NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
442524 2kcu 16097 cing 4-filtered-FRED STAR entry full 1826


data_FRED_restraints_with_modified_coordinates_PDB_code_2kcu

# This FRED archive file contains, for PDB entry <2kcu>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2kcu
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2kcu
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        18112.07

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $protein_CtR107 A . 1 1 
    stop_

save_


save_protein_CtR107
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "protein CtR107"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MDFECQFVCELKELAPVPALLIRTQTAMSELGSLFEAGYHDILQLLAGQGKSPSGPPFARYFGMSAGTFEVEFGFPVEGGVEGSGRVVTGLTPSGKAASSLYIGPYGEIEAVYDALMKWVDDNGFDLSGEAYEIYLDNPAETAPDQLRTRVSLMLHESLEHHHHHH
    _Entity.Number_of_monomers           166

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 ASP . 1 1 
         3 PHE . 1 1 
         4 GLU . 1 1 
         5 CYS . 1 1 
         6 GLN . 1 1 
         7 PHE . 1 1 
         8 VAL . 1 1 
         9 CYS . 1 1 
        10 GLU . 1 1 
        11 LEU . 1 1 
        12 LYS . 1 1 
        13 GLU . 1 1 
        14 LEU . 1 1 
        15 ALA . 1 1 
        16 PRO . 1 1 
        17 VAL . 1 1 
        18 PRO . 1 1 
        19 ALA . 1 1 
        20 LEU . 1 1 
        21 LEU . 1 1 
        22 ILE . 1 1 
        23 ARG . 1 1 
        24 THR . 1 1 
        25 GLN . 1 1 
        26 THR . 1 1 
        27 ALA . 1 1 
        28 MET . 1 1 
        29 SER . 1 1 
        30 GLU . 1 1 
        31 LEU . 1 1 
        32 GLY . 1 1 
        33 SER . 1 1 
        34 LEU . 1 1 
        35 PHE . 1 1 
        36 GLU . 1 1 
        37 ALA . 1 1 
        38 GLY . 1 1 
        39 TYR . 1 1 
        40 HIS . 1 1 
        41 ASP . 1 1 
        42 ILE . 1 1 
        43 LEU . 1 1 
        44 GLN . 1 1 
        45 LEU . 1 1 
        46 LEU . 1 1 
        47 ALA . 1 1 
        48 GLY . 1 1 
        49 GLN . 1 1 
        50 GLY . 1 1 
        51 LYS . 1 1 
        52 SER . 1 1 
        53 PRO . 1 1 
        54 SER . 1 1 
        55 GLY . 1 1 
        56 PRO . 1 1 
        57 PRO . 1 1 
        58 PHE . 1 1 
        59 ALA . 1 1 
        60 ARG . 1 1 
        61 TYR . 1 1 
        62 PHE . 1 1 
        63 GLY . 1 1 
        64 MET . 1 1 
        65 SER . 1 1 
        66 ALA . 1 1 
        67 GLY . 1 1 
        68 THR . 1 1 
        69 PHE . 1 1 
        70 GLU . 1 1 
        71 VAL . 1 1 
        72 GLU . 1 1 
        73 PHE . 1 1 
        74 GLY . 1 1 
        75 PHE . 1 1 
        76 PRO . 1 1 
        77 VAL . 1 1 
        78 GLU . 1 1 
        79 GLY . 1 1 
        80 GLY . 1 1 
        81 VAL . 1 1 
        82 GLU . 1 1 
        83 GLY . 1 1 
        84 SER . 1 1 
        85 GLY . 1 1 
        86 ARG . 1 1 
        87 VAL . 1 1 
        88 VAL . 1 1 
        89 THR . 1 1 
        90 GLY . 1 1 
        91 LEU . 1 1 
        92 THR . 1 1 
        93 PRO . 1 1 
        94 SER . 1 1 
        95 GLY . 1 1 
        96 LYS . 1 1 
        97 ALA . 1 1 
        98 ALA . 1 1 
        99 SER . 1 1 
       100 SER . 1 1 
       101 LEU . 1 1 
       102 TYR . 1 1 
       103 ILE . 1 1 
       104 GLY . 1 1 
       105 PRO . 1 1 
       106 TYR . 1 1 
       107 GLY . 1 1 
       108 GLU . 1 1 
       109 ILE . 1 1 
       110 GLU . 1 1 
       111 ALA . 1 1 
       112 VAL . 1 1 
       113 TYR . 1 1 
       114 ASP . 1 1 
       115 ALA . 1 1 
       116 LEU . 1 1 
       117 MET . 1 1 
       118 LYS . 1 1 
       119 TRP . 1 1 
       120 VAL . 1 1 
       121 ASP . 1 1 
       122 ASP . 1 1 
       123 ASN . 1 1 
       124 GLY . 1 1 
       125 PHE . 1 1 
       126 ASP . 1 1 
       127 LEU . 1 1 
       128 SER . 1 1 
       129 GLY . 1 1 
       130 GLU . 1 1 
       131 ALA . 1 1 
       132 TYR . 1 1 
       133 GLU . 1 1 
       134 ILE . 1 1 
       135 TYR . 1 1 
       136 LEU . 1 1 
       137 ASP . 1 1 
       138 ASN . 1 1 
       139 PRO . 1 1 
       140 ALA . 1 1 
       141 GLU . 1 1 
       142 THR . 1 1 
       143 ALA . 1 1 
       144 PRO . 1 1 
       145 ASP . 1 1 
       146 GLN . 1 1 
       147 LEU . 1 1 
       148 ARG . 1 1 
       149 THR . 1 1 
       150 ARG . 1 1 
       151 VAL . 1 1 
       152 SER . 1 1 
       153 LEU . 1 1 
       154 MET . 1 1 
       155 LEU . 1 1 
       156 HIS . 1 1 
       157 GLU . 1 1 
       158 SER . 1 1 
       159 LEU . 1 1 
       160 GLU . 1 1 
       161 HIS . 1 1 
       162 HIS . 1 1 
       163 HIS . 1 1 
       164 HIS . 1 1 
       165 HIS . 1 1 
       166 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       ASP   2   2 1 1 
       PHE   3   3 1 1 
       GLU   4   4 1 1 
       CYS   5   5 1 1 
       GLN   6   6 1 1 
       PHE   7   7 1 1 
       VAL   8   8 1 1 
       CYS   9   9 1 1 
       GLU  10  10 1 1 
       LEU  11  11 1 1 
       LYS  12  12 1 1 
       GLU  13  13 1 1 
       LEU  14  14 1 1 
       ALA  15  15 1 1 
       PRO  16  16 1 1 
       VAL  17  17 1 1 
       PRO  18  18 1 1 
       ALA  19  19 1 1 
       LEU  20  20 1 1 
       LEU  21  21 1 1 
       ILE  22  22 1 1 
       ARG  23  23 1 1 
       THR  24  24 1 1 
       GLN  25  25 1 1 
       THR  26  26 1 1 
       ALA  27  27 1 1 
       MET  28  28 1 1 
       SER  29  29 1 1 
       GLU  30  30 1 1 
       LEU  31  31 1 1 
       GLY  32  32 1 1 
       SER  33  33 1 1 
       LEU  34  34 1 1 
       PHE  35  35 1 1 
       GLU  36  36 1 1 
       ALA  37  37 1 1 
       GLY  38  38 1 1 
       TYR  39  39 1 1 
       HIS  40  40 1 1 
       ASP  41  41 1 1 
       ILE  42  42 1 1 
       LEU  43  43 1 1 
       GLN  44  44 1 1 
       LEU  45  45 1 1 
       LEU  46  46 1 1 
       ALA  47  47 1 1 
       GLY  48  48 1 1 
       GLN  49  49 1 1 
       GLY  50  50 1 1 
       LYS  51  51 1 1 
       SER  52  52 1 1 
       PRO  53  53 1 1 
       SER  54  54 1 1 
       GLY  55  55 1 1 
       PRO  56  56 1 1 
       PRO  57  57 1 1 
       PHE  58  58 1 1 
       ALA  59  59 1 1 
       ARG  60  60 1 1 
       TYR  61  61 1 1 
       PHE  62  62 1 1 
       GLY  63  63 1 1 
       MET  64  64 1 1 
       SER  65  65 1 1 
       ALA  66  66 1 1 
       GLY  67  67 1 1 
       THR  68  68 1 1 
       PHE  69  69 1 1 
       GLU  70  70 1 1 
       VAL  71  71 1 1 
       GLU  72  72 1 1 
       PHE  73  73 1 1 
       GLY  74  74 1 1 
       PHE  75  75 1 1 
       PRO  76  76 1 1 
       VAL  77  77 1 1 
       GLU  78  78 1 1 
       GLY  79  79 1 1 
       GLY  80  80 1 1 
       VAL  81  81 1 1 
       GLU  82  82 1 1 
       GLY  83  83 1 1 
       SER  84  84 1 1 
       GLY  85  85 1 1 
       ARG  86  86 1 1 
       VAL  87  87 1 1 
       VAL  88  88 1 1 
       THR  89  89 1 1 
       GLY  90  90 1 1 
       LEU  91  91 1 1 
       THR  92  92 1 1 
       PRO  93  93 1 1 
       SER  94  94 1 1 
       GLY  95  95 1 1 
       LYS  96  96 1 1 
       ALA  97  97 1 1 
       ALA  98  98 1 1 
       SER  99  99 1 1 
       SER 100 100 1 1 
       LEU 101 101 1 1 
       TYR 102 102 1 1 
       ILE 103 103 1 1 
       GLY 104 104 1 1 
       PRO 105 105 1 1 
       TYR 106 106 1 1 
       GLY 107 107 1 1 
       GLU 108 108 1 1 
       ILE 109 109 1 1 
       GLU 110 110 1 1 
       ALA 111 111 1 1 
       VAL 112 112 1 1 
       TYR 113 113 1 1 
       ASP 114 114 1 1 
       ALA 115 115 1 1 
       LEU 116 116 1 1 
       MET 117 117 1 1 
       LYS 118 118 1 1 
       TRP 119 119 1 1 
       VAL 120 120 1 1 
       ASP 121 121 1 1 
       ASP 122 122 1 1 
       ASN 123 123 1 1 
       GLY 124 124 1 1 
       PHE 125 125 1 1 
       ASP 126 126 1 1 
       LEU 127 127 1 1 
       SER 128 128 1 1 
       GLY 129 129 1 1 
       GLU 130 130 1 1 
       ALA 131 131 1 1 
       TYR 132 132 1 1 
       GLU 133 133 1 1 
       ILE 134 134 1 1 
       TYR 135 135 1 1 
       LEU 136 136 1 1 
       ASP 137 137 1 1 
       ASN 138 138 1 1 
       PRO 139 139 1 1 
       ALA 140 140 1 1 
       GLU 141 141 1 1 
       THR 142 142 1 1 
       ALA 143 143 1 1 
       PRO 144 144 1 1 
       ASP 145 145 1 1 
       GLN 146 146 1 1 
       LEU 147 147 1 1 
       ARG 148 148 1 1 
       THR 149 149 1 1 
       ARG 150 150 1 1 
       VAL 151 151 1 1 
       SER 152 152 1 1 
       LEU 153 153 1 1 
       MET 154 154 1 1 
       LEU 155 155 1 1 
       HIS 156 156 1 1 
       GLU 157 157 1 1 
       SER 158 158 1 1 
       LEU 159 159 1 1 
       GLU 160 160 1 1 
       HIS 161 161 1 1 
       HIS 162 162 1 1 
       HIS 163 163 1 1 
       HIS 164 164 1 1 
       HIS 165 165 1 1 
       HIS 166 166 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   2 ASP HB3  .   2 . HB1  1 1 
          1 1 2 1 1   3 PHE H    .   3 . HN   1 1 
          2 1 1 1 1   3 PHE HA   .   3 . HA   1 1 
          2 1 2 1 1   4 GLU H    .   4 . HN   1 1 
          3 1 1 1 1   4 GLU HA   .   4 . HA   1 1 
          3 1 2 1 1   5 CYS H    .   5 . HN   1 1 
          4 1 1 1 1   6 GLN HA   .   6 . HA   1 1 
          4 1 2 1 1   7 PHE H    .   7 . HN   1 1 
          5 1 1 1 1   6 GLN HB2  .   6 . HB2  1 1 
          5 1 2 1 1   7 PHE H    .   7 . HN   1 1 
          6 1 1 1 1   6 GLN HB3  .   6 . HB1  1 1 
          6 1 2 1 1   7 PHE H    .   7 . HN   1 1 
          7 1 1 1 1   7 PHE HA   .   7 . HA   1 1 
          7 1 2 1 1   8 VAL H    .   8 . HN   1 1 
          8 1 1 1 1   8 VAL H    .   8 . HN   1 1 
          8 1 2 1 1   9 CYS H    .   9 . HN   1 1 
          9 1 1 1 1   8 VAL HA   .   8 . HA   1 1 
          9 1 2 1 1   9 CYS H    .   9 . HN   1 1 
         10 1 1 1 1   8 VAL HB   .   8 . HB   1 1 
         10 1 2 1 1   9 CYS H    .   9 . HN   1 1 
         11 1 1 1 1   9 CYS HA   .   9 . HA   1 1 
         11 1 2 1 1  10 GLU H    .  10 . HN   1 1 
         12 1 1 1 1   9 CYS HB2  .   9 . HB2  1 1 
         12 1 2 1 1  10 GLU H    .  10 . HN   1 1 
         13 1 1 1 1   9 CYS HB3  .   9 . HB1  1 1 
         13 1 2 1 1  10 GLU H    .  10 . HN   1 1 
         14 1 1 1 1  10 GLU H    .  10 . HN   1 1 
         14 1 2 1 1  11 LEU H    .  11 . HN   1 1 
         15 1 1 1 1  10 GLU HA   .  10 . HA   1 1 
         15 1 2 1 1  11 LEU H    .  11 . HN   1 1 
         16 1 1 1 1  10 GLU HB2  .  10 . HB2  1 1 
         16 1 2 1 1  11 LEU H    .  11 . HN   1 1 
         17 1 1 1 1  10 GLU HB3  .  10 . HB1  1 1 
         17 1 2 1 1  11 LEU H    .  11 . HN   1 1 
         18 1 1 1 1  11 LEU HA   .  11 . HA   1 1 
         18 1 2 1 1  12 LYS H    .  12 . HN   1 1 
         19 1 1 1 1  11 LEU HB2  .  11 . HB2  1 1 
         19 1 2 1 1  12 LYS H    .  12 . HN   1 1 
         20 1 1 1 1  11 LEU HB3  .  11 . HB1  1 1 
         20 1 2 1 1  12 LYS H    .  12 . HN   1 1 
         21 1 1 1 1  12 LYS H    .  12 . HN   1 1 
         21 1 2 1 1  13 GLU H    .  13 . HN   1 1 
         22 1 1 1 1  12 LYS HA   .  12 . HA   1 1 
         22 1 2 1 1  13 GLU H    .  13 . HN   1 1 
         23 1 1 1 1  13 GLU HB2  .  13 . HB2  1 1 
         23 1 2 1 1  14 LEU H    .  14 . HN   1 1 
         24 1 1 1 1  13 GLU HB3  .  13 . HB1  1 1 
         24 1 2 1 1  14 LEU H    .  14 . HN   1 1 
         25 1 1 1 1  14 LEU HA   .  14 . HA   1 1 
         25 1 2 1 1  15 ALA H    .  15 . HN   1 1 
         26 1 1 1 1  14 LEU HB2  .  14 . HB2  1 1 
         26 1 2 1 1  15 ALA H    .  15 . HN   1 1 
         27 1 1 1 1  14 LEU HB3  .  14 . HB1  1 1 
         27 1 2 1 1  15 ALA H    .  15 . HN   1 1 
         28 1 1 1 1  16 PRO HA   .  16 . HA   1 1 
         28 1 2 1 1  17 VAL H    .  17 . HN   1 1 
         29 1 1 1 1  18 PRO HA   .  18 . HA   1 1 
         29 1 2 1 1  19 ALA H    .  19 . HN   1 1 
         30 1 1 1 1  18 PRO HB3  .  18 . HB1  1 1 
         30 1 2 1 1  19 ALA H    .  19 . HN   1 1 
         31 1 1 1 1  19 ALA HA   .  19 . HA   1 1 
         31 1 2 1 1  20 LEU H    .  20 . HN   1 1 
         32 1 1 1 1  20 LEU HA   .  20 . HA   1 1 
         32 1 2 1 1  21 LEU H    .  21 . HN   1 1 
         33 1 1 1 1  20 LEU HB2  .  20 . HB2  1 1 
         33 1 2 1 1  21 LEU H    .  21 . HN   1 1 
         34 1 1 1 1  20 LEU HB3  .  20 . HB1  1 1 
         34 1 2 1 1  21 LEU H    .  21 . HN   1 1 
         35 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
         35 1 2 1 1  23 ARG H    .  23 . HN   1 1 
         36 1 1 1 1  23 ARG H    .  23 . HN   1 1 
         36 1 2 1 1  24 THR H    .  24 . HN   1 1 
         37 1 1 1 1  23 ARG HA   .  23 . HA   1 1 
         37 1 2 1 1  24 THR H    .  24 . HN   1 1 
         38 1 1 1 1  23 ARG HB2  .  23 . HB2  1 1 
         38 1 2 1 1  24 THR H    .  24 . HN   1 1 
         39 1 1 1 1  23 ARG HB3  .  23 . HB1  1 1 
         39 1 2 1 1  24 THR H    .  24 . HN   1 1 
         40 1 1 1 1  24 THR HA   .  24 . HA   1 1 
