10  9944 1 1 28 SER CA   C  -6.167 -13.855  -3.176 1.00 . A A . 28 SER CA   1 1 
       10  9945 1 1 28 SER CB   C  -6.774 -14.757  -4.252 1.00 . A A . 28 SER CB   1 1 
       10  9946 1 1 28 SER H    H  -7.957 -12.737  -3.274 1.00 . A A . 28 SER H    1 1 
       10  9947 1 1 28 SER HA   H  -5.939 -14.451  -2.306 1.00 . A A . 28 SER HA   1 1 
       10  9948 1 1 28 SER HB2  H  -7.260 -14.148  -4.999 1.00 . A A . 28 SER HB2  1 1 
       10  9949 1 1 28 SER HB3  H  -5.990 -15.338  -4.716 1.00 . A A . 28 SER HB3  1 1 
       10  9950 1 1 28 SER HG   H  -7.346 -16.521  -3.619 1.00 . A A . 28 SER HG   1 1 
       10  9951 1 1 28 SER N    N  -7.123 -12.832  -2.776 1.00 . A A . 28 SER N    1 1 
       10  9952 1 1 28 SER O    O  -3.783 -13.579  -3.256 1.00 . A A . 28 SER O    1 1 
       10  9953 1 1 28 SER OG   O  -7.730 -15.644  -3.696 1.00 . A A . 28 SER OG   1 1 
       10  9954 1 1 29 ALA C    C  -3.058 -10.883  -4.133 1.00 . A A . 29 ALA C    1 1 
       10  9955 1 1 29 ALA CA   C  -3.864 -11.609  -5.205 1.00 . A A . 29 ALA CA   1 1 
       10  9956 1 1 29 ALA CB   C  -4.313 -10.631  -6.282 1.00 . A A . 29 ALA CB   1 1 
       10  9957 1 1 29 ALA H    H  -5.916 -12.051  -4.935 1.00 . A A . 29 ALA H    1 1 
       10  9958 1 1 29 ALA HA   H  -3.235 -12.355  -5.668 1.00 . A A . 29 ALA HA   1 1 
       10  9959 1 1 29 ALA HB1  H  -3.610 -10.650  -7.100 1.00 . A A . 29 ALA HB1  1 1 
       10  9960 1 1 29 ALA HB2  H  -4.358  -9.636  -5.867 1.00 . A A . 29 ALA HB2  1 1 
       10  9961 1 1 29 ALA HB3  H  -5.291 -10.917  -6.641 1.00 . A A . 29 ALA HB3  1 1 
       10  9962 1 1 29 ALA N    N  -5.017 -12.290  -4.627 1.00 . A A . 29 ALA N    1 1 
       10  9963 1 1 29 ALA O    O  -1.833 -10.806  -4.210 1.00 . A A . 29 ALA O    1 1 
       10  9964 1 1 30 ILE C    C  -2.142 -10.548  -1.289 1.00 . A A . 30 ILE C    1 1 
       10  9965 1 1 30 ILE CA   C  -3.101  -9.636  -2.045 1.00 . A A . 30 ILE CA   1 1 
       10  9966 1 1 30 ILE CB   C  -4.128  -9.055  -1.053 1.00 . A A . 30 ILE CB   1 1 
       10  9967 1 1 30 ILE CD1  C  -4.666  -7.171  -2.680 1.00 . A A . 30 ILE CD1  1 1 
       10  9968 1 1 30 ILE CG1  C  -5.212  -8.272  -1.798 1.00 . A A . 30 ILE CG1  1 1 
       10  9969 1 1 30 ILE CG2  C  -3.434  -8.165  -0.032 1.00 . A A . 30 ILE CG2  1 1 
       10  9970 1 1 30 ILE H    H  -4.730 -10.449  -3.125 1.00 . A A . 30 ILE H    1 1 
       10  9971 1 1 30 ILE HA   H  -2.542  -8.818  -2.475 1.00 . A A . 30 ILE HA   1 1 
       10  9972 1 1 30 ILE HB   H  -4.587  -9.875  -0.523 1.00 . A A . 30 ILE HB   1 1 
       10  9973 1 1 30 ILE HD11 H  -3.776  -6.756  -2.230 1.00 . A A . 30 ILE HD11 1 1 
       10  9974 1 1 30 ILE HD12 H  -5.409  -6.396  -2.790 1.00 . A A . 30 ILE HD12 1 1 
       10  9975 1 1 30 ILE HD13 H  -4.421  -7.575  -3.651 1.00 . A A . 30 ILE HD13 1 1 
       10  9976 1 1 30 ILE HG12 H  -5.772  -8.950  -2.423 1.00 . A A . 30 ILE HG12 1 1 
       10  9977 1 1 30 ILE HG13 H  -5.879  -7.820  -1.078 1.00 . A A . 30 ILE HG13 1 1 
       10  9978 1 1 30 ILE HG21 H  -4.076  -8.033   0.826 1.00 . A A . 30 ILE HG21 1 1 
       10  9979 1 1 30 ILE HG22 H  -3.223  -7.204  -0.477 1.00 . A A . 30 ILE HG22 1 1 
       10  9980 1 1 30 ILE HG23 H  -2.508  -8.627   0.279 1.00 . A A . 30 ILE HG23 1 1 
       10  9981 1 1 30 ILE N    N  -3.755 -10.353  -3.133 1.00 . A A . 30 ILE N    1 1 
       10  9982 1 1 30 ILE O    O  -0.980 -10.202  -1.073 1.00 . A A . 30 ILE O    1 1 
       10  9983 1 1 31 ASN C    C  -0.637 -13.138  -1.004 1.00 . A A . 31 ASN C    1 1 
       10  9984 1 1 31 ASN CA   C  -1.823 -12.680  -0.161 1.00 . A A . 31 ASN CA   1 1 
       10  9985 1 1 31 ASN CB   C  -2.673 -13.885   0.249 1.00 . A A . 31 ASN CB   1 1 
       10  9986 1 1 31 ASN CG   C  -2.705 -14.085   1.753 1.00 . A A . 31 ASN CG   1 1 
       10  9987 1 1 31 ASN H    H  -3.569 -11.934  -1.095 1.00 . A A . 31 ASN H    1 1 
       10  9988 1 1 31 ASN HA   H  -1.451 -12.194   0.727 1.00 . A A . 31 ASN HA   1 1 
       10  9989 1 1 31 ASN HB2  H  -3.685 -13.737  -0.095 1.00 . A A . 31 ASN HB2  1 1 
       10  9990 1 1 31 ASN HB3  H  -2.268 -14.778  -0.206 1.00 . A A . 31 ASN HB3  1 1 
       10  9991 1 1 31 ASN HD21 H  -1.073 -15.221   1.657 1.00 . A A . 31 ASN HD21 1 1 
       10  9992 1 1 31 ASN HD22 H  -1.740 -14.986   3.242 1.00 . A A . 31 ASN HD22 1 1 
       10  9993 1 1 31 ASN N    N  -2.635 -11.715  -0.891 1.00 . A A . 31 ASN N    1 1 
       10  9994 1 1 31 ASN ND2  N  -1.742 -14.840   2.269 1.00 . A A . 31 ASN ND2  1 1 
       10  9995 1 1 31 ASN O    O   0.429 -13.449  -0.474 1.00 . A A . 31 ASN O    1 1 
       10  9996 1 1 31 ASN OD1  O  -3.584 -13.568   2.442 1.00 . A A . 31 ASN OD1  1 1 
       10  9997 1 1 32 LYS C    C   1.281 -12.521  -3.396 1.00 . A A . 32 LYS C    1 1 
       10  9998 1 1 32 LYS CA   C   0.219 -13.601  -3.235 1.00 . A A . 32 LYS CA   1 1 
       10  9999 1 1 32 LYS CB   C  -0.376 -13.952  -4.599 1.00 . A A . 32 LYS CB   1 1 
       10 10000 1 1 32 LYS CD   C  -0.768 -16.429  -4.460 1.00 . A A . 32 LYS CD   1 1 
       10 10001 1 1 32 LYS CE   C  -1.538 -17.462  -5.269 1.00 . A A . 32 LYS CE   1 1 
       10 10002 1 1 32 LYS CG   C  -1.418 -15.058  -4.544 1.00 . A A . 32 LYS CG   1 1 
       10 10003 1 1 32 LYS H    H  -1.703 -12.923  -2.681 1.00 . A A . 32 LYS H    1 1 
       10 10004 1 1 32 LYS HA   H   0.678 -14.476  -2.818 1.00 . A A . 32 LYS HA   1 1 
       10 10005 1 1 32 LYS HB2  H  -0.840 -13.069  -5.015 1.00 . A A . 32 LYS HB2  1 1 
       10 10006 1 1 32 LYS HB3  H   0.422 -14.270  -5.255 1.00 . A A . 32 LYS HB3  1 1 
       10 10007 1 1 32 LYS HD2  H   0.238 -16.365  -4.845 1.00 . A A . 32 LYS HD2  1 1 
       10 10008 1 1 32 LYS HD3  H  -0.742 -16.742  -3.427 1.00 . A A . 32 LYS HD3  1 1 
       10 10009 1 1 32 LYS HE2  H  -2.594 -17.319  -5.098 1.00 . A A . 32 LYS HE2  1 1 
       10 10010 1 1 32 LYS HE3  H  -1.320 -17.316  -6.316 1.00 . A A . 32 LYS HE3  1 1 
       10 10011 1 1 32 LYS HG2  H  -2.039 -14.911  -3.675 1.00 . A A . 32 LYS HG2  1 1 
       10 10012 1 1 32 LYS HG3  H  -2.025 -15.012  -5.437 1.00 . A A . 32 LYS HG3  1 1 
       10 10013 1 1 32 LYS HZ1  H  -0.220 -18.868  -4.462 1.00 . A A . 32 LYS HZ1  1 1 
       10 10014 1 1 32 LYS HZ2  H  -1.172 -19.467  -5.726 1.00 . A A . 32 LYS HZ2  1 1 
       10 10015 1 1 32 LYS HZ3  H  -1.853 -19.227  -4.197 1.00 . A A . 32 LYS HZ3  1 1 
       10 10016 1 1 32 LYS N    N  -0.832 -13.179  -2.319 1.00 . A A . 32 LYS N    1 1 
       10 10017 1 1 32 LYS NZ   N  -1.170 -18.853  -4.887 1.00 . A A . 32 LYS NZ   1 1 
       10 10018 1 1 32 LYS O    O   2.436 -12.813  -3.700 1.00 . A A . 32 LYS O    1 1 
       10 10019 1 1 33 TRP C    C   2.828 -10.148  -2.219 1.00 . A A . 33 TRP C    1 1 
       10 10020 1 1 33 TRP CA   C   1.779 -10.148  -3.327 1.00 . A A . 33 TRP CA   1 1 
       10 10021 1 1 33 TRP CB   C   0.956  -8.872  -3.286 1.00 . A A . 33 TRP CB   1 1 
       10 10022 1 1 33 TRP CD1  C   0.301  -9.313  -5.689 1.00 . A A . 33 TRP CD1  1 1 
       10 10023 1 1 33 TRP CD2  C  -0.885  -7.703  -4.714 1.00 . A A . 33 TRP CD2  1 1 
       10 10024 1 1 33 TRP CE2  C  -1.335  -7.842  -6.039 1.00 . A A . 33 TRP CE2  1 1 
       10 10025 1 1 33 TRP CE3  C  -1.483  -6.754  -3.893 1.00 . A A . 33 TRP CE3  1 1 
       10 10026 1 1 33 TRP CG   C   0.168  -8.644  -4.526 1.00 . A A . 33 TRP CG   1 1 
       10 10027 1 1 33 TRP CH2  C  -2.933  -6.134  -5.732 1.00 . A A . 33 TRP CH2  1 1 
       10 10028 1 1 33 TRP CZ2  C  -2.361  -7.063  -6.560 1.00 . A A . 33 TRP CZ2  1 1 
       10 10029 1 1 33 TRP CZ3  C  -2.504  -5.976  -4.407 1.00 . A A . 33 TRP CZ3  1 1 
       10 10030 1 1 33 TRP H    H  -0.057 -11.097  -2.965 1.00 . A A . 33 TRP H    1 1 
       10 10031 1 1 33 TRP HA   H   2.273 -10.218  -4.285 1.00 . A A . 33 TRP HA   1 1 
       10 10032 1 1 33 TRP HB2  H   0.260  -8.945  -2.479 1.00 . A A . 33 TRP HB2  1 1 
       10 10033 1 1 33 TRP HB3  H   1.608  -8.029  -3.134 1.00 . A A . 33 TRP HB3  1 1 
       10 10034 1 1 33 TRP HD1  H   1.016 -10.098  -5.839 1.00 . A A . 33 TRP HD1  1 1 
       10 10035 1 1 33 TRP HE1  H  -0.682  -9.153  -7.539 1.00 . A A . 33 TRP HE1  1 1 
       10 10036 1 1 33 TRP HE3  H  -1.161  -6.630  -2.870 1.00 . A A . 33 TRP HE3  1 1 
       10 10037 1 1 33 TRP HH2  H  -3.734  -5.506  -6.095 1.00 . A A . 33 TRP HH2  1 1 
       10 10038 1 1 33 TRP HZ2  H  -2.700  -7.175  -7.579 1.00 . A A . 33 TRP HZ2  1 1 
       10 10039 1 1 33 TRP HZ3  H  -2.980  -5.234  -3.785 1.00 . A A . 33 TRP HZ3  1 1 
       10 10040 1 1 33 TRP N    N   0.878 -11.274  -3.199 1.00 . A A . 33 TRP N    1 1 
       10 10041 1 1 33 TRP NE1  N  -0.591  -8.835  -6.618 1.00 . A A . 33 TRP NE1  1 1 
       10 10042 1 1 33 TRP O    O   4.023 -10.009  -2.483 1.00 . A A . 33 TRP O    1 1 
       10 10043 1 1 34 ILE C    C   3.935 -11.688   0.327 1.00 . A A . 34 ILE C    1 1 
       10 10044 1 1 34 ILE CA   C   3.273 -10.322   0.167 1.00 . A A . 34 ILE CA   1 1 
       10 10045 1 1 34 ILE CB   C   2.529  -9.970   1.469 1.00 . A A . 34 ILE CB   1 1 