         40 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         41 1 1 1 1  24 THR HB   .  24 . HB   1 1 
         41 1 2 1 1  25 GLN H    .  25 . HN   1 1 
         42 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
         42 1 2 1 1  26 THR H    .  26 . HN   1 1 
         43 1 1 1 1  26 THR HA   .  26 . HA   1 1 
         43 1 2 1 1  27 ALA H    .  27 . HN   1 1 
         44 1 1 1 1  26 THR HB   .  26 . HB   1 1 
         44 1 2 1 1  27 ALA H    .  27 . HN   1 1 
         45 1 1 1 1  27 ALA HA   .  27 . HA   1 1 
         45 1 2 1 1  28 MET H    .  28 . HN   1 1 
         46 1 1 1 1  28 MET H    .  28 . HN   1 1 
         46 1 2 1 1  29 SER H    .  29 . HN   1 1 
         47 1 1 1 1  30 GLU HB2  .  30 . HB2  1 1 
         47 1 2 1 1  31 LEU H    .  31 . HN   1 1 
         48 1 1 1 1  30 GLU HB3  .  30 . HB1  1 1 
         48 1 2 1 1  31 LEU H    .  31 . HN   1 1 
         49 1 1 1 1  31 LEU HB2  .  31 . HB2  1 1 
         49 1 2 1 1  32 GLY H    .  32 . HN   1 1 
         50 1 1 1 1  31 LEU HB3  .  31 . HB1  1 1 
         50 1 2 1 1  32 GLY H    .  32 . HN   1 1 
         51 1 1 1 1  34 LEU H    .  34 . HN   1 1 
         51 1 2 1 1  35 PHE H    .  35 . HN   1 1 
         52 1 1 1 1  34 LEU HB2  .  34 . HB2  1 1 
         52 1 2 1 1  35 PHE H    .  35 . HN   1 1 
         53 1 1 1 1  35 PHE H    .  35 . HN   1 1 
         53 1 2 1 1  36 GLU H    .  36 . HN   1 1 
         54 1 1 1 1  35 PHE HB2  .  35 . HB2  1 1 
         54 1 2 1 1  36 GLU H    .  36 . HN   1 1 
         55 1 1 1 1  35 PHE HB3  .  35 . HB1  1 1 
         55 1 2 1 1  36 GLU H    .  36 . HN   1 1 
         56 1 1 1 1  37 ALA H    .  37 . HN   1 1 
         56 1 2 1 1  38 GLY H    .  38 . HN   1 1 
         57 1 1 1 1  38 GLY H    .  38 . HN   1 1 
         57 1 2 1 1  39 TYR H    .  39 . HN   1 1 
         58 1 1 1 1  39 TYR HB2  .  39 . HB2  1 1 
         58 1 2 1 1  40 HIS H    .  40 . HN   1 1 
         59 1 1 1 1  39 TYR HB3  .  39 . HB1  1 1 
         59 1 2 1 1  40 HIS H    .  40 . HN   1 1 
         60 1 1 1 1  46 LEU H    .  46 . HN   1 1 
         60 1 2 1 1  47 ALA H    .  47 . HN   1 1 
         61 1 1 1 1  46 LEU HB2  .  46 . HB2  1 1 
         61 1 2 1 1  47 ALA H    .  47 . HN   1 1 
         62 1 1 1 1  46 LEU HB3  .  46 . HB1  1 1 
         62 1 2 1 1  47 ALA H    .  47 . HN   1 1 
         63 1 1 1 1  47 ALA H    .  47 . HN   1 1 
         63 1 2 1 1  48 GLY H    .  48 . HN   1 1 
         64 1 1 1 1  48 GLY H    .  48 . HN   1 1 
         64 1 2 1 1  49 GLN H    .  49 . HN   1 1 
         65 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
         65 1 2 1 1  52 SER H    .  52 . HN   1 1 
         66 1 1 1 1  51 LYS HB2  .  51 . HB2  1 1 
         66 1 2 1 1  52 SER H    .  52 . HN   1 1 
         67 1 1 1 1  51 LYS HB3  .  51 . HB1  1 1 
         67 1 2 1 1  52 SER H    .  52 . HN   1 1 
         68 1 1 1 1  53 PRO HA   .  53 . HA   1 1 
         68 1 2 1 1  54 SER H    .  54 . HN   1 1 
         69 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
         69 1 2 1 1  54 SER H    .  54 . HN   1 1 
         70 1 1 1 1  54 SER H    .  54 . HN   1 1 
         70 1 2 1 1  55 GLY H    .  55 . HN   1 1 
         71 1 1 1 1  57 PRO HA   .  57 . HA   1 1 
         71 1 2 1 1  58 PHE H    .  58 . HN   1 1 
         72 1 1 1 1  58 PHE HB2  .  58 . HB2  1 1 
         72 1 2 1 1  59 ALA H    .  59 . HN   1 1 
         73 1 1 1 1  59 ALA HA   .  59 . HA   1 1 
         73 1 2 1 1  60 ARG H    .  60 . HN   1 1 
         74 1 1 1 1  60 ARG HA   .  60 . HA   1 1 
         74 1 2 1 1  61 TYR H    .  61 . HN   1 1 
         75 1 1 1 1  61 TYR HA   .  61 . HA   1 1 
         75 1 2 1 1  62 PHE H    .  62 . HN   1 1 
         76 1 1 1 1  68 THR HB   .  68 . HB   1 1 
         76 1 2 1 1  69 PHE H    .  69 . HN   1 1 
         77 1 1 1 1  69 PHE H    .  69 . HN   1 1 
         77 1 2 1 1  70 GLU H    .  70 . HN   1 1 
         78 1 1 1 1  69 PHE HA   .  69 . HA   1 1 
         78 1 2 1 1  70 GLU H    .  70 . HN   1 1 
         79 1 1 1 1  69 PHE HB2  .  69 . HB2  1 1 
         79 1 2 1 1  70 GLU H    .  70 . HN   1 1 
         80 1 1 1 1  70 GLU H    .  70 . HN   1 1 
         80 1 2 1 1  71 VAL H    .  71 . HN   1 1 
         81 1 1 1 1  70 GLU HA   .  70 . HA   1 1 
         81 1 2 1 1  71 VAL H    .  71 . HN   1 1 
         82 1 1 1 1  71 VAL H    .  71 . HN   1 1 
         82 1 2 1 1  72 GLU H    .  72 . HN   1 1 
         83 1 1 1 1  71 VAL HA   .  71 . HA   1 1 
         83 1 2 1 1  72 GLU H    .  72 . HN   1 1 
         84 1 1 1 1  71 VAL HB   .  71 . HB   1 1 
         84 1 2 1 1  72 GLU H    .  72 . HN   1 1 
         85 1 1 1 1  76 PRO HA   .  76 . HA   1 1 
         85 1 2 1 1  77 VAL H    .  77 . HN   1 1 
         86 1 1 1 1  76 PRO HB2  .  76 . HB2  1 1 
         86 1 2 1 1  77 VAL H    .  77 . HN   1 1 
         87 1 1 1 1  76 PRO HB3  .  76 . HB1  1 1 
         87 1 2 1 1  77 VAL H    .  77 . HN   1 1 
         88 1 1 1 1  77 VAL HA   .  77 . HA   1 1 
         88 1 2 1 1  78 GLU H    .  78 . HN   1 1 
         89 1 1 1 1  78 GLU H    .  78 . HN   1 1 
         89 1 2 1 1  79 GLY H    .  79 . HN   1 1 
         90 1 1 1 1  81 VAL HA   .  81 . HA   1 1 
         90 1 2 1 1  82 GLU H    .  82 . HN   1 1 
         91 1 1 1 1  82 GLU H    .  82 . HN   1 1 
         91 1 2 1 1  83 GLY H    .  83 . HN   1 1 
         92 1 1 1 1  82 GLU HA   .  82 . HA   1 1 
         92 1 2 1 1  83 GLY H    .  83 . HN   1 1 
         93 1 1 1 1  83 GLY H    .  83 . HN   1 1 
         93 1 2 1 1  84 SER H    .  84 . HN   1 1 
         94 1 1 1 1  84 SER HA   .  84 . HA   1 1 
         94 1 2 1 1  85 GLY H    .  85 . HN   1 1 
         95 1 1 1 1  87 VAL HA   .  87 . HA   1 1 
         95 1 2 1 1  88 VAL H    .  88 . HN   1 1 
         96 1 1 1 1  87 VAL HB   .  87 . HB   1 1 
         96 1 2 1 1  88 VAL H    .  88 . HN   1 1 
         97 1 1 1 1  88 VAL HB   .  88 . HB   1 1 
         97 1 2 1 1  89 THR H    .  89 . HN   1 1 
         98 1 1 1 1  89 THR HA   .  89 . HA   1 1 
         98 1 2 1 1  90 GLY H    .  90 . HN   1 1 
         99 1 1 1 1  89 THR HB   .  89 . HB   1 1 
         99 1 2 1 1  90 GLY H    .  90 . HN   1 1 
        100 1 1 1 1  90 GLY HA2  .  90 . HA2  1 1 
        100 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        101 1 1 1 1  90 GLY HA3  .  90 . HA1  1 1 
        101 1 2 1 1  91 LEU H    .  91 . HN   1 1 
        102 1 1 1 1  91 LEU HA   .  91 . HA   1 1 
        102 1 2 1 1  92 THR H    .  92 . HN   1 1 
        103 1 1 1 1  91 LEU HB3  .  91 . HB1  1 1 
        103 1 2 1 1  92 THR H    .  92 . HN   1 1 
        104 1 1 1 1  93 PRO HA   .  93 . HA   1 1 
        104 1 2 1 1  94 SER H    .  94 . HN   1 1 
        105 1 1 1 1  93 PRO HB2  .  93 . HB2  1 1 
        105 1 2 1 1  94 SER H    .  94 . HN   1 1 
        106 1 1 1 1  93 PRO HB3  .  93 . HB1  1 1 
        106 1 2 1 1  94 SER H    .  94 . HN   1 1 
        107 1 1 1 1  94 SER HA   .  94 . HA   1 1 
        107 1 2 1 1  95 GLY H    .  95 . HN   1 1 
        108 1 1 1 1  94 SER HB2  .  94 . HB2  1 1 
        108 1 2 1 1  95 GLY H    .  95 . HN   1 1 
        109 1 1 1 1  94 SER HB3  .  94 . HB1  1 1 
        109 1 2 1 1  95 GLY H    .  95 . HN   1 1 
        110 1 1 1 1  95 GLY HA2  .  95 . HA2  1 1 
        110 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        111 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        111 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        112 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
        112 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        113 1 1 1 1  96 LYS HB2  .  96 . HB2  1 1 
        113 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        114 1 1 1 1  96 LYS HB3  .  96 . HB1  1 1 
        114 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        115 1 1 1 1  97 ALA HA   .  97 . HA   1 1 
        115 1 2 1 1  98 ALA H    .  98 . HN   1 1 
        116 1 1 1 1  98 ALA HA   .  98 . HA   1 1 
        116 1 2 1 1  99 SER H    .  99 . HN   1 1 
        117 1 1 1 1  99 SER HA   .  99 . HA   1 1 
        117 1 2 1 1 100 SER H    . 100 . HN   1 1 
        118 1 1 1 1 100 SER HA   . 100 . HA   1 1 
        118 1 2 1 1 101 LEU H    . 101 . HN   1 1 
        119 1 1 1 1 101 LEU HA   . 101 . HA   1 1 
        119 1 2 1 1 102 TYR H    . 102 . HN   1 1 
        120 1 1 1 1 102 TYR HA   . 102 . HA   1 1 
        120 1 2 1 1 103 ILE H    . 103 . HN   1 1 
        121 1 1 1 1 103 ILE HA   . 103 . HA   1 1 
        121 1 2 1 1 104 GLY H    . 104 . HN   1 1 
        122 1 1 1 1 110 GLU HB2  . 110 . HB2  1 1 
        122 1 2 1 1 111 ALA H    . 111 . HN   1 1 
        123 1 1 1 1 110 GLU HB3  . 110 . HB1  1 1 
        123 1 2 1 1 111 ALA H    . 111 . HN   1 1 
        124 1 1 1 1 111 ALA H    . 111 . HN   1 1 
        124 1 2 1 1 112 VAL H    . 112 . HN   1 1 
        125 1 1 1 1 113 TYR H    . 113 . HN   1 1 
        125 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        126 1 1 1 1 113 TYR HB2  . 113 . HB2  1 1 
        126 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        127 1 1 1 1 113 TYR HB3  . 113 . HB1  1 1 
        127 1 2 1 1 114 ASP H    . 114 . HN   1 1 
        128 1 1 1 1 114 ASP H    . 114 . HN   1 1 
        128 1 2 1 1 115 ALA H    . 115 . HN   1 1 
        129 1 1 1 1 114 ASP HB2  . 114 . HB2  1 1 
        129 1 2 1 1 115 ALA H    . 115 . HN   1 1 
        130 1 1 1 1 114 ASP HB3  . 114 . HB1  1 1 
        130 1 2 1 1 115 ALA H    . 115 . HN   1 1 
        131 1 1 1 1 117 MET H    . 117 . HN   1 1 
        131 1 2 1 1 118 LYS H    . 118 . HN   1 1 
        132 1 1 1 1 119 TRP H    . 119 . HN   1 1 
        132 1 2 1 1 120 VAL H    . 120 . HN   1 1 
        133 1 1 1 1 120 VAL HB   . 120 . HB   1 1 
        133 1 2 1 1 121 ASP H    . 121 . HN   1 1 
        134 1 1 1 1 121 ASP H    . 121 . HN   1 1 
        134 1 2 1 1 122 ASP H    . 122 . HN   1 1 
        135 1 1 1 1 121 ASP HB2  . 121 . HB2  1 1 
        135 1 2 1 1 122 ASP H    . 122 . HN   1 1 
        136 1 1 1 1 121 ASP HB3  . 121 . HB1  1 1 
        136 1 2 1 1 122 ASP H    . 122 . HN   1 1 
        137 1 1 1 1 122 ASP H    . 122 . HN   1 1 
        137 1 2 1 1 123 ASN H    . 123 . HN   1 1 
        138 1 1 1 1 122 ASP HB2  . 122 . HB2  1 1 
        138 1 2 1 1 123 ASN H    . 123 . HN   1 1 
        139 1 1 1 1 125 PHE HA   . 125 . HA   1 1 
        139 1 2 1 1 126 ASP H    . 126 . HN   1 1 
        140 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
        140 1 2 1 1 126 ASP H    . 126 . HN   1 1 
        141 1 1 1 1 126 ASP HA   . 126 . HA   1 1 
        141 1 2 1 1 127 LEU H    . 127 . HN   1 1 
        142 1 1 1 1 126 ASP HB2  . 126 . HB2  1 1 
        142 1 2 1 1 127 LEU H    . 127 . HN   1 1 
        143 1 1 1 1 126 ASP HB3  . 126 . HB1  1 1 
        143 1 2 1 1 127 LEU H    . 127 . HN   1 1 
        144 1 1 1 1 127 LEU HA   . 127 . HA   1 1 
        144 1 2 1 1 128 SER H    . 128 . HN   1 1 
        145 1 1 1 1 127 LEU HB2  . 127 . HB2  1 1 
        145 1 2 1 1 128 SER H    . 128 . HN   1 1 
        146 1 1 1 1 127 LEU HB3  . 127 . HB1  1 1 
        146 1 2 1 1 128 SER H    . 128 . HN   1 1 
        147 1 1 1 1 131 ALA HA   . 131 . HA   1 1 
        147 1 2 1 1 132 TYR H    . 132 . HN   1 1 
        148 1 1 1 1 132 TYR HA   . 132 . HA   1 1 
        148 1 2 1 1 133 GLU H    . 133 . HN   1 1 
        149 1 1 1 1 133 GLU HA   . 133 . HA   1 1 
        149 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        150 1 1 1 1 134 ILE HA   . 134 . HA   1 1 
        150 1 2 1 1 135 TYR H    . 135 . HN   1 1 
        151 1 1 1 1 136 LEU HB2  . 136 . HB2  1 1 
        151 1 2 1 1 137 ASP H    . 137 . HN   1 1 
        152 1 1 1 1 136 LEU HB3  . 136 . HB1  1 1 
        152 1 2 1 1 137 ASP H    . 137 . HN   1 1 
        153 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
        153 1 2 1 1 138 ASN H    . 138 . HN   1 1 
        154 1 1 1 1 139 PRO HB3  . 139 . HB1  1 1 
        154 1 2 1 1 140 ALA H    . 140 . HN   1 1 
        155 1 1 1 1 140 ALA H    . 140 . HN   1 1 
        155 1 2 1 1 141 GLU H    . 141 . HN   1 1 
        156 1 1 1 1 141 GLU HB2  . 141 . HB2  1 1 
        156 1 2 1 1 142 THR H    . 142 . HN   1 1 
        157 1 1 1 1 141 GLU HB3  . 141 . HB1  1 1 
        157 1 2 1 1 142 THR H    . 142 . HN   1 1 
        158 1 1 1 1 142 THR HA   . 142 . HA   1 1 
        158 1 2 1 1 143 ALA H    . 143 . HN   1 1 
        159 1 1 1 1 142 THR HB   . 142 . HB   1 1 
        159 1 2 1 1 143 ALA H    . 143 . HN   1 1 
        160 1 1 1 1 144 PRO HB2  . 144 . HB2  1 1 
        160 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        161 1 1 1 1 147 LEU HA   . 147 . HA   1 1 