       10 10046 1 1 34 ILE CD1  C   0.215  -8.920   1.623 1.00 . A A . 34 ILE CD1  1 1 
       10 10047 1 1 34 ILE CG1  C   1.674  -8.715   1.275 1.00 . A A . 34 ILE CG1  1 1 
       10 10048 1 1 34 ILE CG2  C   3.519  -9.774   2.609 1.00 . A A . 34 ILE CG2  1 1 
       10 10049 1 1 34 ILE H    H   1.412 -10.409  -0.835 1.00 . A A . 34 ILE H    1 1 
       10 10050 1 1 34 ILE HA   H   4.040  -9.579   0.003 1.00 . A A . 34 ILE HA   1 1 
       10 10051 1 1 34 ILE HB   H   1.886 -10.799   1.725 1.00 . A A . 34 ILE HB   1 1 
       10 10052 1 1 34 ILE HD11 H   0.067  -9.930   1.975 1.00 . A A . 34 ILE HD11 1 1 
       10 10053 1 1 34 ILE HD12 H  -0.392  -8.750   0.747 1.00 . A A . 34 ILE HD12 1 1 
       10 10054 1 1 34 ILE HD13 H  -0.070  -8.225   2.400 1.00 . A A . 34 ILE HD13 1 1 
       10 10055 1 1 34 ILE HG12 H   2.055  -7.923   1.902 1.00 . A A . 34 ILE HG12 1 1 
       10 10056 1 1 34 ILE HG13 H   1.726  -8.407   0.240 1.00 . A A . 34 ILE HG13 1 1 
       10 10057 1 1 34 ILE HG21 H   3.166  -8.990   3.262 1.00 . A A . 34 ILE HG21 1 1 
       10 10058 1 1 34 ILE HG22 H   4.482  -9.497   2.205 1.00 . A A . 34 ILE HG22 1 1 
       10 10059 1 1 34 ILE HG23 H   3.612 -10.693   3.167 1.00 . A A . 34 ILE HG23 1 1 
       10 10060 1 1 34 ILE N    N   2.374 -10.304  -0.981 1.00 . A A . 34 ILE N    1 1 
       10 10061 1 1 34 ILE O    O   5.021 -11.801   0.894 1.00 . A A . 34 ILE O    1 1 
       10 10062 1 1 35 HIS C    C   5.150 -14.195  -0.770 1.00 . A A . 35 HIS C    1 1 
       10 10063 1 1 35 HIS CA   C   3.790 -14.084  -0.093 1.00 . A A . 35 HIS CA   1 1 
       10 10064 1 1 35 HIS CB   C   2.809 -15.061  -0.742 1.00 . A A . 35 HIS CB   1 1 
       10 10065 1 1 35 HIS CD2  C   1.190 -16.912   0.066 1.00 . A A . 35 HIS CD2  1 1 
       10 10066 1 1 35 HIS CE1  C   1.086 -16.355   2.184 1.00 . A A . 35 HIS CE1  1 1 
       10 10067 1 1 35 HIS CG   C   1.977 -15.825   0.239 1.00 . A A . 35 HIS CG   1 1 
       10 10068 1 1 35 HIS H    H   2.409 -12.572  -0.617 1.00 . A A . 35 HIS H    1 1 
       10 10069 1 1 35 HIS HA   H   3.900 -14.332   0.947 1.00 . A A . 35 HIS HA   1 1 
       10 10070 1 1 35 HIS HB2  H   2.140 -14.511  -1.384 1.00 . A A . 35 HIS HB2  1 1 
       10 10071 1 1 35 HIS HB3  H   3.362 -15.773  -1.336 1.00 . A A . 35 HIS HB3  1 1 
       10 10072 1 1 35 HIS HD1  H   2.346 -14.752   2.017 1.00 . A A . 35 HIS HD1  1 1 
       10 10073 1 1 35 HIS HD2  H   1.019 -17.435  -0.863 1.00 . A A . 35 HIS HD2  1 1 
       10 10074 1 1 35 HIS HE1  H   0.830 -16.347   3.233 1.00 . A A . 35 HIS HE1  1 1 
       10 10075 1 1 35 HIS HE2  H  -0.023 -17.916   1.456 1.00 . A A . 35 HIS HE2  1 1 
       10 10076 1 1 35 HIS N    N   3.271 -12.724  -0.178 1.00 . A A . 35 HIS N    1 1 
       10 10077 1 1 35 HIS ND1  N   1.889 -15.500   1.576 1.00 . A A . 35 HIS ND1  1 1 
       10 10078 1 1 35 HIS NE2  N   0.649 -17.222   1.289 1.00 . A A . 35 HIS NE2  1 1 
       10 10079 1 1 35 HIS O    O   5.992 -15.000  -0.373 1.00 . A A . 35 HIS O    1 1 
       10 10080 1 1 36 ALA C    C   7.463 -12.179  -2.193 1.00 . A A . 36 ALA C    1 1 
       10 10081 1 1 36 ALA CA   C   6.598 -13.387  -2.543 1.00 . A A . 36 ALA CA   1 1 
       10 10082 1 1 36 ALA CB   C   6.312 -13.427  -4.036 1.00 . A A . 36 ALA CB   1 1 
       10 10083 1 1 36 ALA H    H   4.634 -12.773  -2.062 1.00 . A A . 36 ALA H    1 1 
       10 10084 1 1 36 ALA HA   H   7.137 -14.287  -2.283 1.00 . A A . 36 ALA HA   1 1 
       10 10085 1 1 36 ALA HB1  H   6.146 -12.423  -4.397 1.00 . A A . 36 ALA HB1  1 1 
       10 10086 1 1 36 ALA HB2  H   5.430 -14.025  -4.216 1.00 . A A . 36 ALA HB2  1 1 
       10 10087 1 1 36 ALA HB3  H   7.154 -13.862  -4.554 1.00 . A A . 36 ALA HB3  1 1 
       10 10088 1 1 36 ALA N    N   5.348 -13.385  -1.796 1.00 . A A . 36 ALA N    1 1 
       10 10089 1 1 36 ALA O    O   8.661 -12.162  -2.476 1.00 . A A . 36 ALA O    1 1 
       10 10090 1 1 37 GLY C    C   7.436  -8.858  -2.210 1.00 . A A . 37 GLY C    1 1 
       10 10091 1 1 37 GLY CA   C   7.589  -9.979  -1.201 1.00 . A A . 37 GLY CA   1 1 
       10 10092 1 1 37 GLY H    H   5.897 -11.240  -1.375 1.00 . A A . 37 GLY H    1 1 
       10 10093 1 1 37 GLY HA2  H   7.229  -9.636  -0.241 1.00 . A A . 37 GLY HA2  1 1 
       10 10094 1 1 37 GLY HA3  H   8.636 -10.229  -1.112 1.00 . A A . 37 GLY HA3  1 1 
       10 10095 1 1 37 GLY N    N   6.853 -11.172  -1.577 1.00 . A A . 37 GLY N    1 1 
       10 10096 1 1 37 GLY O    O   8.419  -8.232  -2.606 1.00 . A A . 37 GLY O    1 1 
       10 10097 1 1 38 ARG C    C   5.865  -6.187  -2.909 1.00 . A A . 38 ARG C    1 1 
       10 10098 1 1 38 ARG CA   C   5.923  -7.548  -3.593 1.00 . A A . 38 ARG CA   1 1 
       10 10099 1 1 38 ARG CB   C   4.603  -7.824  -4.318 1.00 . A A . 38 ARG CB   1 1 
       10 10100 1 1 38 ARG CD   C   3.764  -7.804  -6.686 1.00 . A A . 38 ARG CD   1 1 
       10 10101 1 1 38 ARG CG   C   4.418  -6.995  -5.578 1.00 . A A . 38 ARG CG   1 1 
       10 10102 1 1 38 ARG CZ   C   3.345  -7.538  -9.100 1.00 . A A . 38 ARG CZ   1 1 
       10 10103 1 1 38 ARG H    H   5.457  -9.135  -2.272 1.00 . A A . 38 ARG H    1 1 
       10 10104 1 1 38 ARG HA   H   6.725  -7.543  -4.315 1.00 . A A . 38 ARG HA   1 1 
       10 10105 1 1 38 ARG HB2  H   4.566  -8.868  -4.589 1.00 . A A . 38 ARG HB2  1 1 
       10 10106 1 1 38 ARG HB3  H   3.785  -7.607  -3.646 1.00 . A A . 38 ARG HB3  1 1 
       10 10107 1 1 38 ARG HD2  H   4.397  -8.647  -6.922 1.00 . A A . 38 ARG HD2  1 1 
       10 10108 1 1 38 ARG HD3  H   2.806  -8.162  -6.336 1.00 . A A . 38 ARG HD3  1 1 
       10 10109 1 1 38 ARG HE   H   3.586  -6.036  -7.808 1.00 . A A . 38 ARG HE   1 1 
       10 10110 1 1 38 ARG HG2  H   3.793  -6.145  -5.351 1.00 . A A . 38 ARG HG2  1 1 
       10 10111 1 1 38 ARG HG3  H   5.384  -6.652  -5.917 1.00 . A A . 38 ARG HG3  1 1 
       10 10112 1 1 38 ARG HH11 H   3.434  -9.458  -8.473 1.00 . A A . 38 ARG HH11 1 1 
       10 10113 1 1 38 ARG HH12 H   3.139  -9.244 -10.166 1.00 . A A . 38 ARG HH12 1 1 
       10 10114 1 1 38 ARG HH21 H   3.199  -5.752 -10.034 1.00 . A A . 38 ARG HH21 1 1 
       10 10115 1 1 38 ARG HH22 H   3.007  -7.140 -11.052 1.00 . A A . 38 ARG HH22 1 1 
       10 10116 1 1 38 ARG N    N   6.200  -8.603  -2.626 1.00 . A A . 38 ARG N    1 1 
       10 10117 1 1 38 ARG NE   N   3.560  -7.012  -7.897 1.00 . A A . 38 ARG NE   1 1 
       10 10118 1 1 38 ARG NH1  N   3.302  -8.855  -9.259 1.00 . A A . 38 ARG NH1  1 1 
       10 10119 1 1 38 ARG NH2  N   3.169  -6.745 -10.147 1.00 . A A . 38 ARG NH2  1 1 
       10 10120 1 1 38 ARG O    O   4.840  -5.809  -2.344 1.00 . A A . 38 ARG O    1 1 
       10 10121 1 1 39 LYS C    C   6.193  -3.130  -3.108 1.00 . A A . 39 LYS C    1 1 
       10 10122 1 1 39 LYS CA   C   7.050  -4.137  -2.348 1.00 . A A . 39 LYS CA   1 1 
       10 10123 1 1 39 LYS CB   C   8.502  -3.656  -2.299 1.00 . A A . 39 LYS CB   1 1 
       10 10124 1 1 39 LYS CD   C  10.606  -4.176  -3.574 1.00 . A A . 39 LYS CD   1 1 
       10 10125 1 1 39 LYS CE   C  11.232  -4.311  -4.953 1.00 . A A . 39 LYS CE   1 1 
       10 10126 1 1 39 LYS CG   C   9.184  -3.643  -3.659 1.00 . A A . 39 LYS CG   1 1 
       10 10127 1 1 39 LYS H    H   7.760  -5.814  -3.428 1.00 . A A . 39 LYS H    1 1 
       10 10128 1 1 39 LYS HA   H   6.675  -4.221  -1.338 1.00 . A A . 39 LYS HA   1 1 
       10 10129 1 1 39 LYS HB2  H   8.523  -2.653  -1.900 1.00 . A A . 39 LYS HB2  1 1 
       10 10130 1 1 39 LYS HB3  H   9.062  -4.308  -1.646 1.00 . A A . 39 LYS HB3  1 1 
       10 10131 1 1 39 LYS HD2  H  11.200  -3.494  -2.986 1.00 . A A . 39 LYS HD2  1 1 
       10 10132 1 1 39 LYS HD3  H  10.588  -5.145  -3.099 1.00 . A A . 39 LYS HD3  1 1 
       10 10133 1 1 39 LYS HE2  H  10.779  -5.151  -5.459 1.00 . A A . 39 LYS HE2  1 1 
       10 10134 1 1 39 LYS HE3  H  11.041  -3.409  -5.513 1.00 . A A . 39 LYS HE3  1 1 
       10 10135 1 1 39 LYS HG2  H   8.618  -4.260  -4.340 1.00 . A A . 39 LYS HG2  1 1 
       10 10136 1 1 39 LYS HG3  H   9.211  -2.626  -4.026 1.00 . A A . 39 LYS HG3  1 1 
       10 10137 1 1 39 LYS HZ1  H  13.048  -4.966  -5.756 1.00 . A A . 39 LYS HZ1  1 1 
       10 10138 1 1 39 LYS HZ2  H  12.930  -5.160  -4.080 1.00 . A A . 39 LYS HZ2  1 1 
       10 10139 1 1 39 LYS HZ3  H  13.193  -3.624  -4.734 1.00 . A A . 39 LYS HZ3  1 1 
       10 10140 1 1 39 LYS N    N   6.974  -5.457  -2.963 1.00 . A A . 39 LYS N    1 1 
       10 10141 1 1 39 LYS NZ   N  12.704  -4.531  -4.875 1.00 . A A . 39 LYS NZ   1 1 
       10 10142 1 1 39 LYS O    O   6.444  -2.846  -4.279 1.00 . A A . 39 LYS O    1 1 
       10 10143 1 1 40 ILE C    C   3.877  -0.546  -2.039 1.00 . A A . 40 ILE C    1 1 
       10 10144 1 1 40 ILE CA   C   4.285  -1.619  -3.044 1.00 . A A . 40 ILE CA   1 1 
       10 10145 1 1 40 ILE CB   C   3.012  -2.288  -3.599 1.00 . A A . 40 ILE CB   1 1 
       10 10146 1 1 40 ILE CD1  C   2.139  -4.342  -4.815 1.00 . A A . 40 ILE CD1  1 1 