        161 1 2 1 1 148 ARG H    . 148 . HN   1 1 
        162 1 1 1 1 148 ARG HA   . 148 . HA   1 1 
        162 1 2 1 1 149 THR H    . 149 . HN   1 1 
        163 1 1 1 1 150 ARG HA   . 150 . HA   1 1 
        163 1 2 1 1 151 VAL H    . 151 . HN   1 1 
        164 1 1 1 1 152 SER HA   . 152 . HA   1 1 
        164 1 2 1 1 153 LEU H    . 153 . HN   1 1 
        165 1 1 1 1 153 LEU HA   . 153 . HA   1 1 
        165 1 2 1 1 154 MET H    . 154 . HN   1 1 
        166 1 1 1 1 153 LEU HB2  . 153 . HB2  1 1 
        166 1 2 1 1 154 MET H    . 154 . HN   1 1 
        167 1 1 1 1 153 LEU HB3  . 153 . HB1  1 1 
        167 1 2 1 1 154 MET H    . 154 . HN   1 1 
        168 1 1 1 1 154 MET H    . 154 . HN   1 1 
        168 1 2 1 1 155 LEU H    . 155 . HN   1 1 
        169 1 1 1 1 155 LEU HB2  . 155 . HB2  1 1 
        169 1 2 1 1 156 HIS H    . 156 . HN   1 1 
        170 1 1 1 1 155 LEU HB3  . 155 . HB1  1 1 
        170 1 2 1 1 156 HIS H    . 156 . HN   1 1 
        171 1 1 1 1 156 HIS HB2  . 156 . HB2  1 1 
        171 1 2 1 1 157 GLU H    . 157 . HN   1 1 
        172 1 1 1 1 159 LEU H    . 159 . HN   1 1 
        172 1 2 1 1 160 GLU H    . 160 . HN   1 1 
        173 1 1 1 1 160 GLU HA   . 160 . HA   1 1 
        173 1 2 1 1 161 HIS H    . 161 . HN   1 1 
        174 1 1 1 1   6 GLN H    .   6 . HN   1 1 
        174 1 2 1 1   6 GLN HB2  .   6 . HB2  1 1 
        175 1 1 1 1   6 GLN H    .   6 . HN   1 1 
        175 1 2 1 1   6 GLN HB3  .   6 . HB1  1 1 
        176 1 1 1 1   7 PHE H    .   7 . HN   1 1 
        176 1 2 1 1   7 PHE HB2  .   7 . HB2  1 1 
        177 1 1 1 1  11 LEU H    .  11 . HN   1 1 
        177 1 2 1 1  11 LEU HB3  .  11 . HB1  1 1 
        178 1 1 1 1  12 LYS H    .  12 . HN   1 1 
        178 1 2 1 1  12 LYS HB2  .  12 . HB2  1 1 
        179 1 1 1 1  12 LYS H    .  12 . HN   1 1 
        179 1 2 1 1  12 LYS HB3  .  12 . HB1  1 1 
        180 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        180 1 2 1 1  14 LEU HB2  .  14 . HB2  1 1 
        181 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        181 1 2 1 1  14 LEU HB3  .  14 . HB1  1 1 
        182 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        182 1 2 1 1  22 ILE HB   .  22 . HB   1 1 
        183 1 1 1 1  23 ARG H    .  23 . HN   1 1 
        183 1 2 1 1  23 ARG HB2  .  23 . HB2  1 1 
        184 1 1 1 1  23 ARG H    .  23 . HN   1 1 
        184 1 2 1 1  23 ARG HB3  .  23 . HB1  1 1 
        185 1 1 1 1  31 LEU H    .  31 . HN   1 1 
        185 1 2 1 1  31 LEU HB3  .  31 . HB1  1 1 
        186 1 1 1 1  34 LEU H    .  34 . HN   1 1 
        186 1 2 1 1  34 LEU HB2  .  34 . HB2  1 1 
        187 1 1 1 1  36 GLU H    .  36 . HN   1 1 
        187 1 2 1 1  36 GLU HB3  .  36 . HB1  1 1 
        188 1 1 1 1  40 HIS H    .  40 . HN   1 1 
        188 1 2 1 1  40 HIS HB2  .  40 . HB2  1 1 
        189 1 1 1 1  40 HIS H    .  40 . HN   1 1 
        189 1 2 1 1  40 HIS HB3  .  40 . HB1  1 1 
        190 1 1 1 1  46 LEU H    .  46 . HN   1 1 
        190 1 2 1 1  46 LEU HB2  .  46 . HB2  1 1 
        191 1 1 1 1  46 LEU H    .  46 . HN   1 1 
        191 1 2 1 1  46 LEU HB3  .  46 . HB1  1 1 
        192 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        192 1 2 1 1  49 GLN HB2  .  49 . HB2  1 1 
        193 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        193 1 2 1 1  49 GLN HB3  .  49 . HB1  1 1 
        194 1 1 1 1  51 LYS H    .  51 . HN   1 1 
        194 1 2 1 1  51 LYS HB2  .  51 . HB2  1 1 
        195 1 1 1 1  51 LYS H    .  51 . HN   1 1 
        195 1 2 1 1  51 LYS HB3  .  51 . HB1  1 1 
        196 1 1 1 1  52 SER H    .  52 . HN   1 1 
        196 1 2 1 1  52 SER HB2  .  52 . HB2  1 1 
        197 1 1 1 1  52 SER H    .  52 . HN   1 1 
        197 1 2 1 1  52 SER HB3  .  52 . HB1  1 1 
        198 1 1 1 1  64 MET H    .  64 . HN   1 1 
        198 1 2 1 1  64 MET HB2  .  64 . HB2  1 1 
        199 1 1 1 1  64 MET H    .  64 . HN   1 1 
        199 1 2 1 1  64 MET HB3  .  64 . HB1  1 1 
        200 1 1 1 1  68 THR H    .  68 . HN   1 1 
        200 1 2 1 1  68 THR HB   .  68 . HB   1 1 
        201 1 1 1 1  81 VAL H    .  81 . HN   1 1 
        201 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
        202 1 1 1 1  87 VAL H    .  87 . HN   1 1 
        202 1 2 1 1  87 VAL HB   .  87 . HB   1 1 
        203 1 1 1 1  89 THR H    .  89 . HN   1 1 
        203 1 2 1 1  89 THR HB   .  89 . HB   1 1 
        204 1 1 1 1 101 LEU H    . 101 . HN   1 1 
        204 1 2 1 1 101 LEU HB2  . 101 . HB2  1 1 
        205 1 1 1 1 101 LEU H    . 101 . HN   1 1 
        205 1 2 1 1 101 LEU HB3  . 101 . HB1  1 1 
        206 1 1 1 1 109 ILE H    . 109 . HN   1 1 
        206 1 2 1 1 109 ILE HB   . 109 . HB   1 1 
        207 1 1 1 1 110 GLU H    . 110 . HN   1 1 
        207 1 2 1 1 110 GLU HB2  . 110 . HB2  1 1 
        208 1 1 1 1 110 GLU H    . 110 . HN   1 1 
        208 1 2 1 1 110 GLU HB3  . 110 . HB1  1 1 
        209 1 1 1 1 113 TYR H    . 113 . HN   1 1 
        209 1 2 1 1 113 TYR HB2  . 113 . HB2  1 1 
        210 1 1 1 1 113 TYR H    . 113 . HN   1 1 
        210 1 2 1 1 113 TYR HB3  . 113 . HB1  1 1 
        211 1 1 1 1 116 LEU H    . 116 . HN   1 1 
        211 1 2 1 1 116 LEU HB2  . 116 . HB2  1 1 
        212 1 1 1 1 116 LEU H    . 116 . HN   1 1 
        212 1 2 1 1 116 LEU HB3  . 116 . HB1  1 1 
        213 1 1 1 1 118 LYS H    . 118 . HN   1 1 
        213 1 2 1 1 118 LYS HB3  . 118 . HB1  1 1 
        214 1 1 1 1 120 VAL H    . 120 . HN   1 1 
        214 1 2 1 1 120 VAL HB   . 120 . HB   1 1 
        215 1 1 1 1 121 ASP H    . 121 . HN   1 1 
        215 1 2 1 1 121 ASP HB2  . 121 . HB2  1 1 
        216 1 1 1 1 121 ASP H    . 121 . HN   1 1 
        216 1 2 1 1 121 ASP HB3  . 121 . HB1  1 1 
        217 1 1 1 1 122 ASP H    . 122 . HN   1 1 
        217 1 2 1 1 122 ASP HB2  . 122 . HB2  1 1 
        218 1 1 1 1 122 ASP H    . 122 . HN   1 1 
        218 1 2 1 1 122 ASP HB3  . 122 . HB1  1 1 
        219 1 1 1 1 123 ASN H    . 123 . HN   1 1 
        219 1 2 1 1 123 ASN HB2  . 123 . HB2  1 1 
        220 1 1 1 1 123 ASN H    . 123 . HN   1 1 
        220 1 2 1 1 123 ASN HB3  . 123 . HB1  1 1 
        221 1 1 1 1 125 PHE H    . 125 . HN   1 1 
        221 1 2 1 1 125 PHE HB2  . 125 . HB2  1 1 
        222 1 1 1 1 125 PHE H    . 125 . HN   1 1 
        222 1 2 1 1 125 PHE HB3  . 125 . HB1  1 1 
        223 1 1 1 1 127 LEU H    . 127 . HN   1 1 
        223 1 2 1 1 127 LEU HB2  . 127 . HB2  1 1 
        224 1 1 1 1 134 ILE H    . 134 . HN   1 1 
        224 1 2 1 1 134 ILE HB   . 134 . HB   1 1 
        225 1 1 1 1 135 TYR H    . 135 . HN   1 1 
        225 1 2 1 1 135 TYR HB3  . 135 . HB1  1 1 
        226 1 1 1 1 138 ASN H    . 138 . HN   1 1 
        226 1 2 1 1 138 ASN HB2  . 138 . HB2  1 1 
        227 1 1 1 1 141 GLU H    . 141 . HN   1 1 
        227 1 2 1 1 141 GLU HB2  . 141 . HB2  1 1 
        228 1 1 1 1 141 GLU H    . 141 . HN   1 1 
        228 1 2 1 1 141 GLU HB3  . 141 . HB1  1 1 
        229 1 1 1 1 142 THR H    . 142 . HN   1 1 
        229 1 2 1 1 142 THR HB   . 142 . HB   1 1 
        230 1 1 1 1 145 ASP H    . 145 . HN   1 1 
        230 1 2 1 1 145 ASP HB2  . 145 . HB2  1 1 
        231 1 1 1 1 145 ASP H    . 145 . HN   1 1 
        231 1 2 1 1 145 ASP HB3  . 145 . HB1  1 1 
        232 1 1 1 1 146 GLN H    . 146 . HN   1 1 
        232 1 2 1 1 146 GLN HB2  . 146 . HB2  1 1 
        233 1 1 1 1 146 GLN H    . 146 . HN   1 1 
        233 1 2 1 1 146 GLN HB3  . 146 . HB1  1 1 
        234 1 1 1 1 147 LEU H    . 147 . HN   1 1 
        234 1 2 1 1 147 LEU HB2  . 147 . HB2  1 1 
        235 1 1 1 1 147 LEU H    . 147 . HN   1 1 
        235 1 2 1 1 147 LEU HB3  . 147 . HB1  1 1 
        236 1 1 1 1 151 VAL H    . 151 . HN   1 1 
        236 1 2 1 1 151 VAL HB   . 151 . HB   1 1 
        237 1 1 1 1 153 LEU H    . 153 . HN   1 1 
        237 1 2 1 1 153 LEU HB2  . 153 . HB2  1 1 
        238 1 1 1 1 153 LEU H    . 153 . HN   1 1 
        238 1 2 1 1 153 LEU HB3  . 153 . HB1  1 1 
        239 1 1 1 1 156 HIS H    . 156 . HN   1 1 
        239 1 2 1 1 156 HIS HB2  . 156 . HB2  1 1 
        240 1 1 1 1 156 HIS H    . 156 . HN   1 1 
        240 1 2 1 1 156 HIS HB3  . 156 . HB1  1 1 
        241 1 1 1 1 160 GLU H    . 160 . HN   1 1 
        241 1 2 1 1 160 GLU HA   . 160 . HA   1 1 
        242 1 1 1 1   6 GLN H    .   6 . HN   1 1 
        242 1 2 1 1   7 PHE H    .   7 . HN   1 1 
        243 1 1 1 1   7 PHE H    .   7 . HN   1 1 
        243 1 2 1 1   8 VAL H    .   8 . HN   1 1 
        244 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        244 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        245 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        245 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        246 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        246 1 2 1 1  26 THR H    .  26 . HN   1 1 
        247 1 1 1 1  29 SER H    .  29 . HN   1 1 
        247 1 2 1 1  30 GLU H    .  30 . HN   1 1 
        248 1 1 1 1  30 GLU H    .  30 . HN   1 1 
        248 1 2 1 1  31 LEU H    .  31 . HN   1 1 
        249 1 1 1 1  31 LEU H    .  31 . HN   1 1 
        249 1 2 1 1  32 GLY H    .  32 . HN   1 1 
        250 1 1 1 1  32 GLY H    .  32 . HN   1 1 
        250 1 2 1 1  33 SER H    .  33 . HN   1 1 
        251 1 1 1 1  33 SER H    .  33 . HN   1 1 
        251 1 2 1 1  34 LEU H    .  34 . HN   1 1 
        252 1 1 1 1  36 GLU H    .  36 . HN   1 1 
        252 1 2 1 1  37 ALA H    .  37 . HN   1 1 
        253 1 1 1 1  39 TYR H    .  39 . HN   1 1 
        253 1 2 1 1  40 HIS H    .  40 . HN   1 1 
        254 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        254 1 2 1 1  50 GLY H    .  50 . HN   1 1 
        255 1 1 1 1  50 GLY H    .  50 . HN   1 1 
        255 1 2 1 1  51 LYS H    .  51 . HN   1 1 
        256 1 1 1 1  51 LYS H    .  51 . HN   1 1 
        256 1 2 1 1  52 SER H    .  52 . HN   1 1 
        257 1 1 1 1  60 ARG H    .  60 . HN   1 1 
        257 1 2 1 1  61 TYR H    .  61 . HN   1 1 
        258 1 1 1 1  67 GLY H    .  67 . HN   1 1 
        258 1 2 1 1  68 THR H    .  68 . HN   1 1 
        259 1 1 1 1  68 THR H    .  68 . HN   1 1 
        259 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        260 1 1 1 1  80 GLY H    .  80 . HN   1 1 
        260 1 2 1 1  81 VAL H    .  81 . HN   1 1 
        261 1 1 1 1  81 VAL H    .  81 . HN   1 1 
        261 1 2 1 1  82 GLU H    .  82 . HN   1 1 
        262 1 1 1 1  86 ARG H    .  86 . HN   1 1 
        262 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        263 1 1 1 1  87 VAL H    .  87 . HN   1 1 
        263 1 2 1 1  88 VAL H    .  88 . HN   1 1 
        264 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        264 1 2 1 1  92 THR H    .  92 . HN   1 1 
        265 1 1 1 1  95 GLY H    .  95 . HN   1 1 
        265 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        266 1 1 1 1 109 ILE H    . 109 . HN   1 1 
        266 1 2 1 1 110 GLU H    . 110 . HN   1 1 
        267 1 1 1 1 110 GLU H    . 110 . HN   1 1 
        267 1 2 1 1 111 ALA H    . 111 . HN   1 1 
        268 1 1 1 1 112 VAL H    . 112 . HN   1 1 
        268 1 2 1 1 113 TYR H    . 113 . HN   1 1 
        269 1 1 1 1 115 ALA H    . 115 . HN   1 1 
        269 1 2 1 1 116 LEU H    . 116 . HN   1 1 
        270 1 1 1 1 118 LYS H    . 118 . HN   1 1 
        270 1 2 1 1 119 TRP H    . 119 . HN   1 1 
        271 1 1 1 1 120 VAL H    . 120 . HN   1 1 
        271 1 2 1 1 121 ASP H    . 121 . HN   1 1 
        272 1 1 1 1 123 ASN H    . 123 . HN   1 1 
        272 1 2 1 1 124 GLY H    . 124 . HN   1 1 
        273 1 1 1 1 128 SER H    . 128 . HN   1 1 
        273 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        274 1 1 1 1 129 GLY H    . 129 . HN   1 1 
        274 1 2 1 1 130 GLU H    . 130 . HN   1 1 
        275 1 1 1 1 141 GLU H    . 141 . HN   1 1 
        275 1 2 1 1 142 THR H    . 142 . HN   1 1 
        276 1 1 1 1 145 ASP H    . 145 . HN   1 1 
        276 1 2 1 1 146 GLN H    . 146 . HN   1 1 
        277 1 1 1 1 146 GLN H    . 146 . HN   1 1 
        277 1 2 1 1 147 LEU H    . 147 . HN   1 1 
        278 1 1 1 1 149 THR H    . 149 . HN   1 1 
        278 1 2 1 1 150 ARG H    . 150 . HN   1 1 
        279 1 1 1 1  27 ALA H    .  27 . HN   1 1 
        279 1 2 1 1  30 GLU HB2  .  30 . HB2  1 1 
        280 1 1 1 1  27 ALA H    .  27 . HN   1 1 
        280 1 2 1 1  30 GLU HB3  .  30 . HB1  1 1 
        281 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
        281 1 2 1 1  34 LEU H    .  34 . HN   1 1 
        282 1 1 1 1  33 SER HA   .  33 . HA   1 1 
        282 1 2 1 1  36 GLU H    .  36 . HN   1 1 
        283 1 1 1 1  44 GLN HA   .  44 . HA   1 1 
        283 1 2 1 1  47 ALA H    .  47 . HN   1 1 
        284 1 1 1 1  47 ALA HA   .  47 . HA   1 1 
        284 1 2 1 1  51 LYS H    .  51 . HN   1 1 
        285 1 1 1 1  46 LEU HA   .  46 . HA   1 1 
        285 1 2 1 1  51 LYS H    .  51 . HN   1 1 
        286 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
        286 1 2 1 1  55 GLY H    .  55 . HN   1 1 
        287 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
        287 1 2 1 1  55 GLY H    .  55 . HN   1 1 
        288 1 1 1 1  53 PRO HA   .  53 . HA   1 1 
        288 1 2 1 1  55 GLY H    .  55 . HN   1 1 
        289 1 1 1 1  84 SER H    .  84 . HN   1 1 
        289 1 2 1 1  87 VAL HB   .  87 . HB   1 1 
        290 1 1 1 1  20 LEU HA   .  20 . HA   1 1 
        290 1 2 1 1  90 GLY H    .  90 . HN   1 1 
        291 1 1 1 1 109 ILE HA   . 109 . HA   1 1 
        291 1 2 1 1 112 VAL H    . 112 . HN   1 1 
        292 1 1 1 1 109 ILE HA   . 109 . HA   1 1 
        292 1 2 1 1 111 ALA H    . 111 . HN   1 1 
        293 1 1 1 1 110 GLU HA   . 110 . HA   1 1 
        293 1 2 1 1 113 TYR H    . 113 . HN   1 1 
        294 1 1 1 1 112 VAL HA   . 112 . HA   1 1 
        294 1 2 1 1 115 ALA H    . 115 . HN   1 1 
        295 1 1 1 1 120 VAL HA   . 120 . HA   1 1 
        295 1 2 1 1 123 ASN H    . 123 . HN   1 1 
        296 1 1 1 1 120 VAL HA   . 120 . HA   1 1 
        296 1 2 1 1 125 PHE H    . 125 . HN   1 1 
        297 1 1 1 1 127 LEU HB2  . 127 . HB2  1 1 
        297 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        298 1 1 1 1 127 LEU HB3  . 127 . HB1  1 1 
        298 1 2 1 1 129 GLY H    . 129 . HN   1 1 
        299 1 1 1 1  97 ALA HA   .  97 . HA   1 1 
        299 1 2 1 1 155 LEU H    . 155 . HN   1 1 
        300 1 1 1 1  12 LYS H    .  12 . HN   1 1 
        300 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        301 1 1 1 1  21 LEU H    .  21 . HN   1 1 
        301 1 2 1 1  88 VAL H    .  88 . HN   1 1 
        302 1 1 1 1  26 THR H    .  26 . HN   1 1 
        302 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        303 1 1 1 1  60 ARG H    .  60 . HN   1 1 
        303 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        304 1 1 1 1  17 VAL H    .  17 . HN   1 1 
        304 1 2 1 1  92 THR H    .  92 . HN   1 1 
        305 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        305 1 2 1 1  95 GLY H    .  95 . HN   1 1 
        306 1 1 1 1  98 ALA H    .  98 . HN   1 1 
        306 1 2 1 1 153 LEU H    . 153 . HN   1 1 
        307 1 1 1 1  10 GLU H    .  10 . HN   1 1 
        307 1 2 1 1  99 SER H    .  99 . HN   1 1 
        308 1 1 1 1 104 GLY H    . 104 . HN   1 1 
        308 1 2 1 1 147 LEU H    . 147 . HN   1 1 
        309 1 1 1 1  60 ARG HA   .  60 . HA   1 1 
        309 1 2 1 1 133 GLU H    . 133 . HN   1 1 
        310 1 1 1 1  58 PHE HA   .  58 . HA   1 1 
        310 1 2 1 1 135 TYR H    . 135 . HN   1 1 
        311 1 1 1 1 140 ALA H    . 140 . HN   1 1 
        311 1 2 1 1 142 THR H    . 142 . HN   1 1 
        312 1 1 1 1  20 LEU H    .  20 . HN   1 1 
        312 1 2 1 1  75 PHE H    .  75 . HN   1 1 
        313 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        313 1 2 1 1  51 LYS H    .  51 . HN   1 1 
        314 1 1 1 1  59 ALA H    .  59 . HN   1 1 
        314 1 2 1 1 133 GLU H    . 133 . HN   1 1 
        315 1 1 1 1  61 TYR H    .  61 . HN   1 1 
        315 1 2 1 1 131 ALA H    . 131 . HN   1 1 
        316 1 1 1 1  84 SER H    .  84 . HN   1 1 
        316 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        317 1 1 1 1 100 SER H    . 100 . HN   1 1 
        317 1 2 1 1 151 VAL H    . 151 . HN   1 1 
        318 1 1 1 1 102 TYR H    . 102 . HN   1 1 
        318 1 2 1 1 149 THR H    . 149 . HN   1 1 
        319 1 1 1 1 132 TYR H    . 132 . HN   1 1 
        319 1 2 1 1 152 SER H    . 152 . HN   1 1 
        320 1 1 1 1  40 HIS H    .  40 . HN   1 1 
        320 1 2 1 1  41 ASP H    .  41 . HN   1 1 
        321 1 1 1 1  40 HIS HB3  .  40 . HB1  1 1 
        321 1 2 1 1  41 ASP H    .  41 . HN   1 1 
        322 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        322 1 2 1 1  46 LEU H    .  46 . HN   1 1 
        323 1 1 1 1  44 GLN H    .  44 . HN   1 1 
        323 1 2 1 1  45 LEU H    .  45 . HN   1 1 
        324 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
        324 1 2 1 1  26 THR H    .  26 . HN   1 1 
        325 1 1 1 1  34 LEU HG   .  34 . HG   1 1 
        325 1 2 1 1  35 PHE H    .  35 . HN   1 1 
        326 1 1 1 1  46 LEU HG   .  46 . HG   1 1 
        326 1 2 1 1  47 ALA H    .  47 . HN   1 1 
        327 1 1 1 1  51 LYS HD2  .  51 . HD2  1 1 
        327 1 2 1 1  52 SER H    .  52 . HN   1 1 
        328 1 1 1 1  51 LYS HD3  .  51 . HD1  1 1 
        328 1 2 1 1  52 SER H    .  52 . HN   1 1 
        329 1 1 1 1  53 PRO HG2  .  53 . HG2  1 1 
        329 1 2 1 1  54 SER H    .  54 . HN   1 1 
        330 1 1 1 1  53 PRO HG3  .  53 . HG1  1 1 
        330 1 2 1 1  54 SER H    .  54 . HN   1 1 
        331 1 1 1 1  58 PHE QD   .  58 . HD*  1 1 
        331 1 2 1 1  59 ALA H    .  59 . HN   1 1 
        332 1 1 1 1  96 LYS HG2  .  96 . HG2  1 1 
        332 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        333 1 1 1 1  96 LYS HD2  .  96 . HD2  1 1 
        333 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        334 1 1 1 1  96 LYS HD3  .  96 . HD1  1 1 
        334 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        335 1 1 1 1 110 GLU HG2  . 110 . HG2  1 1 
        335 1 2 1 1 111 ALA H    . 111 . HN   1 1 
        336 1 1 1 1 110 GLU HG3  . 110 . HG1  1 1 
        336 1 2 1 1 111 ALA H    . 111 . HN   1 1 
        337 1 1 1 1 117 MET HG2  . 117 . HG2  1 1 
        337 1 2 1 1 118 LYS H    . 118 . HN   1 1 
        338 1 1 1 1 117 MET HG3  . 117 . HG1  1 1 
        338 1 2 1 1 118 LYS H    . 118 . HN   1 1 
        339 1 1 1 1 119 TRP HE3  . 119 . HE3  1 1 
        339 1 2 1 1 120 VAL H    . 120 . HN   1 1 
        340 1 1 1 1 144 PRO HG2  . 144 . HG2  1 1 
        340 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        341 1 1 1 1 144 PRO HG3  . 144 . HG1  1 1 
        341 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        342 1 1 1 1 144 PRO HD2  . 144 . HD2  1 1 
        342 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        343 1 1 1 1 144 PRO HD3  . 144 . HD1  1 1 
        343 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        344 1 1 1 1 150 ARG HG2  . 150 . HG2  1 1 
        344 1 2 1 1 151 VAL H    . 151 . HN   1 1 
        345 1 1 1 1 150 ARG HG3  . 150 . HG1  1 1 
        345 1 2 1 1 151 VAL H    . 151 . HN   1 1 
        346 1 1 1 1   4 GLU H    .   4 . HN   1 1 
        346 1 2 1 1   4 GLU HG2  .   4 . HG2  1 1 
        347 1 1 1 1   4 GLU H    .   4 . HN   1 1 
        347 1 2 1 1   4 GLU HG3  .   4 . HG1  1 1 
        348 1 1 1 1  20 LEU H    .  20 . HN   1 1 
        348 1 2 1 1  20 LEU HG   .  20 . HG   1 1 
        349 1 1 1 1  23 ARG H    .  23 . HN   1 1 
        349 1 2 1 1  23 ARG HG2  .  23 . HG2  1 1 
        350 1 1 1 1  23 ARG H    .  23 . HN   1 1 
        350 1 2 1 1  23 ARG HG3  .  23 . HG1  1 1 
        351 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        351 1 2 1 1  25 GLN HG3  .  25 . HG1  1 1 
        352 1 1 1 1  34 LEU H    .  34 . HN   1 1 
        352 1 2 1 1  34 LEU HG   .  34 . HG   1 1 
        353 1 1 1 1  64 MET H    .  64 . HN   1 1 
        353 1 2 1 1  64 MET HG2  .  64 . HG2  1 1 
        354 1 1 1 1  64 MET H    .  64 . HN   1 1 
        354 1 2 1 1  64 MET HG3  .  64 . HG1  1 1 
        355 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        355 1 2 1 1  70 GLU HG2  .  70 . HG2  1 1 
        356 1 1 1 1  70 GLU H    .  70 . HN   1 1 
        356 1 2 1 1  70 GLU HG3  .  70 . HG1  1 1 
        357 1 1 1 1  91 LEU H    .  91 . HN   1 1 
        357 1 2 1 1  91 LEU HG   .  91 . HG   1 1 
        358 1 1 1 1 130 GLU H    . 130 . HN   1 1 
        358 1 2 1 1 130 GLU HG2  . 130 . HG2  1 1 
        359 1 1 1 1 130 GLU H    . 130 . HN   1 1 
        359 1 2 1 1 130 GLU HG3  . 130 . HG1  1 1 
        360 1 1 1 1 133 GLU H    . 133 . HN   1 1 
        360 1 2 1 1 133 GLU HG2  . 133 . HG2  1 1 
        361 1 1 1 1 133 GLU H    . 133 . HN   1 1 
        361 1 2 1 1 133 GLU HG3  . 133 . HG1  1 1 
        362 1 1 1 1 136 LEU H    . 136 . HN   1 1 
        362 1 2 1 1 136 LEU HG   . 136 . HG   1 1 
        363 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        363 1 2 1 1 150 ARG HG2  . 150 . HG2  1 1 
        364 1 1 1 1 150 ARG H    . 150 . HN   1 1 
        364 1 2 1 1 150 ARG HG3  . 150 . HG1  1 1 
        365 1 1 1 1 155 LEU H    . 155 . HN   1 1 
        365 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
        366 1 1 1 1  58 PHE QE   .  58 . HE*  1 1 
        366 1 2 1 1  75 PHE H    .  75 . HN   1 1 
        367 1 1 1 1  49 GLN HE21 .  49 . HE21 1 1 
        367 1 2 1 1  82 GLU H    .  82 . HN   1 1 
        368 1 1 1 1  49 GLN HE22 .  49 . HE22 1 1 
        368 1 2 1 1  82 GLU HB3  .  82 . HB1  1 1 
        369 1 1 1 1  49 GLN HE21 .  49 . HE21 1 1 
        369 1 2 1 1  82 GLU HB2  .  82 . HB2  1 1 
        370 1 1 1 1  49 GLN HE21 .  49 . HE21 1 1 
        370 1 2 1 1  82 GLU HB3  .  82 . HB1  1 1 
        371 1 1 1 1  49 GLN HE22 .  49 . HE22 1 1 
        371 1 2 1 1  82 GLU H    .  82 . HN   1 1 
        372 1 1 1 1 123 ASN H    . 123 . HN   1 1 
        372 1 2 1 1 123 ASN HD21 . 123 . HD21 1 1 
        373 1 1 1 1 123 ASN H    . 123 . HN   1 1 
        373 1 2 1 1 123 ASN HD22 . 123 . HD22 1 1 
        374 1 1 1 1 119 TRP HE1  . 119 . HE1  1 1 
        374 1 2 1 1 123 ASN HD21 . 123 . HD21 1 1 
        375 1 1 1 1 119 TRP HE1  . 119 . HE1  1 1 
        375 1 2 1 1 123 ASN HD22 . 123 . HD22 1 1 
        376 1 1 1 1   8 VAL MG2  .   8 . HG2* 1 1 
        376 1 2 1 1   9 CYS H    .   9 . HN   1 1 
        377 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
        377 1 2 1 1  23 ARG H    .  23 . HN   1 1 
        378 1 1 1 1  34 LEU MD2  .  34 . HD2* 1 1 
        378 1 2 1 1  35 PHE H    .  35 . HN   1 1 
        379 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        379 1 2 1 1  47 ALA H    .  47 . HN   1 1 
        380 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        380 1 2 1 1  47 ALA H    .  47 . HN   1 1 
        381 1 1 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        381 1 2 1 1  92 THR H    .  92 . HN   1 1 
        382 1 1 1 1 101 LEU MD1  . 101 . HD1* 1 1 
        382 1 2 1 1 102 TYR H    . 102 . HN   1 1 
        383 1 1 1 1 109 ILE MG   . 109 . HG2* 1 1 
        383 1 2 1 1 110 GLU H    . 110 . HN   1 1 
        384 1 1 1 1 117 MET ME   . 117 . HE*  1 1 
        384 1 2 1 1 118 LYS H    . 118 . HN   1 1 
        385 1 1 1 1 127 LEU MD1  . 127 . HD1* 1 1 
        385 1 2 1 1 128 SER H    . 128 . HN   1 1 
        386 1 1 1 1 142 THR MG   . 142 . HG2* 1 1 
        386 1 2 1 1 143 ALA H    . 143 . HN   1 1 
        387 1 1 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        387 1 2 1 1 148 ARG H    . 148 . HN   1 1 
        388 1 1 1 1 151 VAL MG1  . 151 . HG1* 1 1 
        388 1 2 1 1 152 SER H    . 152 . HN   1 1 
        389 1 1 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        389 1 2 1 1 156 HIS H    . 156 . HN   1 1 
        390 1 1 1 1 154 MET H    . 154 . HN   1 1 
        390 1 2 1 1 154 MET ME   . 154 . HE*  1 1 
        391 1 1 1 1  10 GLU H    .  10 . HN   1 1 
        391 1 2 1 1  98 ALA MB   .  98 . HB*  1 1 
        392 1 1 1 1  10 GLU H    .  10 . HN   1 1 
        392 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        393 1 1 1 1  17 VAL H    .  17 . HN   1 1 
        393 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        394 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        394 1 2 1 1  51 LYS H    .  51 . HN   1 1 
        395 1 1 1 1  54 SER H    .  54 . HN   1 1 
        395 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        396 1 1 1 1  26 THR MG   .  26 . HG2* 1 1 
        396 1 2 1 1  71 VAL H    .  71 . HN   1 1 
        397 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        397 1 2 1 1  75 PHE H    .  75 . HN   1 1 
        398 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        398 1 2 1 1  77 VAL H    .  77 . HN   1 1 
        399 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        399 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        400 1 1 1 1  20 LEU MD2  .  20 . HD2* 1 1 
        400 1 2 1 1  89 THR H    .  89 . HN   1 1 
        401 1 1 1 1  11 LEU MD2  .  11 . HD2* 1 1 