       10 10147 1 1 40 ILE CG1  C   3.354  -3.600  -4.305 1.00 . A A . 40 ILE CG1  1 1 
       10 10148 1 1 40 ILE CG2  C   2.288  -1.346  -4.549 1.00 . A A . 40 ILE CG2  1 1 
       10 10149 1 1 40 ILE H    H   5.033  -2.863  -1.501 1.00 . A A . 40 ILE H    1 1 
       10 10150 1 1 40 ILE HA   H   4.809  -1.152  -3.864 1.00 . A A . 40 ILE HA   1 1 
       10 10151 1 1 40 ILE HB   H   2.353  -2.496  -2.769 1.00 . A A . 40 ILE HB   1 1 
       10 10152 1 1 40 ILE HD11 H   1.955  -5.204  -4.192 1.00 . A A . 40 ILE HD11 1 1 
       10 10153 1 1 40 ILE HD12 H   2.313  -4.662  -5.832 1.00 . A A . 40 ILE HD12 1 1 
       10 10154 1 1 40 ILE HD13 H   1.281  -3.686  -4.786 1.00 . A A . 40 ILE HD13 1 1 
       10 10155 1 1 40 ILE HG12 H   3.995  -3.391  -5.149 1.00 . A A . 40 ILE HG12 1 1 
       10 10156 1 1 40 ILE HG13 H   3.875  -4.248  -3.616 1.00 . A A . 40 ILE HG13 1 1 
       10 10157 1 1 40 ILE HG21 H   1.580  -1.906  -5.141 1.00 . A A . 40 ILE HG21 1 1 
       10 10158 1 1 40 ILE HG22 H   3.008  -0.872  -5.200 1.00 . A A . 40 ILE HG22 1 1 
       10 10159 1 1 40 ILE HG23 H   1.765  -0.593  -3.979 1.00 . A A . 40 ILE HG23 1 1 
       10 10160 1 1 40 ILE N    N   5.181  -2.595  -2.433 1.00 . A A . 40 ILE N    1 1 
       10 10161 1 1 40 ILE O    O   4.034  -0.722  -0.831 1.00 . A A . 40 ILE O    1 1 
       10 10162 1 1 41 PHE C    C   1.571   2.211  -2.156 1.00 . A A . 41 PHE C    1 1 
       10 10163 1 1 41 PHE CA   C   2.914   1.659  -1.691 1.00 . A A . 41 PHE CA   1 1 
       10 10164 1 1 41 PHE CB   C   3.957   2.778  -1.680 1.00 . A A . 41 PHE CB   1 1 
       10 10165 1 1 41 PHE CD1  C   5.508   2.369   0.249 1.00 . A A . 41 PHE CD1  1 1 
       10 10166 1 1 41 PHE CD2  C   6.310   1.951  -1.958 1.00 . A A . 41 PHE CD2  1 1 
       10 10167 1 1 41 PHE CE1  C   6.729   1.982   0.769 1.00 . A A . 41 PHE CE1  1 1 
       10 10168 1 1 41 PHE CE2  C   7.532   1.563  -1.444 1.00 . A A . 41 PHE CE2  1 1 
       10 10169 1 1 41 PHE CG   C   5.285   2.358  -1.118 1.00 . A A . 41 PHE CG   1 1 
       10 10170 1 1 41 PHE CZ   C   7.742   1.580  -0.079 1.00 . A A . 41 PHE CZ   1 1 
       10 10171 1 1 41 PHE H    H   3.246   0.641  -3.517 1.00 . A A . 41 PHE H    1 1 
       10 10172 1 1 41 PHE HA   H   2.805   1.272  -0.691 1.00 . A A . 41 PHE HA   1 1 
       10 10173 1 1 41 PHE HB2  H   4.118   3.121  -2.690 1.00 . A A . 41 PHE HB2  1 1 
       10 10174 1 1 41 PHE HB3  H   3.585   3.599  -1.081 1.00 . A A . 41 PHE HB3  1 1 
       10 10175 1 1 41 PHE HD1  H   4.715   2.683   0.913 1.00 . A A . 41 PHE HD1  1 1 
       10 10176 1 1 41 PHE HD2  H   6.147   1.939  -3.025 1.00 . A A . 41 PHE HD2  1 1 
       10 10177 1 1 41 PHE HE1  H   6.890   1.995   1.836 1.00 . A A . 41 PHE HE1  1 1 
       10 10178 1 1 41 PHE HE2  H   8.323   1.249  -2.108 1.00 . A A . 41 PHE HE2  1 1 
       10 10179 1 1 41 PHE HZ   H   8.697   1.277   0.327 1.00 . A A . 41 PHE HZ   1 1 
       10 10180 1 1 41 PHE N    N   3.349   0.562  -2.546 1.00 . A A . 41 PHE N    1 1 
       10 10181 1 1 41 PHE O    O   1.450   2.710  -3.274 1.00 . A A . 41 PHE O    1 1 
       10 10182 1 1 42 LEU C    C  -0.956   4.048  -1.160 1.00 . A A . 42 LEU C    1 1 
       10 10183 1 1 42 LEU CA   C  -0.764   2.611  -1.628 1.00 . A A . 42 LEU CA   1 1 
       10 10184 1 1 42 LEU CB   C  -1.852   1.717  -1.022 1.00 . A A . 42 LEU CB   1 1 
       10 10185 1 1 42 LEU CD1  C  -0.515  -0.070   0.148 1.00 . A A . 42 LEU CD1  1 1 
       10 10186 1 1 42 LEU CD2  C  -1.023   2.093   1.323 1.00 . A A . 42 LEU CD2  1 1 
       10 10187 1 1 42 LEU CG   C  -1.521   1.061   0.320 1.00 . A A . 42 LEU CG   1 1 
       10 10188 1 1 42 LEU H    H   0.717   1.710  -0.419 1.00 . A A . 42 LEU H    1 1 
       10 10189 1 1 42 LEU HA   H  -0.858   2.588  -2.701 1.00 . A A . 42 LEU HA   1 1 
       10 10190 1 1 42 LEU HB2  H  -2.738   2.318  -0.886 1.00 . A A . 42 LEU HB2  1 1 
       10 10191 1 1 42 LEU HB3  H  -2.076   0.935  -1.731 1.00 . A A . 42 LEU HB3  1 1 
       10 10192 1 1 42 LEU HD11 H   0.309   0.074   0.832 1.00 . A A . 42 LEU HD11 1 1 
       10 10193 1 1 42 LEU HD12 H  -0.145  -0.070  -0.867 1.00 . A A . 42 LEU HD12 1 1 
       10 10194 1 1 42 LEU HD13 H  -0.996  -1.014   0.357 1.00 . A A . 42 LEU HD13 1 1 
       10 10195 1 1 42 LEU HD21 H  -0.859   1.616   2.276 1.00 . A A . 42 LEU HD21 1 1 
       10 10196 1 1 42 LEU HD22 H  -1.764   2.872   1.434 1.00 . A A . 42 LEU HD22 1 1 
       10 10197 1 1 42 LEU HD23 H  -0.100   2.525   0.973 1.00 . A A . 42 LEU HD23 1 1 