        401 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        402 1 1 1 1 126 ASP H    . 126 . HN   1 1 
        402 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        403 1 1 1 1 140 ALA H    . 140 . HN   1 1 
        403 1 2 1 1 142 THR MG   . 142 . HG2* 1 1 
        404 1 1 1 1 140 ALA H    . 140 . HN   1 1 
        404 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        405 1 1 1 1 140 ALA MB   . 140 . HB*  1 1 
        405 1 2 1 1 142 THR H    . 142 . HN   1 1 
        406 1 1 1 1 142 THR H    . 142 . HN   1 1 
        406 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        407 1 1 1 1 143 ALA MB   . 143 . HB*  1 1 
        407 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        408 1 1 1 1 134 ILE MG   . 134 . HG2* 1 1 
        408 1 2 1 1 150 ARG H    . 150 . HN   1 1 
        409 1 1 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        409 1 2 1 1 153 LEU H    . 153 . HN   1 1 
        410 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        410 1 2 1 1  49 GLN HE22 .  49 . HE22 1 1 
        411 1 1 1 1  49 GLN HE22 .  49 . HE22 1 1 
        411 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        412 1 1 1 1  21 LEU H    .  21 . HN   1 1 
        412 1 2 1 1  88 VAL MG2  .  88 . HG2* 1 1 
        413 1 1 1 1   7 PHE H    .   7 . HN   1 1 
        413 1 2 1 1   7 PHE HB3  .   7 . HB1  1 1 
        414 1 1 1 1   8 VAL H    .   8 . HN   1 1 
        414 1 2 1 1   8 VAL HB   .   8 . HB   1 1 
        415 1 1 1 1  11 LEU H    .  11 . HN   1 1 
        415 1 2 1 1  11 LEU HB2  .  11 . HB2  1 1 
        416 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        416 1 2 1 1  13 GLU HB2  .  13 . HB2  1 1 
        417 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        417 1 2 1 1  13 GLU HB3  .  13 . HB1  1 1 
        418 1 1 1 1  31 LEU H    .  31 . HN   1 1 
        418 1 2 1 1  31 LEU HB2  .  31 . HB2  1 1 
        419 1 1 1 1  34 LEU H    .  34 . HN   1 1 
        419 1 2 1 1  34 LEU HB3  .  34 . HB1  1 1 
        420 1 1 1 1  36 GLU H    .  36 . HN   1 1 
        420 1 2 1 1  36 GLU HB2  .  36 . HB2  1 1 
        421 1 1 1 1 103 ILE H    . 103 . HN   1 1 
        421 1 2 1 1 103 ILE HB   . 103 . HB   1 1 
        422 1 1 1 1 112 VAL H    . 112 . HN   1 1 
        422 1 2 1 1 112 VAL HB   . 112 . HB   1 1 
        423 1 1 1 1 114 ASP H    . 114 . HN   1 1 
        423 1 2 1 1 114 ASP HB2  . 114 . HB2  1 1 
        424 1 1 1 1 114 ASP H    . 114 . HN   1 1 
        424 1 2 1 1 114 ASP HB3  . 114 . HB1  1 1 
        425 1 1 1 1 118 LYS H    . 118 . HN   1 1 
        425 1 2 1 1 118 LYS HB2  . 118 . HB2  1 1 
        426 1 1 1 1 138 ASN H    . 138 . HN   1 1 
        426 1 2 1 1 138 ASN HB3  . 138 . HB1  1 1 
        427 1 1 1 1   2 ASP HB2  .   2 . HB2  1 1 
        427 1 2 1 1   3 PHE H    .   3 . HN   1 1 
        428 1 1 1 1  12 LYS HB2  .  12 . HB2  1 1 
        428 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        429 1 1 1 1  12 LYS HB3  .  12 . HB1  1 1 
        429 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        430 1 1 1 1  18 PRO HB2  .  18 . HB2  1 1 
        430 1 2 1 1  19 ALA H    .  19 . HN   1 1 
        431 1 1 1 1  34 LEU HB3  .  34 . HB1  1 1 
        431 1 2 1 1  35 PHE H    .  35 . HN   1 1 
        432 1 1 1 1  36 GLU HB2  .  36 . HB2  1 1 
        432 1 2 1 1  37 ALA H    .  37 . HN   1 1 
        433 1 1 1 1  36 GLU HB3  .  36 . HB1  1 1 
        433 1 2 1 1  37 ALA H    .  37 . HN   1 1 
        434 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
        434 1 2 1 1  54 SER H    .  54 . HN   1 1 
        435 1 1 1 1  58 PHE HB3  .  58 . HB1  1 1 
        435 1 2 1 1  59 ALA H    .  59 . HN   1 1 
        436 1 1 1 1  69 PHE HB3  .  69 . HB1  1 1 
        436 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        437 1 1 1 1  77 VAL HB   .  77 . HB   1 1 
        437 1 2 1 1  78 GLU H    .  78 . HN   1 1 
        438 1 1 1 1  78 GLU HB2  .  78 . HB2  1 1 
        438 1 2 1 1  79 GLY H    .  79 . HN   1 1 
        439 1 1 1 1  78 GLU HB3  .  78 . HB1  1 1 
        439 1 2 1 1  79 GLY H    .  79 . HN   1 1 
        440 1 1 1 1  81 VAL HB   .  81 . HB   1 1 
        440 1 2 1 1  82 GLU H    .  82 . HN   1 1 
        441 1 1 1 1  82 GLU HB2  .  82 . HB2  1 1 
        441 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        442 1 1 1 1  82 GLU HB3  .  82 . HB1  1 1 
        442 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        443 1 1 1 1  91 LEU HB2  .  91 . HB2  1 1 
        443 1 2 1 1  92 THR H    .  92 . HN   1 1 
        444 1 1 1 1  95 GLY HA3  .  95 . HA1  1 1 
        444 1 2 1 1  96 LYS H    .  96 . HN   1 1 
        445 1 1 1 1 108 GLU HB2  . 108 . HB2  1 1 
        445 1 2 1 1 109 ILE H    . 109 . HN   1 1 
        446 1 1 1 1 108 GLU HB3  . 108 . HB1  1 1 
        446 1 2 1 1 109 ILE H    . 109 . HN   1 1 
        447 1 1 1 1 118 LYS HB2  . 118 . HB2  1 1 
        447 1 2 1 1 119 TRP H    . 119 . HN   1 1 
        448 1 1 1 1 118 LYS HB3  . 118 . HB1  1 1 
        448 1 2 1 1 119 TRP H    . 119 . HN   1 1 
        449 1 1 1 1 122 ASP HB3  . 122 . HB1  1 1 
        449 1 2 1 1 123 ASN H    . 123 . HN   1 1 
        450 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
        450 1 2 1 1 126 ASP H    . 126 . HN   1 1 
        451 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
        451 1 2 1 1 138 ASN H    . 138 . HN   1 1 
        452 1 1 1 1 144 PRO HB3  . 144 . HB1  1 1 
        452 1 2 1 1 145 ASP H    . 145 . HN   1 1 
        453 1 1 1 1 156 HIS HB3  . 156 . HB1  1 1 
        453 1 2 1 1 157 GLU H    . 157 . HN   1 1 
        454 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
        454 1 2 1 1  26 THR HB   .  26 . HB   1 1 
        455 1 1 1 1  33 SER HA   .  33 . HA   1 1 
        455 1 2 1 1  36 GLU HB3  .  36 . HB1  1 1 
        456 1 1 1 1  33 SER HA   .  33 . HA   1 1 
        456 1 2 1 1  36 GLU HB2  .  36 . HB2  1 1 
        457 1 1 1 1 118 LYS HA   . 118 . HA   1 1 
        457 1 2 1 1 121 ASP HB2  . 121 . HB2  1 1 
        458 1 1 1 1 118 LYS HA   . 118 . HA   1 1 
        458 1 2 1 1 121 ASP HB3  . 121 . HB1  1 1 
        459 1 1 1 1  61 TYR HA   .  61 . HA   1 1 
        459 1 2 1 1  71 VAL HA   .  71 . HA   1 1 
        460 1 1 1 1  18 PRO HA   .  18 . HA   1 1 
        460 1 2 1 1  91 LEU HA   .  91 . HA   1 1 
        461 1 1 1 1 131 ALA HA   . 131 . HA   1 1 
        461 1 2 1 1 153 LEU HA   . 153 . HA   1 1 
        462 1 1 1 1  19 ALA HA   .  19 . HA   1 1 
        462 1 2 1 1  77 VAL H    .  77 . HN   1 1 
        463 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
        463 1 2 1 1  71 VAL H    .  71 . HN   1 1 
        464 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
        464 1 2 1 1  70 GLU HA   .  70 . HA   1 1 
        465 1 1 1 1  28 MET HA   .  28 . HA   1 1 
        465 1 2 1 1  30 GLU H    .  30 . HN   1 1 
        466 1 1 1 1  40 HIS HB2  .  40 . HB2  1 1 
        466 1 2 1 1  41 ASP H    .  41 . HN   1 1 
        467 1 1 1 1 120 VAL HA   . 120 . HA   1 1 
        467 1 2 1 1 124 GLY H    . 124 . HN   1 1 
        468 1 1 1 1  58 PHE HA   .  58 . HA   1 1 
        468 1 2 1 1 134 ILE HA   . 134 . HA   1 1 
        469 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        469 1 2 1 1  45 LEU HB3  .  45 . HB1  1 1 
        470 1 1 1 1  45 LEU H    .  45 . HN   1 1 
        470 1 2 1 1  45 LEU HB2  .  45 . HB2  1 1 
        471 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
        471 1 2 1 1  46 LEU H    .  46 . HN   1 1 
        472 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
        472 1 2 1 1  46 LEU H    .  46 . HN   1 1 
        473 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
        473 1 2 1 1  34 LEU HB2  .  34 . HB2  1 1 
        474 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
        474 1 2 1 1  34 LEU HB3  .  34 . HB1  1 1 
        475 1 1 1 1 116 LEU HA   . 116 . HA   1 1 
        475 1 2 1 1 119 TRP HB2  . 119 . HB2  1 1 
        476 1 1 1 1 116 LEU HA   . 116 . HA   1 1 
        476 1 2 1 1 119 TRP HB3  . 119 . HB1  1 1 
        477 1 1 1 1  10 GLU H    .  10 . HN   1 1 
        477 1 2 1 1  10 GLU HG2  .  10 . HG2  1 1 
        478 1 1 1 1  10 GLU H    .  10 . HN   1 1 
        478 1 2 1 1  10 GLU HG3  .  10 . HG1  1 1 
        479 1 1 1 1  11 LEU H    .  11 . HN   1 1 
        479 1 2 1 1  11 LEU HG   .  11 . HG   1 1 
        480 1 1 1 1  12 LYS H    .  12 . HN   1 1 
        480 1 2 1 1  12 LYS HG2  .  12 . HG2  1 1 
        481 1 1 1 1  12 LYS H    .  12 . HN   1 1 
        481 1 2 1 1  12 LYS HG3  .  12 . HG1  1 1 
        482 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        482 1 2 1 1  13 GLU HG2  .  13 . HG2  1 1 
        483 1 1 1 1  13 GLU H    .  13 . HN   1 1 
        483 1 2 1 1  13 GLU HG3  .  13 . HG1  1 1 
        484 1 1 1 1  14 LEU H    .  14 . HN   1 1 
        484 1 2 1 1  14 LEU HG   .  14 . HG   1 1 
        485 1 1 1 1  25 GLN H    .  25 . HN   1 1 
        485 1 2 1 1  25 GLN HG2  .  25 . HG2  1 1 
        486 1 1 1 1  28 MET H    .  28 . HN   1 1 
        486 1 2 1 1  28 MET HG2  .  28 . HG2  1 1 
        487 1 1 1 1  28 MET H    .  28 . HN   1 1 
        487 1 2 1 1  28 MET HG3  .  28 . HG1  1 1 
        488 1 1 1 1  30 GLU H    .  30 . HN   1 1 
        488 1 2 1 1  30 GLU HG2  .  30 . HG2  1 1 
        489 1 1 1 1  30 GLU H    .  30 . HN   1 1 
        489 1 2 1 1  30 GLU HG3  .  30 . HG1  1 1 
        490 1 1 1 1  36 GLU H    .  36 . HN   1 1 
        490 1 2 1 1  36 GLU HG2  .  36 . HG2  1 1 
        491 1 1 1 1  36 GLU H    .  36 . HN   1 1 
        491 1 2 1 1  36 GLU HG3  .  36 . HG1  1 1 
        492 1 1 1 1  46 LEU H    .  46 . HN   1 1 
        492 1 2 1 1  46 LEU HG   .  46 . HG   1 1 
        493 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        493 1 2 1 1  49 GLN HG2  .  49 . HG2  1 1 
        494 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        494 1 2 1 1  49 GLN HG3  .  49 . HG1  1 1 
        495 1 1 1 1  51 LYS H    .  51 . HN   1 1 
        495 1 2 1 1  51 LYS HG2  .  51 . HG2  1 1 
        496 1 1 1 1  51 LYS H    .  51 . HN   1 1 
        496 1 2 1 1  51 LYS HG3  .  51 . HG1  1 1 
        497 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
        497 1 2 1 1  51 LYS HD2  .  51 . HD2  1 1 
        498 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
        498 1 2 1 1  51 LYS HD3  .  51 . HD1  1 1 
        499 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
        499 1 2 1 1  51 LYS HE2  .  51 . HE2  1 1 
        500 1 1 1 1  51 LYS HB2  .  51 . HB2  1 1 
        500 1 2 1 1  51 LYS HE2  .  51 . HE2  1 1 
        501 1 1 1 1  51 LYS HB3  .  51 . HB1  1 1 
        501 1 2 1 1  51 LYS HE2  .  51 . HE2  1 1 
        502 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
        502 1 2 1 1  51 LYS HE3  .  51 . HE1  1 1 
        503 1 1 1 1  51 LYS HB2  .  51 . HB2  1 1 
        503 1 2 1 1  51 LYS HE3  .  51 . HE1  1 1 
        504 1 1 1 1  51 LYS HB3  .  51 . HB1  1 1 
        504 1 2 1 1  51 LYS HE3  .  51 . HE1  1 1 
        505 1 1 1 1  78 GLU H    .  78 . HN   1 1 
        505 1 2 1 1  78 GLU HG2  .  78 . HG2  1 1 
        506 1 1 1 1  78 GLU H    .  78 . HN   1 1 
        506 1 2 1 1  78 GLU HG3  .  78 . HG1  1 1 
        507 1 1 1 1  82 GLU H    .  82 . HN   1 1 
        507 1 2 1 1  82 GLU HG2  .  82 . HG2  1 1 
        508 1 1 1 1  82 GLU H    .  82 . HN   1 1 
        508 1 2 1 1  82 GLU HG3  .  82 . HG1  1 1 
        509 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        509 1 2 1 1  96 LYS HG2  .  96 . HG2  1 1 
        510 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        510 1 2 1 1  96 LYS HG3  .  96 . HG1  1 1 
        511 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        511 1 2 1 1  96 LYS HD2  .  96 . HD2  1 1 
        512 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
        512 1 2 1 1  96 LYS HD2  .  96 . HD2  1 1 
        513 1 1 1 1  96 LYS H    .  96 . HN   1 1 
        513 1 2 1 1  96 LYS HD3  .  96 . HD1  1 1 
        514 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
        514 1 2 1 1  96 LYS HD3  .  96 . HD1  1 1 
        515 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
        515 1 2 1 1  96 LYS HE2  .  96 . HE2  1 1 
        516 1 1 1 1  96 LYS HB2  .  96 . HB2  1 1 
        516 1 2 1 1  96 LYS HE2  .  96 . HE2  1 1 
        517 1 1 1 1  96 LYS HB3  .  96 . HB1  1 1 
        517 1 2 1 1  96 LYS HE2  .  96 . HE2  1 1 
        518 1 1 1 1  96 LYS HA   .  96 . HA   1 1 
        518 1 2 1 1  96 LYS HE3  .  96 . HE1  1 1 
        519 1 1 1 1  96 LYS HB2  .  96 . HB2  1 1 
        519 1 2 1 1  96 LYS HE3  .  96 . HE1  1 1 
        520 1 1 1 1  96 LYS HB3  .  96 . HB1  1 1 
        520 1 2 1 1  96 LYS HE3  .  96 . HE1  1 1 
        521 1 1 1 1 108 GLU H    . 108 . HN   1 1 
        521 1 2 1 1 108 GLU HG2  . 108 . HG2  1 1 
        522 1 1 1 1 108 GLU H    . 108 . HN   1 1 
        522 1 2 1 1 108 GLU HG3  . 108 . HG1  1 1 
        523 1 1 1 1 116 LEU H    . 116 . HN   1 1 
        523 1 2 1 1 116 LEU HG   . 116 . HG   1 1 
        524 1 1 1 1 117 MET H    . 117 . HN   1 1 
        524 1 2 1 1 117 MET HG2  . 117 . HG2  1 1 
        525 1 1 1 1 117 MET H    . 117 . HN   1 1 
        525 1 2 1 1 117 MET HG3  . 117 . HG1  1 1 
        526 1 1 1 1 118 LYS H    . 118 . HN   1 1 
        526 1 2 1 1 118 LYS HG2  . 118 . HG2  1 1 
        527 1 1 1 1 118 LYS H    . 118 . HN   1 1 
        527 1 2 1 1 118 LYS HG3  . 118 . HG1  1 1 
        528 1 1 1 1 118 LYS HA   . 118 . HA   1 1 
        528 1 2 1 1 118 LYS HD2  . 118 . HD2  1 1 
        529 1 1 1 1 118 LYS HA   . 118 . HA   1 1 
        529 1 2 1 1 118 LYS HD3  . 118 . HD1  1 1 
        530 1 1 1 1 141 GLU H    . 141 . HN   1 1 
        530 1 2 1 1 141 GLU HG2  . 141 . HG2  1 1 
        531 1 1 1 1 141 GLU H    . 141 . HN   1 1 
        531 1 2 1 1 141 GLU HG3  . 141 . HG1  1 1 
        532 1 1 1 1 146 GLN H    . 146 . HN   1 1 
        532 1 2 1 1 146 GLN HG2  . 146 . HG2  1 1 
        533 1 1 1 1 146 GLN H    . 146 . HN   1 1 
        533 1 2 1 1 146 GLN HG3  . 146 . HG1  1 1 
        534 1 1 1 1 147 LEU H    . 147 . HN   1 1 
        534 1 2 1 1 147 LEU HG   . 147 . HG   1 1 
        535 1 1 1 1 154 MET H    . 154 . HN   1 1 
        535 1 2 1 1 154 MET HG2  . 154 . HG2  1 1 
        536 1 1 1 1 154 MET H    . 154 . HN   1 1 
        536 1 2 1 1 154 MET HG3  . 154 . HG1  1 1 
        537 1 1 1 1 157 GLU H    . 157 . HN   1 1 
        537 1 2 1 1 157 GLU HG2  . 157 . HG2  1 1 
        538 1 1 1 1 157 GLU H    . 157 . HN   1 1 
        538 1 2 1 1 157 GLU HG3  . 157 . HG1  1 1 
        539 1 1 1 1  11 LEU HG   .  11 . HG   1 1 
        539 1 2 1 1  12 LYS H    .  12 . HN   1 1 
        540 1 1 1 1  13 GLU HG2  .  13 . HG2  1 1 
        540 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        541 1 1 1 1  13 GLU HG3  .  13 . HG1  1 1 
        541 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        542 1 1 1 1  23 ARG HG2  .  23 . HG2  1 1 
        542 1 2 1 1  24 THR H    .  24 . HN   1 1 
        543 1 1 1 1  23 ARG HG3  .  23 . HG1  1 1 
        543 1 2 1 1  24 THR H    .  24 . HN   1 1 
        544 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
        544 1 2 1 1  26 THR H    .  26 . HN   1 1 
        545 1 1 1 1  36 GLU HG2  .  36 . HG2  1 1 
        545 1 2 1 1  37 ALA H    .  37 . HN   1 1 
        546 1 1 1 1  36 GLU HG3  .  36 . HG1  1 1 
        546 1 2 1 1  37 ALA H    .  37 . HN   1 1 
        547 1 1 1 1  39 TYR QD   .  39 . HD*  1 1 
        547 1 2 1 1  40 HIS H    .  40 . HN   1 1 
        548 1 1 1 1  51 LYS HG2  .  51 . HG2  1 1 
        548 1 2 1 1  52 SER H    .  52 . HN   1 1 
        549 1 1 1 1  51 LYS HG3  .  51 . HG1  1 1 
        549 1 2 1 1  52 SER H    .  52 . HN   1 1 
        550 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
        550 1 2 1 1  70 GLU H    .  70 . HN   1 1 
        551 1 1 1 1  70 GLU HG2  .  70 . HG2  1 1 
        551 1 2 1 1  71 VAL H    .  71 . HN   1 1 
        552 1 1 1 1  70 GLU HG3  .  70 . HG1  1 1 
        552 1 2 1 1  71 VAL H    .  71 . HN   1 1 
        553 1 1 1 1  78 GLU HG2  .  78 . HG2  1 1 
        553 1 2 1 1  79 GLY H    .  79 . HN   1 1 
        554 1 1 1 1  78 GLU HG3  .  78 . HG1  1 1 
        554 1 2 1 1  79 GLY H    .  79 . HN   1 1 
        555 1 1 1 1  82 GLU HG2  .  82 . HG2  1 1 
        555 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        556 1 1 1 1  82 GLU HG3  .  82 . HG1  1 1 
        556 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        557 1 1 1 1  96 LYS HG3  .  96 . HG1  1 1 
        557 1 2 1 1  97 ALA H    .  97 . HN   1 1 
        558 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
        558 1 2 1 1 103 ILE H    . 103 . HN   1 1 
        559 1 1 1 1 108 GLU HG2  . 108 . HG2  1 1 
        559 1 2 1 1 109 ILE H    . 109 . HN   1 1 
        560 1 1 1 1 108 GLU HG3  . 108 . HG1  1 1 
        560 1 2 1 1 109 ILE H    . 109 . HN   1 1 
        561 1 1 1 1 116 LEU HG   . 116 . HG   1 1 
        561 1 2 1 1 117 MET H    . 117 . HN   1 1 
        562 1 1 1 1 132 TYR QD   . 132 . HD*  1 1 
        562 1 2 1 1 133 GLU H    . 133 . HN   1 1 
        563 1 1 1 1 157 GLU HG2  . 157 . HG2  1 1 
        563 1 2 1 1 158 SER H    . 158 . HN   1 1 
        564 1 1 1 1 157 GLU HG3  . 157 . HG1  1 1 
        564 1 2 1 1 158 SER H    . 158 . HN   1 1 
        565 1 1 1 1   2 ASP HB2  .   2 . HB2  1 1 
        565 1 2 1 1   3 PHE HB2  .   3 . HB2  1 1 
        566 1 1 1 1   2 ASP HB2  .   2 . HB2  1 1 
        566 1 2 1 1   3 PHE HB3  .   3 . HB1  1 1 
        567 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
        567 1 2 1 1  87 VAL HA   .  87 . HA   1 1 
        568 1 1 1 1  22 ILE HG13 .  22 . HG11 1 1 
        568 1 2 1 1  87 VAL HA   .  87 . HA   1 1 
        569 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
        569 1 2 1 1  75 PHE HB2  .  75 . HB2  1 1 
        570 1 1 1 1  61 TYR QD   .  61 . HD*  1 1 
        570 1 2 1 1  71 VAL HB   .  71 . HB   1 1 
        571 1 1 1 1  61 TYR HA   .  61 . HA   1 1 
        571 1 2 1 1  71 VAL HB   .  71 . HB   1 1 
        572 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
        572 1 2 1 1  75 PHE HB2  .  75 . HB2  1 1 
        573 1 1 1 1  16 PRO QB   .  16 . HB*  1 1 
        573 1 2 1 1  94 SER HB2  .  94 . HB2  1 1 
        574 1 1 1 1  16 PRO QB   .  16 . HB*  1 1 
        574 1 2 1 1  94 SER HB3  .  94 . HB1  1 1 
        575 1 1 1 1 109 ILE HG12 . 109 . HG12 1 1 
        575 1 2 1 1 113 TYR QD   . 113 . HD*  1 1 
        576 1 1 1 1  10 GLU HA   .  10 . HA   1 1 
        576 1 2 1 1 119 TRP HZ2  . 119 . HZ2  1 1 
        577 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
        577 1 2 1 1 155 LEU HG   . 155 . HG   1 1 
        578 1 1 1 1 102 TYR HA   . 102 . HA   1 1 
        578 1 2 1 1 149 THR HB   . 149 . HB   1 1 
        579 1 1 1 1  11 LEU HB2  .  11 . HB2  1 1 
        579 1 2 1 1 119 TRP HH2  . 119 . HH2  1 1 
        580 1 1 1 1  11 LEU HB3  .  11 . HB1  1 1 
        580 1 2 1 1 119 TRP HH2  . 119 . HH2  1 1 
        581 1 1 1 1  11 LEU HG   .  11 . HG   1 1 
        581 1 2 1 1 119 TRP HH2  . 119 . HH2  1 1 
        582 1 1 1 1  35 PHE HZ   .  35 . HZ   1 1 
        582 1 2 1 1  73 PHE QD   .  73 . HD*  1 1 
        583 1 1 1 1  58 PHE HB2  .  58 . HB2  1 1 
        583 1 2 1 1 132 TYR QE   . 132 . HE*  1 1 
        584 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
        584 1 2 1 1  71 VAL HB   .  71 . HB   1 1 
        585 1 1 1 1   7 PHE QE   .   7 . HE*  1 1 
        585 1 2 1 1 102 TYR QD   . 102 . HD*  1 1 
        586 1 1 1 1   7 PHE QE   .   7 . HE*  1 1 
        586 1 2 1 1 102 TYR QE   . 102 . HE*  1 1 
        587 1 1 1 1 109 ILE HG13 . 109 . HG11 1 1 
        587 1 2 1 1 113 TYR QD   . 113 . HD*  1 1 
        588 1 1 1 1 110 GLU HA   . 110 . HA   1 1 
        588 1 2 1 1 113 TYR QD   . 113 . HD*  1 1 
        589 1 1 1 1   7 PHE QD   .   7 . HD*  1 1 
        589 1 2 1 1 112 VAL HA   . 112 . HA   1 1 
        590 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
        590 1 2 1 1 112 VAL HB   . 112 . HB   1 1 
        591 1 1 1 1 119 TRP HE3  . 119 . HE3  1 1 
        591 1 2 1 1 120 VAL HA   . 120 . HA   1 1 
        592 1 1 1 1 120 VAL HA   . 120 . HA   1 1 
        592 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
        593 1 1 1 1  58 PHE QD   .  58 . HD*  1 1 
        593 1 2 1 1 132 TYR QE   . 132 . HE*  1 1 
        594 1 1 1 1 135 TYR QE   . 135 . HE*  1 1 
        594 1 2 1 1 149 THR HB   . 149 . HB   1 1 
        595 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
        595 1 2 1 1 149 THR HB   . 149 . HB   1 1 
        596 1 1 1 1  11 LEU H    .  11 . HN   1 1 
        596 1 2 1 1 119 TRP HZ2  . 119 . HZ2  1 1 
        597 1 1 1 1  11 LEU H    .  11 . HN   1 1 
        597 1 2 1 1 119 TRP HH2  . 119 . HH2  1 1 
        598 1 1 1 1  12 LYS HG2  .  12 . HG2  1 1 
        598 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
        599 1 1 1 1  12 LYS HG3  .  12 . HG1  1 1 
        599 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
        600 1 1 1 1  35 PHE QE   .  35 . HE*  1 1 
        600 1 2 1 1  73 PHE QE   .  73 . HE*  1 1 
        601 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
        601 1 2 1 1  84 SER HB3  .  84 . HB1  1 1 
        602 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
        602 1 2 1 1  84 SER HB3  .  84 . HB1  1 1 
        603 1 1 1 1  17 VAL HB   .  17 . HB   1 1 
        603 1 2 1 1  18 PRO HD3  .  18 . HD1  1 1 
        604 1 1 1 1  17 VAL HB   .  17 . HB   1 1 
        604 1 2 1 1  18 PRO HD2  .  18 . HD2  1 1 
        605 1 1 1 1  58 PHE HB3  .  58 . HB1  1 1 
        605 1 2 1 1 132 TYR QE   . 132 . HE*  1 1 
        606 1 1 1 1  11 LEU HB3  .  11 . HB1  1 1 
        606 1 2 1 1 119 TRP HZ2  . 119 . HZ2  1 1 
        607 1 1 1 1 120 VAL HA   . 120 . HA   1 1 
        607 1 2 1 1 125 PHE HB2  . 125 . HB2  1 1 
        608 1 1 1 1 120 VAL HA   . 120 . HA   1 1 
        608 1 2 1 1 125 PHE HB3  . 125 . HB1  1 1 
        609 1 1 1 1 134 ILE HB   . 134 . HB   1 1 
        609 1 2 1 1 149 THR HA   . 149 . HA   1 1 
        610 1 1 1 1 131 ALA HA   . 131 . HA   1 1 
        610 1 2 1 1 153 LEU HB3  . 153 . HB1  1 1 
        611 1 1 1 1 131 ALA HA   . 131 . HA   1 1 
        611 1 2 1 1 153 LEU HB2  . 153 . HB2  1 1 
        612 1 1 1 1  39 TYR HB2  .  39 . HB2  1 1 
        612 1 2 1 1  75 PHE QE   .  75 . HE*  1 1 
        613 1 1 1 1  39 TYR HB3  .  39 . HB1  1 1 
        613 1 2 1 1  75 PHE QE   .  75 . HE*  1 1 
        614 1 1 1 1 117 MET H    . 117 . HN   1 1 
        614 1 2 1 1 117 MET ME   . 117 . HE*  1 1 
        615 1 1 1 1   8 VAL MG1  .   8 . HG1* 1 1 
        615 1 2 1 1   9 CYS H    .   9 . HN   1 1 
        616 1 1 1 1  11 LEU MD1  .  11 . HD1* 1 1 
        616 1 2 1 1  12 LYS H    .  12 . HN   1 1 
        617 1 1 1 1  11 LEU MD2  .  11 . HD2* 1 1 
        617 1 2 1 1  12 LYS H    .  12 . HN   1 1 
        618 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
        618 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        619 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
        619 1 2 1 1  15 ALA H    .  15 . HN   1 1 
        620 1 1 1 1  20 LEU MD1  .  20 . HD1* 1 1 
        620 1 2 1 1  21 LEU H    .  21 . HN   1 1 
        621 1 1 1 1  20 LEU MD2  .  20 . HD2* 1 1 
        621 1 2 1 1  21 LEU H    .  21 . HN   1 1 
        622 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        622 1 2 1 1  23 ARG H    .  23 . HN   1 1 
        623 1 1 1 1  24 THR MG   .  24 . HG2* 1 1 
        623 1 2 1 1  25 GLN H    .  25 . HN   1 1 
        624 1 1 1 1  26 THR MG   .  26 . HG2* 1 1 
        624 1 2 1 1  27 ALA H    .  27 . HN   1 1 
        625 1 1 1 1  68 THR MG   .  68 . HG2* 1 1 
        625 1 2 1 1  69 PHE H    .  69 . HN   1 1 
        626 1 1 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        626 1 2 1 1  78 GLU H    .  78 . HN   1 1 
        627 1 1 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        627 1 2 1 1  78 GLU H    .  78 . HN   1 1 
        628 1 1 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        628 1 2 1 1  82 GLU H    .  82 . HN   1 1 
        629 1 1 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        629 1 2 1 1  82 GLU H    .  82 . HN   1 1 
        630 1 1 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        630 1 2 1 1  88 VAL H    .  88 . HN   1 1 
        631 1 1 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        631 1 2 1 1  88 VAL H    .  88 . HN   1 1 
        632 1 1 1 1  88 VAL MG1  .  88 . HG1* 1 1 
        632 1 2 1 1  89 THR H    .  89 . HN   1 1 
        633 1 1 1 1  88 VAL MG2  .  88 . HG2* 1 1 
        633 1 2 1 1  89 THR H    .  89 . HN   1 1 
        634 1 1 1 1  89 THR MG   .  89 . HG2* 1 1 
        634 1 2 1 1  90 GLY H    .  90 . HN   1 1 
        635 1 1 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        635 1 2 1 1  92 THR H    .  92 . HN   1 1 
        636 1 1 1 1 101 LEU MD2  . 101 . HD2* 1 1 
        636 1 2 1 1 102 TYR H    . 102 . HN   1 1 
        637 1 1 1 1 103 ILE MG   . 103 . HG2* 1 1 
        637 1 2 1 1 104 GLY H    . 104 . HN   1 1 
        638 1 1 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        638 1 2 1 1 113 TYR H    . 113 . HN   1 1 