       10 10198 1 1 42 LEU HG   H  -2.421   0.632   0.718 1.00 . A A . 42 LEU HG   1 1 
       10 10199 1 1 42 LEU N    N   0.563   2.118  -1.294 1.00 . A A . 42 LEU N    1 1 
       10 10200 1 1 42 LEU O    O  -0.592   4.406  -0.041 1.00 . A A . 42 LEU O    1 1 
       10 10201 1 1 43 THR C    C  -3.256   6.469  -1.351 1.00 . A A . 43 THR C    1 1 
       10 10202 1 1 43 THR CA   C  -1.789   6.263  -1.706 1.00 . A A . 43 THR CA   1 1 
       10 10203 1 1 43 THR CB   C  -1.396   7.163  -2.879 1.00 . A A . 43 THR CB   1 1 
       10 10204 1 1 43 THR CG2  C  -0.881   8.518  -2.445 1.00 . A A . 43 THR CG2  1 1 
       10 10205 1 1 43 THR H    H  -1.811   4.522  -2.904 1.00 . A A . 43 THR H    1 1 
       10 10206 1 1 43 THR HA   H  -1.184   6.519  -0.850 1.00 . A A . 43 THR HA   1 1 
       10 10207 1 1 43 THR HB   H  -2.264   7.322  -3.503 1.00 . A A . 43 THR HB   1 1 
       10 10208 1 1 43 THR HG1  H  -0.093   7.161  -4.344 1.00 . A A . 43 THR HG1  1 1 
       10 10209 1 1 43 THR HG21 H  -0.336   8.975  -3.259 1.00 . A A . 43 THR HG21 1 1 
       10 10210 1 1 43 THR HG22 H  -0.224   8.400  -1.596 1.00 . A A . 43 THR HG22 1 1 
       10 10211 1 1 43 THR HG23 H  -1.713   9.150  -2.171 1.00 . A A . 43 THR HG23 1 1 
       10 10212 1 1 43 THR N    N  -1.537   4.867  -2.028 1.00 . A A . 43 THR N    1 1 
       10 10213 1 1 43 THR O    O  -4.139   6.287  -2.191 1.00 . A A . 43 THR O    1 1 
       10 10214 1 1 43 THR OG1  O  -0.389   6.549  -3.664 1.00 . A A . 43 THR OG1  1 1 
       10 10215 1 1 44 ILE C    C  -5.342   8.469   0.042 1.00 . A A . 44 ILE C    1 1 
       10 10216 1 1 44 ILE CA   C  -4.868   7.060   0.372 1.00 . A A . 44 ILE CA   1 1 
       10 10217 1 1 44 ILE CB   C  -4.978   6.837   1.892 1.00 . A A . 44 ILE CB   1 1 
       10 10218 1 1 44 ILE CD1  C  -4.313   5.256   3.773 1.00 . A A . 44 ILE CD1  1 1 
       10 10219 1 1 44 ILE CG1  C  -4.322   5.509   2.281 1.00 . A A . 44 ILE CG1  1 1 
       10 10220 1 1 44 ILE CG2  C  -6.434   6.862   2.328 1.00 . A A . 44 ILE CG2  1 1 
       10 10221 1 1 44 ILE H    H  -2.759   6.959   0.522 1.00 . A A . 44 ILE H    1 1 
       10 10222 1 1 44 ILE HA   H  -5.513   6.349  -0.123 1.00 . A A . 44 ILE HA   1 1 
       10 10223 1 1 44 ILE HB   H  -4.465   7.644   2.391 1.00 . A A . 44 ILE HB   1 1 
       10 10224 1 1 44 ILE HD11 H  -5.327   5.263   4.146 1.00 . A A . 44 ILE HD11 1 1 
       10 10225 1 1 44 ILE HD12 H  -3.743   6.029   4.267 1.00 . A A . 44 ILE HD12 1 1 
       10 10226 1 1 44 ILE HD13 H  -3.864   4.294   3.971 1.00 . A A . 44 ILE HD13 1 1 
       10 10227 1 1 44 ILE HG12 H  -4.858   4.699   1.812 1.00 . A A . 44 ILE HG12 1 1 
       10 10228 1 1 44 ILE HG13 H  -3.298   5.507   1.937 1.00 . A A . 44 ILE HG13 1 1 
       10 10229 1 1 44 ILE HG21 H  -7.017   7.419   1.608 1.00 . A A . 44 ILE HG21 1 1 
       10 10230 1 1 44 ILE HG22 H  -6.513   7.336   3.295 1.00 . A A . 44 ILE HG22 1 1 
       10 10231 1 1 44 ILE HG23 H  -6.811   5.852   2.391 1.00 . A A . 44 ILE HG23 1 1 
       10 10232 1 1 44 ILE N    N  -3.509   6.839  -0.101 1.00 . A A . 44 ILE N    1 1 
       10 10233 1 1 44 ILE O    O  -4.842   9.449   0.592 1.00 . A A . 44 ILE O    1 1 
       10 10234 1 1 45 ASN C    C  -7.858  10.368  -0.238 1.00 . A A . 45 ASN C    1 1 
       10 10235 1 1 45 ASN CA   C  -6.855   9.855  -1.265 1.00 . A A . 45 ASN CA   1 1 
       10 10236 1 1 45 ASN CB   C  -7.523   9.743  -2.636 1.00 . A A . 45 ASN CB   1 1 
       10 10237 1 1 45 ASN CG   C  -6.590   9.178  -3.689 1.00 . A A . 45 ASN CG   1 1 
       10 10238 1 1 45 ASN H    H  -6.669   7.744  -1.266 1.00 . A A . 45 ASN H    1 1 
       10 10239 1 1 45 ASN HA   H  -6.034  10.553  -1.330 1.00 . A A . 45 ASN HA   1 1 
       10 10240 1 1 45 ASN HB2  H  -8.383   9.095  -2.559 1.00 . A A . 45 ASN HB2  1 1 
       10 10241 1 1 45 ASN HB3  H  -7.845  10.725  -2.955 1.00 . A A . 45 ASN HB3  1 1 
       10 10242 1 1 45 ASN HD21 H  -7.099   7.323  -3.172 1.00 . A A . 45 ASN HD21 1 1 
       10 10243 1 1 45 ASN HD22 H  -5.939   7.461  -4.456 1.00 . A A . 45 ASN HD22 1 1 
       10 10244 1 1 45 ASN N    N  -6.312   8.563  -0.861 1.00 . A A . 45 ASN N    1 1 
       10 10245 1 1 45 ASN ND2  N  -6.538   7.854  -3.782 1.00 . A A . 45 ASN ND2  1 1 
       10 10246 1 1 45 ASN O    O  -8.233   9.654   0.691 1.00 . A A . 45 ASN O    1 1 
       10 10247 1 1 45 ASN OD1  O  -5.925   9.921  -4.409 1.00 . A A . 45 ASN OD1  1 1 
       10 10248 1 1 46 ALA C    C -10.680  11.915   0.093 1.00 . A A . 46 ALA C    1 1 