        639 1 1 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        639 1 2 1 1 117 MET H    . 117 . HN   1 1 
        640 1 1 1 1 120 VAL MG1  . 120 . HG1* 1 1 
        640 1 2 1 1 121 ASP H    . 121 . HN   1 1 
        641 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        641 1 2 1 1 121 ASP H    . 121 . HN   1 1 
        642 1 1 1 1 127 LEU MD2  . 127 . HD2* 1 1 
        642 1 2 1 1 128 SER H    . 128 . HN   1 1 
        643 1 1 1 1 134 ILE MG   . 134 . HG2* 1 1 
        643 1 2 1 1 135 TYR H    . 135 . HN   1 1 
        644 1 1 1 1 134 ILE MD   . 134 . HD1* 1 1 
        644 1 2 1 1 135 TYR H    . 135 . HN   1 1 
        645 1 1 1 1 147 LEU MD1  . 147 . HD1* 1 1 
        645 1 2 1 1 148 ARG H    . 148 . HN   1 1 
        646 1 1 1 1 149 THR MG   . 149 . HG2* 1 1 
        646 1 2 1 1 150 ARG H    . 150 . HN   1 1 
        647 1 1 1 1 151 VAL MG2  . 151 . HG2* 1 1 
        647 1 2 1 1 152 SER H    . 152 . HN   1 1 
        648 1 1 1 1 154 MET ME   . 154 . HE*  1 1 
        648 1 2 1 1 155 LEU H    . 155 . HN   1 1 
        649 1 1 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        649 1 2 1 1 156 HIS H    . 156 . HN   1 1 
        650 1 1 1 1  11 LEU MD1  .  11 . HD1* 1 1 
        650 1 2 1 1  12 LYS HA   .  12 . HA   1 1 
        651 1 1 1 1  11 LEU MD2  .  11 . HD2* 1 1 
        651 1 2 1 1  12 LYS HA   .  12 . HA   1 1 
        652 1 1 1 1  12 LYS HB2  .  12 . HB2  1 1 
        652 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
        653 1 1 1 1  12 LYS HB3  .  12 . HB1  1 1 
        653 1 2 1 1  14 LEU MD1  .  14 . HD1* 1 1 
        654 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        654 1 2 1 1 116 LEU MD1  . 116 . HD1* 1 1 
        655 1 1 1 1 100 SER HB3  . 100 . HB1  1 1 
        655 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        656 1 1 1 1 100 SER HB2  . 100 . HB2  1 1 
        656 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        657 1 1 1 1   9 CYS HA   .   9 . HA   1 1 
        657 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        658 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        658 1 2 1 1  24 THR HA   .  24 . HA   1 1 
        659 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        659 1 2 1 1  86 ARG HD2  .  86 . HD2  1 1 
        660 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        660 1 2 1 1  86 ARG HD3  .  86 . HD1  1 1 
        661 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
        661 1 2 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        662 1 1 1 1  22 ILE HG13 .  22 . HG11 1 1 
        662 1 2 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        663 1 1 1 1  24 THR HB   .  24 . HB   1 1 
        663 1 2 1 1  34 LEU MD1  .  34 . HD1* 1 1 
        664 1 1 1 1  24 THR MG   .  24 . HG2* 1 1 
        664 1 2 1 1  71 VAL HB   .  71 . HB   1 1 
        665 1 1 1 1  24 THR MG   .  24 . HG2* 1 1 
        665 1 2 1 1  34 LEU HG   .  34 . HG   1 1 
        666 1 1 1 1  24 THR MG   .  24 . HG2* 1 1 
        666 1 2 1 1  34 LEU MD2  .  34 . HD2* 1 1 
        667 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        667 1 2 1 1  24 THR MG   .  24 . HG2* 1 1 
        668 1 1 1 1  25 GLN HG2  .  25 . HG2  1 1 
        668 1 2 1 1  68 THR MG   .  68 . HG2* 1 1 
        669 1 1 1 1  24 THR MG   .  24 . HG2* 1 1 
        669 1 2 1 1  26 THR HB   .  26 . HB   1 1 
        670 1 1 1 1  25 GLN HA   .  25 . HA   1 1 
        670 1 2 1 1  26 THR MG   .  26 . HG2* 1 1 
        671 1 1 1 1 109 ILE HA   . 109 . HA   1 1 
        671 1 2 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        672 1 1 1 1  26 THR HB   .  26 . HB   1 1 
        672 1 2 1 1  34 LEU MD2  .  34 . HD2* 1 1 
        673 1 1 1 1  26 THR HB   .  26 . HB   1 1 
        673 1 2 1 1  34 LEU MD1  .  34 . HD1* 1 1 
        674 1 1 1 1  34 LEU HA   .  34 . HA   1 1 
        674 1 2 1 1  37 ALA MB   .  37 . HB*  1 1 
        675 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        675 1 2 1 1  77 VAL HB   .  77 . HB   1 1 
        676 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        676 1 2 1 1  53 PRO HA   .  53 . HA   1 1 
        677 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        677 1 2 1 1  52 SER HA   .  52 . HA   1 1 
        678 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        678 1 2 1 1  52 SER HA   .  52 . HA   1 1 
        679 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        679 1 2 1 1  51 LYS HB2  .  51 . HB2  1 1 
        680 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        680 1 2 1 1  51 LYS HB3  .  51 . HB1  1 1 
        681 1 1 1 1  51 LYS HD2  .  51 . HD2  1 1 
        681 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        682 1 1 1 1  51 LYS HD3  .  51 . HD1  1 1 
        682 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        683 1 1 1 1  51 LYS HE3  .  51 . HE1  1 1 
        683 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        684 1 1 1 1  51 LYS HE2  .  51 . HE2  1 1 
        684 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        685 1 1 1 1  58 PHE QD   .  58 . HD*  1 1 
        685 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        686 1 1 1 1  25 GLN HG3  .  25 . HG1  1 1 
        686 1 2 1 1  68 THR MG   .  68 . HG2* 1 1 
        687 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
        687 1 2 1 1  68 THR MG   .  68 . HG2* 1 1 
        688 1 1 1 1  76 PRO HA   .  76 . HA   1 1 
        688 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        689 1 1 1 1  76 PRO HA   .  76 . HA   1 1 
        689 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        690 1 1 1 1  18 PRO HB2  .  18 . HB2  1 1 
        690 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        691 1 1 1 1  18 PRO HB3  .  18 . HB1  1 1 
        691 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        692 1 1 1 1  20 LEU HG   .  20 . HG   1 1 
        692 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        693 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        693 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        694 1 1 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        694 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
        695 1 1 1 1  54 SER QB   .  54 . HB*  1 1 
        695 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        696 1 1 1 1  53 PRO HA   .  53 . HA   1 1 
        696 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        697 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        697 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        698 1 1 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        698 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
        699 1 1 1 1  51 LYS HE2  .  51 . HE2  1 1 
        699 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        700 1 1 1 1  49 GLN HB2  .  49 . HB2  1 1 
        700 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        701 1 1 1 1  49 GLN HB3  .  49 . HB1  1 1 
        701 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        702 1 1 1 1  20 LEU MD1  .  20 . HD1* 1 1 
        702 1 2 1 1  83 GLY HA2  .  83 . HA2  1 1 
        703 1 1 1 1  20 LEU MD2  .  20 . HD2* 1 1 
        703 1 2 1 1  83 GLY HA2  .  83 . HA2  1 1 
        704 1 1 1 1  20 LEU MD2  .  20 . HD2* 1 1 
        704 1 2 1 1  83 GLY HA3  .  83 . HA1  1 1 
        705 1 1 1 1  22 ILE MD   .  22 . HD1* 1 1 
        705 1 2 1 1  87 VAL HA   .  87 . HA   1 1 
        706 1 1 1 1  87 VAL HA   .  87 . HA   1 1 
        706 1 2 1 1  88 VAL MG2  .  88 . HG2* 1 1 
        707 1 1 1 1  20 LEU HA   .  20 . HA   1 1 
        707 1 2 1 1  88 VAL MG2  .  88 . HG2* 1 1 
        708 1 1 1 1  82 GLU HA   .  82 . HA   1 1 
        708 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
        709 1 1 1 1  83 GLY HA2  .  83 . HA2  1 1 
        709 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
        710 1 1 1 1  83 GLY HA3  .  83 . HA1  1 1 
        710 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
        711 1 1 1 1  20 LEU HA   .  20 . HA   1 1 
        711 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
        712 1 1 1 1  18 PRO HD3  .  18 . HD1  1 1 
        712 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        713 1 1 1 1  97 ALA MB   .  97 . HB*  1 1 
        713 1 2 1 1  98 ALA HA   .  98 . HA   1 1 
        714 1 1 1 1  97 ALA MB   .  97 . HB*  1 1 
        714 1 2 1 1 152 SER HB3  . 152 . HB1  1 1 
        715 1 1 1 1  97 ALA MB   .  97 . HB*  1 1 
        715 1 2 1 1  99 SER QB   .  99 . HB*  1 1 
        716 1 1 1 1  97 ALA HA   .  97 . HA   1 1 
        716 1 2 1 1  98 ALA MB   .  98 . HB*  1 1 
        717 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        717 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        718 1 1 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        718 1 2 1 1 152 SER HA   . 152 . HA   1 1 
        719 1 1 1 1 100 SER HB2  . 100 . HB2  1 1 
        719 1 2 1 1 116 LEU MD1  . 116 . HD1* 1 1 
        720 1 1 1 1 101 LEU MD2  . 101 . HD2* 1 1 
        720 1 2 1 1 148 ARG HB2  . 148 . HB2  1 1 
        721 1 1 1 1 101 LEU MD2  . 101 . HD2* 1 1 
        721 1 2 1 1 148 ARG HB3  . 148 . HB1  1 1 
        722 1 1 1 1 102 TYR HB2  . 102 . HB2  1 1 
        722 1 2 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        723 1 1 1 1 109 ILE MG   . 109 . HG2* 1 1 
        723 1 2 1 1 110 GLU HA   . 110 . HA   1 1 
        724 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        724 1 2 1 1 151 VAL HA   . 151 . HA   1 1 
        725 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        725 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        726 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        726 1 2 1 1 151 VAL MG2  . 151 . HG2* 1 1 
        727 1 1 1 1 102 TYR HB3  . 102 . HB1  1 1 
        727 1 2 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        728 1 1 1 1 109 ILE HB   . 109 . HB   1 1 
        728 1 2 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        729 1 1 1 1 100 SER HB3  . 100 . HB1  1 1 
        729 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        730 1 1 1 1 100 SER HB2  . 100 . HB2  1 1 
        730 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        731 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        731 1 2 1 1 125 PHE HB3  . 125 . HB1  1 1 
        732 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        732 1 2 1 1 125 PHE HB2  . 125 . HB2  1 1 
        733 1 1 1 1  61 TYR HB2  .  61 . HB2  1 1 
        733 1 2 1 1 131 ALA MB   . 131 . HB*  1 1 
        734 1 1 1 1 131 ALA MB   . 131 . HB*  1 1 
        734 1 2 1 1 153 LEU HA   . 153 . HA   1 1 
        735 1 1 1 1 134 ILE MD   . 134 . HD1* 1 1 
        735 1 2 1 1 150 ARG QB   . 150 . HB*  1 1 
        736 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
        736 1 2 1 1 142 THR MG   . 142 . HG2* 1 1 
        737 1 1 1 1 137 ASP HB3  . 137 . HB1  1 1 
        737 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        738 1 1 1 1 139 PRO HB2  . 139 . HB2  1 1 
        738 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        739 1 1 1 1 143 ALA MB   . 143 . HB*  1 1 
        739 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        740 1 1 1 1 142 THR MG   . 142 . HG2* 1 1 
        740 1 2 1 1 147 LEU HG   . 147 . HG   1 1 
        741 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
        741 1 2 1 1 142 THR MG   . 142 . HG2* 1 1 
        742 1 1 1 1 142 THR MG   . 142 . HG2* 1 1 
        742 1 2 1 1 147 LEU HA   . 147 . HA   1 1 
        743 1 1 1 1 142 THR HA   . 142 . HA   1 1 
        743 1 2 1 1 143 ALA MB   . 143 . HB*  1 1 
        744 1 1 1 1 103 ILE MG   . 103 . HG2* 1 1 
        744 1 2 1 1 146 GLN HA   . 146 . HA   1 1 
        745 1 1 1 1 144 PRO HA   . 144 . HA   1 1 
        745 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        746 1 1 1 1 139 PRO HA   . 139 . HA   1 1 
        746 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        747 1 1 1 1 137 ASP HB2  . 137 . HB2  1 1 
        747 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        748 1 1 1 1 139 PRO HB3  . 139 . HB1  1 1 
        748 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        749 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        749 1 2 1 1 149 THR HB   . 149 . HB   1 1 
        750 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        750 1 2 1 1 149 THR MG   . 149 . HG2* 1 1 
        751 1 1 1 1 142 THR MG   . 142 . HG2* 1 1 