       10 10249 1 1 46 ALA CA   C  -9.248  12.227   0.502 1.00 . A A . 46 ALA CA   1 1 
       10 10250 1 1 46 ALA CB   C  -9.031  13.731   0.557 1.00 . A A . 46 ALA CB   1 1 
       10 10251 1 1 46 ALA H    H  -7.951  12.136  -1.170 1.00 . A A . 46 ALA H    1 1 
       10 10252 1 1 46 ALA HA   H  -9.070  11.827   1.489 1.00 . A A . 46 ALA HA   1 1 
       10 10253 1 1 46 ALA HB1  H  -8.897  14.113  -0.446 1.00 . A A . 46 ALA HB1  1 1 
       10 10254 1 1 46 ALA HB2  H  -8.151  13.947   1.143 1.00 . A A . 46 ALA HB2  1 1 
       10 10255 1 1 46 ALA HB3  H  -9.891  14.204   1.009 1.00 . A A . 46 ALA HB3  1 1 
       10 10256 1 1 46 ALA N    N  -8.288  11.616  -0.411 1.00 . A A . 46 ALA N    1 1 
       10 10257 1 1 46 ALA O    O -11.630  12.453   0.669 1.00 . A A . 46 ALA O    1 1 
       10 10258 1 1 47 ASP C    C -12.540   9.260  -0.893 1.00 . A A . 47 ASP C    1 1 
       10 10259 1 1 47 ASP CA   C -12.170  10.660  -1.378 1.00 . A A . 47 ASP CA   1 1 
       10 10260 1 1 47 ASP CB   C -12.220  10.707  -2.910 1.00 . A A . 47 ASP CB   1 1 
       10 10261 1 1 47 ASP CG   C -10.850  10.651  -3.565 1.00 . A A . 47 ASP CG   1 1 
       10 10262 1 1 47 ASP H    H -10.060  10.646  -1.318 1.00 . A A . 47 ASP H    1 1 
       10 10263 1 1 47 ASP HA   H -12.880  11.366  -0.978 1.00 . A A . 47 ASP HA   1 1 
       10 10264 1 1 47 ASP HB2  H -12.800   9.864  -3.264 1.00 . A A . 47 ASP HB2  1 1 
       10 10265 1 1 47 ASP HB3  H -12.710  11.622  -3.215 1.00 . A A . 47 ASP HB3  1 1 
       10 10266 1 1 47 ASP N    N -10.840  11.043  -0.899 1.00 . A A . 47 ASP N    1 1 
       10 10267 1 1 47 ASP O    O -13.700   8.859  -0.955 1.00 . A A . 47 ASP O    1 1 
       10 10268 1 1 47 ASP OD1  O -10.320   9.534  -3.733 1.00 . A A . 47 ASP OD1  1 1 
       10 10269 1 1 47 ASP OD2  O -10.310  11.724  -3.909 1.00 . A A . 47 ASP OD2  1 1 
       10 10270 1 1 48 GLY C    C -11.210   6.120  -0.881 1.00 . A A . 48 GLY C    1 1 
       10 10271 1 1 48 GLY CA   C -11.780   7.167   0.052 1.00 . A A . 48 GLY CA   1 1 
       10 10272 1 1 48 GLY H    H -10.630   8.881  -0.404 1.00 . A A . 48 GLY H    1 1 
       10 10273 1 1 48 GLY HA2  H -11.330   7.055   1.029 1.00 . A A . 48 GLY HA2  1 1 
       10 10274 1 1 48 GLY HA3  H -12.850   7.012   0.138 1.00 . A A . 48 GLY HA3  1 1 
       10 10275 1 1 48 GLY N    N -11.540   8.516  -0.422 1.00 . A A . 48 GLY N    1 1 
       10 10276 1 1 48 GLY O    O -11.520   4.934  -0.763 1.00 . A A . 48 GLY O    1 1 
       10 10277 1 1 49 SER C    C  -8.339   5.274  -2.322 1.00 . A A . 49 SER C    1 1 
       10 10278 1 1 49 SER CA   C  -9.746   5.652  -2.768 1.00 . A A . 49 SER CA   1 1 
       10 10279 1 1 49 SER CB   C  -9.705   6.290  -4.155 1.00 . A A . 49 SER CB   1 1 
       10 10280 1 1 49 SER H    H -10.150   7.513  -1.858 1.00 . A A . 49 SER H    1 1 
       10 10281 1 1 49 SER HA   H -10.340   4.760  -2.817 1.00 . A A . 49 SER HA   1 1 
       10 10282 1 1 49 SER HB2  H -10.140   7.273  -4.106 1.00 . A A . 49 SER HB2  1 1 
       10 10283 1 1 49 SER HB3  H  -8.681   6.370  -4.480 1.00 . A A . 49 SER HB3  1 1 
       10 10284 1 1 49 SER HG   H -10.690   6.069  -5.829 1.00 . A A . 49 SER HG   1 1 
       10 10285 1 1 49 SER N    N -10.360   6.557  -1.812 1.00 . A A . 49 SER N    1 1 
       10 10286 1 1 49 SER O    O  -7.733   5.956  -1.497 1.00 . A A . 49 SER O    1 1 
       10 10287 1 1 49 SER OG   O -10.420   5.514  -5.096 1.00 . A A . 49 SER OG   1 1 
       10 10288 1 1 50 VAL C    C  -5.852   2.996  -3.721 1.00 . A A . 50 VAL C    1 1 
       10 10289 1 1 50 VAL CA   C  -6.490   3.707  -2.533 1.00 . A A . 50 VAL CA   1 1 
       10 10290 1 1 50 VAL CB   C  -6.521   2.745  -1.327 1.00 . A A . 50 VAL CB   1 1 
       10 10291 1 1 50 VAL CG1  C  -5.173   2.731  -0.625 1.00 . A A . 50 VAL CG1  1 1 
       10 10292 1 1 50 VAL CG2  C  -7.629   3.128  -0.356 1.00 . A A . 50 VAL CG2  1 1 
       10 10293 1 1 50 VAL H    H  -8.360   3.679  -3.524 1.00 . A A . 50 VAL H    1 1 
       10 10294 1 1 50 VAL HA   H  -5.887   4.564  -2.269 1.00 . A A . 50 VAL HA   1 1 
       10 10295 1 1 50 VAL HB   H  -6.721   1.748  -1.693 1.00 . A A . 50 VAL HB   1 1 
       10 10296 1 1 50 VAL HG11 H  -4.661   1.806  -0.847 1.00 . A A . 50 VAL HG11 1 1 
       10 10297 1 1 50 VAL HG12 H  -5.320   2.814   0.441 1.00 . A A . 50 VAL HG12 1 1 
       10 10298 1 1 50 VAL HG13 H  -4.577   3.563  -0.972 1.00 . A A . 50 VAL HG13 1 1 
       10 10299 1 1 50 VAL HG21 H  -7.410   4.091   0.080 1.00 . A A . 50 VAL HG21 1 1 
       10 10300 1 1 50 VAL HG22 H  -7.694   2.386   0.426 1.00 . A A . 50 VAL HG22 1 1 
       10 10301 1 1 50 VAL HG23 H  -8.570   3.176  -0.883 1.00 . A A . 50 VAL HG23 1 1 
       10 10302 1 1 50 VAL N    N  -7.827   4.180  -2.874 1.00 . A A . 50 VAL N    1 1 
       10 10303 1 1 50 VAL O    O  -6.351   1.970  -4.181 1.00 . A A . 50 VAL O    1 1 
       10 10304 1 1 51 TYR C    C  -2.606   2.632  -5.011 1.00 . A A . 51 TYR C    1 1 
       10 10305 1 1 51 TYR CA   C  -4.055   2.958  -5.361 1.00 . A A . 51 TYR CA   1 1 
       10 10306 1 1 51 TYR CB   C  -4.105   3.902  -6.565 1.00 . A A . 51 TYR CB   1 1 
       10 10307 1 1 51 TYR CD1  C  -1.959   5.231  -6.592 1.00 . A A . 51 TYR CD1  1 1 
       10 10308 1 1 51 TYR CD2  C  -3.967   6.349  -5.962 1.00 . A A . 51 TYR CD2  1 1 
       10 10309 1 1 51 TYR CE1  C  -1.245   6.401  -6.415 1.00 . A A . 51 TYR CE1  1 1 
       10 10310 1 1 51 TYR CE2  C  -3.262   7.524  -5.782 1.00 . A A . 51 TYR CE2  1 1 
       10 10311 1 1 51 TYR CG   C  -3.329   5.185  -6.369 1.00 . A A . 51 TYR CG   1 1 
       10 10312 1 1 51 TYR CZ   C  -1.901   7.544  -6.010 1.00 . A A . 51 TYR CZ   1 1 
       10 10313 1 1 51 TYR H    H  -4.399   4.371  -3.814 1.00 . A A . 51 TYR H    1 1 
       10 10314 1 1 51 TYR HA   H  -4.561   2.040  -5.615 1.00 . A A . 51 TYR HA   1 1 
       10 10315 1 1 51 TYR HB2  H  -3.696   3.397  -7.427 1.00 . A A . 51 TYR HB2  1 1 
       10 10316 1 1 51 TYR HB3  H  -5.134   4.164  -6.764 1.00 . A A . 51 TYR HB3  1 1 
       10 10317 1 1 51 TYR HD1  H  -1.448   4.333  -6.910 1.00 . A A . 51 TYR HD1  1 1 
       10 10318 1 1 51 TYR HD2  H  -5.032   6.329  -5.784 1.00 . A A . 51 TYR HD2  1 1 
       10 10319 1 1 51 TYR HE1  H  -0.181   6.416  -6.593 1.00 . A A . 51 TYR HE1  1 1 
       10 10320 1 1 51 TYR HE2  H  -3.775   8.419  -5.464 1.00 . A A . 51 TYR HE2  1 1 
       10 10321 1 1 51 TYR HH   H  -1.687   9.444  -6.209 1.00 . A A . 51 TYR HH   1 1 
       10 10322 1 1 51 TYR N    N  -4.749   3.548  -4.220 1.00 . A A . 51 TYR N    1 1 
       10 10323 1 1 51 TYR O    O  -1.891   3.461  -4.450 1.00 . A A . 51 TYR O    1 1 
       10 10324 1 1 51 TYR OH   O  -1.195   8.712  -5.832 1.00 . A A . 51 TYR OH   1 1 
       10 10325 1 1 52 ALA C    C   0.120   1.307  -6.226 1.00 . A A . 52 ALA C    1 1 
       10 10326 1 1 52 ALA CA   C  -0.819   0.978  -5.070 1.00 . A A . 52 ALA CA   1 1 
       10 10327 1 1 52 ALA CB   C  -0.797  -0.517  -4.780 1.00 . A A . 52 ALA CB   1 1 
       10 10328 1 1 52 ALA H    H  -2.799   0.803  -5.795 1.00 . A A . 52 ALA H    1 1 
       10 10329 1 1 52 ALA HA   H  -0.476   1.496  -4.189 1.00 . A A . 52 ALA HA   1 1 
       10 10330 1 1 52 ALA HB1  H  -0.357  -1.040  -5.614 1.00 . A A . 52 ALA HB1  1 1 
       10 10331 1 1 52 ALA HB2  H  -1.806  -0.866  -4.626 1.00 . A A . 52 ALA HB2  1 1 
       10 10332 1 1 52 ALA HB3  H  -0.213  -0.700  -3.890 1.00 . A A . 52 ALA HB3  1 1 
       10 10333 1 1 52 ALA N    N  -2.181   1.419  -5.350 1.00 . A A . 52 ALA N    1 1 
       10 10334 1 1 52 ALA O    O  -0.129   0.929  -7.370 1.00 . A A . 52 ALA O    1 1 
       10 10335 1 1 53 GLU C    C   3.441   1.527  -6.799 1.00 . A A . 53 GLU C    1 1 
       10 10336 1 1 53 GLU CA   C   2.187   2.387  -6.923 1.00 . A A . 53 GLU CA   1 1 
       10 10337 1 1 53 GLU CB   C   2.551   3.868  -6.782 1.00 . A A . 53 GLU CB   1 1 
       10 10338 1 1 53 GLU CD   C   2.266   6.210  -7.686 1.00 . A A . 53 GLU CD   1 1 
       10 10339 1 1 53 GLU CG   C   1.784   4.774  -7.731 1.00 . A A . 53 GLU CG   1 1 
       10 10340 1 1 53 GLU H    H   1.348   2.279  -4.985 1.00 . A A . 53 GLU H    1 1 
       10 10341 1 1 53 GLU HA   H   1.747   2.224  -7.895 1.00 . A A . 53 GLU HA   1 1 
       10 10342 1 1 53 GLU HB2  H   2.342   4.184  -5.771 1.00 . A A . 53 GLU HB2  1 1 
       10 10343 1 1 53 GLU HB3  H   3.606   3.989  -6.977 1.00 . A A . 53 GLU HB3  1 1 
       10 10344 1 1 53 GLU HG2  H   1.903   4.403  -8.740 1.00 . A A . 53 GLU HG2  1 1 
       10 10345 1 1 53 GLU HG3  H   0.738   4.751  -7.464 1.00 . A A . 53 GLU HG3  1 1 
       10 10346 1 1 53 GLU N    N   1.205   2.011  -5.916 1.00 . A A . 53 GLU N    1 1 
       10 10347 1 1 53 GLU O    O   3.929   1.281  -5.696 1.00 . A A . 53 GLU O    1 1 
       10 10348 1 1 53 GLU OE1  O   2.091   6.862  -6.634 1.00 . A A . 53 GLU OE1  1 1 
       10 10349 1 1 53 GLU OE2  O   2.821   6.683  -8.699 1.00 . A A . 53 GLU OE2  1 1