        751 1 2 1 1 147 LEU MD2  . 147 . HD2* 1 1 
        752 1 1 1 1 134 ILE MG   . 134 . HG2* 1 1 
        752 1 2 1 1 150 ARG QB   . 150 . HB*  1 1 
        753 1 1 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        753 1 2 1 1 151 VAL HB   . 151 . HB   1 1 
        754 1 1 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        754 1 2 1 1 151 VAL HB   . 151 . HB   1 1 
        755 1 1 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        755 1 2 1 1 151 VAL MG2  . 151 . HG2* 1 1 
        756 1 1 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        756 1 2 1 1 151 VAL MG2  . 151 . HG2* 1 1 
        757 1 1 1 1 131 ALA MB   . 131 . HB*  1 1 
        757 1 2 1 1 151 VAL MG2  . 151 . HG2* 1 1 
        758 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
        758 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        759 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
        759 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        760 1 1 1 1  11 LEU MD1  .  11 . HD1* 1 1 
        760 1 2 1 1 119 TRP HH2  . 119 . HH2  1 1 
        761 1 1 1 1  11 LEU MD2  .  11 . HD2* 1 1 
        761 1 2 1 1 119 TRP HH2  . 119 . HH2  1 1 
        762 1 1 1 1  11 LEU MD2  .  11 . HD2* 1 1 
        762 1 2 1 1 119 TRP HZ3  . 119 . HZ3  1 1 
        763 1 1 1 1  14 LEU MD1  .  14 . HD1* 1 1 
        763 1 2 1 1 132 TYR QE   . 132 . HE*  1 1 
        764 1 1 1 1  14 LEU MD2  .  14 . HD2* 1 1 
        764 1 2 1 1 132 TYR QE   . 132 . HE*  1 1 
        765 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        765 1 2 1 1  58 PHE QE   .  58 . HE*  1 1 
        766 1 1 1 1  20 LEU MD1  .  20 . HD1* 1 1 
        766 1 2 1 1  89 THR H    .  89 . HN   1 1 
        767 1 1 1 1 100 SER H    . 100 . HN   1 1 
        767 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        768 1 1 1 1  99 SER H    .  99 . HN   1 1 
        768 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        769 1 1 1 1  99 SER HA   .  99 . HA   1 1 
        769 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        770 1 1 1 1  27 ALA MB   .  27 . HB*  1 1 
        770 1 2 1 1  30 GLU H    .  30 . HN   1 1 
        771 1 1 1 1  27 ALA MB   .  27 . HB*  1 1 
        771 1 2 1 1  29 SER H    .  29 . HN   1 1 
        772 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
        772 1 2 1 1  61 TYR QE   .  61 . HE*  1 1 
        773 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
        773 1 2 1 1  35 PHE QE   .  35 . HE*  1 1 
        774 1 1 1 1  31 LEU MD1  .  31 . HD1* 1 1 
        774 1 2 1 1  35 PHE HZ   .  35 . HZ   1 1 
        775 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
        775 1 2 1 1  35 PHE HZ   .  35 . HZ   1 1 
        776 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
        776 1 2 1 1  35 PHE QE   .  35 . HE*  1 1 
        777 1 1 1 1  31 LEU MD2  .  31 . HD2* 1 1 
        777 1 2 1 1  61 TYR QE   .  61 . HE*  1 1 
        778 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        778 1 2 1 1  52 SER H    .  52 . HN   1 1 
        779 1 1 1 1  35 PHE HZ   .  35 . HZ   1 1 
        779 1 2 1 1  59 ALA MB   .  59 . HB*  1 1 
        780 1 1 1 1  59 ALA MB   .  59 . HB*  1 1 
        780 1 2 1 1 135 TYR QE   . 135 . HE*  1 1 
        781 1 1 1 1  26 THR H    .  26 . HN   1 1 
        781 1 2 1 1  68 THR MG   .  68 . HG2* 1 1 
        782 1 1 1 1   7 PHE QD   .   7 . HD*  1 1 
        782 1 2 1 1 115 ALA MB   . 115 . HB*  1 1 
        783 1 1 1 1  20 LEU H    .  20 . HN   1 1 
        783 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        784 1 1 1 1  20 LEU H    .  20 . HN   1 1 
        784 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        785 1 1 1 1  19 ALA HA   .  19 . HA   1 1 
        785 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        786 1 1 1 1  19 ALA HA   .  19 . HA   1 1 
        786 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        787 1 1 1 1  79 GLY H    .  79 . HN   1 1 
        787 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        788 1 1 1 1  78 GLU H    .  78 . HN   1 1 
        788 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        789 1 1 1 1  49 GLN HE21 .  49 . HE21 1 1 
        789 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        790 1 1 1 1  79 GLY H    .  79 . HN   1 1 
        790 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        791 1 1 1 1  78 GLU H    .  78 . HN   1 1 
        791 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        792 1 1 1 1  49 GLN HE21 .  49 . HE21 1 1 
        792 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        793 1 1 1 1  84 SER H    .  84 . HN   1 1 
        793 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        794 1 1 1 1  84 SER H    .  84 . HN   1 1 
        794 1 2 1 1  87 VAL MG2  .  87 . HG2* 1 1 
        795 1 1 1 1  83 GLY H    .  83 . HN   1 1 
        795 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
        796 1 1 1 1  17 VAL H    .  17 . HN   1 1 
        796 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        797 1 1 1 1  97 ALA MB   .  97 . HB*  1 1 
        797 1 2 1 1 152 SER HA   . 152 . HA   1 1 
        798 1 1 1 1  97 ALA MB   .  97 . HB*  1 1 
        798 1 2 1 1 153 LEU H    . 153 . HN   1 1 
        799 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        799 1 2 1 1 153 LEU H    . 153 . HN   1 1 
        800 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        800 1 2 1 1 119 TRP HE3  . 119 . HE3  1 1 
        801 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        801 1 2 1 1 119 TRP HZ3  . 119 . HZ3  1 1 
        802 1 1 1 1 101 LEU MD2  . 101 . HD2* 1 1 
        802 1 2 1 1 149 THR H    . 149 . HN   1 1 
        803 1 1 1 1 103 ILE MD   . 103 . HD1* 1 1 
        803 1 2 1 1 148 ARG HA   . 148 . HA   1 1 
        804 1 1 1 1 109 ILE MG   . 109 . HG2* 1 1 
        804 1 2 1 1 113 TYR QD   . 113 . HD*  1 1 
        805 1 1 1 1 109 ILE MG   . 109 . HG2* 1 1 
        805 1 2 1 1 113 TYR QE   . 113 . HE*  1 1 
        806 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
        806 1 2 1 1 109 ILE MD   . 109 . HD1* 1 1 
        807 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        807 1 2 1 1 135 TYR QD   . 135 . HD*  1 1 
        808 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        808 1 2 1 1 113 TYR QD   . 113 . HD*  1 1 
        809 1 1 1 1 109 ILE MD   . 109 . HD1* 1 1 
        809 1 2 1 1 113 TYR QE   . 113 . HE*  1 1 
        810 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
        810 1 2 1 1 112 VAL MG1  . 112 . HG1* 1 1 
        811 1 1 1 1   7 PHE QD   .   7 . HD*  1 1 
        811 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        812 1 1 1 1 102 TYR QD   . 102 . HD*  1 1 
        812 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        813 1 1 1 1 119 TRP HE3  . 119 . HE3  1 1 
        813 1 2 1 1 120 VAL MG1  . 120 . HG1* 1 1 
        814 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        814 1 2 1 1 127 LEU H    . 127 . HN   1 1 
        815 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        815 1 2 1 1 125 PHE H    . 125 . HN   1 1 
        816 1 1 1 1 119 TRP HE3  . 119 . HE3  1 1 
        816 1 2 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        817 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        817 1 2 1 1 125 PHE QD   . 125 . HD*  1 1 
        818 1 1 1 1 120 VAL MG2  . 120 . HG2* 1 1 
        818 1 2 1 1 126 ASP HA   . 126 . HA   1 1 
        819 1 1 1 1  61 TYR QD   .  61 . HD*  1 1 
        819 1 2 1 1 131 ALA MB   . 131 . HB*  1 1 
        820 1 1 1 1 113 TYR QE   . 113 . HE*  1 1 
        820 1 2 1 1 131 ALA MB   . 131 . HB*  1 1 
        821 1 1 1 1 132 TYR QE   . 132 . HE*  1 1 
        821 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
        822 1 1 1 1 143 ALA MB   . 143 . HB*  1 1 
        822 1 2 1 1 146 GLN H    . 146 . HN   1 1 
        823 1 1 1 1 135 TYR QD   . 135 . HD*  1 1 
        823 1 2 1 1 149 THR MG   . 149 . HG2* 1 1 
        824 1 1 1 1 135 TYR QE   . 135 . HE*  1 1 
        824 1 2 1 1 149 THR MG   . 149 . HG2* 1 1 
        825 1 1 1 1 113 TYR QE   . 113 . HE*  1 1 
        825 1 2 1 1 151 VAL MG1  . 151 . HG1* 1 1 
        826 1 1 1 1 113 TYR QE   . 113 . HE*  1 1 
        826 1 2 1 1 151 VAL MG2  . 151 . HG2* 1 1 
        827 1 1 1 1  98 ALA H    .  98 . HN   1 1 
        827 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        828 1 1 1 1  98 ALA H    .  98 . HN   1 1 
        828 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        829 1 1 1 1  97 ALA HA   .  97 . HA   1 1 
        829 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        830 1 1 1 1  97 ALA HA   .  97 . HA   1 1 
        830 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        831 1 1 1 1   7 PHE QE   .   7 . HE*  1 1 
        831 1 2 1 1 111 ALA MB   . 111 . HB*  1 1 
        832 1 1 1 1 125 PHE HB2  . 125 . HB2  1 1 
        832 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        833 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
        833 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        834 1 1 1 1 125 PHE QD   . 125 . HD*  1 1 
        834 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        835 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        835 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
        836 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        836 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        837 1 1 1 1  35 PHE QE   .  35 . HE*  1 1 
        837 1 2 1 1  59 ALA MB   .  59 . HB*  1 1 
        838 1 1 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        838 1 2 1 1  72 GLU H    .  72 . HN   1 1 
        839 1 1 1 1  69 PHE QD   .  69 . HD*  1 1 
        839 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        840 1 1 1 1  35 PHE HZ   .  35 . HZ   1 1 
        840 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        841 1 1 1 1  35 PHE QE   .  35 . HE*  1 1 
        841 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        842 1 1 1 1  61 TYR QE   .  61 . HE*  1 1 
        842 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        843 1 1 1 1  61 TYR QD   .  61 . HD*  1 1 
        843 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        844 1 1 1 1  61 TYR HA   .  61 . HA   1 1 
        844 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        845 1 1 1 1  25 GLN QB   .  25 . HB*  1 1 
        845 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        846 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        846 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        847 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        847 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        848 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        848 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        849 1 1 1 1  46 LEU MD2  .  46 . HD2* 1 1 
        849 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
        850 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        850 1 2 1 1  49 GLN HE21 .  49 . HE21 1 1 
        851 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        851 1 2 1 1  84 SER H    .  84 . HN   1 1 
        852 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        852 1 2 1 1  84 SER HB3  .  84 . HB1  1 1 
        853 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        853 1 2 1 1  83 GLY HA3  .  83 . HA1  1 1 
        854 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        854 1 2 1 1  83 GLY HA2  .  83 . HA2  1 1 
        855 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        855 1 2 1 1  84 SER HB2  .  84 . HB2  1 1 
        856 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        856 1 2 1 1  46 LEU H    .  46 . HN   1 1 
        857 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        857 1 2 1 1  83 GLY HA3  .  83 . HA1  1 1 
        858 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        858 1 2 1 1  83 GLY HA2  .  83 . HA2  1 1 
        859 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        859 1 2 1 1  84 SER H    .  84 . HN   1 1 
        860 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        860 1 2 1 1  46 LEU H    .  46 . HN   1 1 
        861 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        861 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        862 1 1 1 1  42 ILE MD   .  42 . HD1* 1 1 
        862 1 2 1 1  75 PHE H    .  75 . HN   1 1 
        863 1 1 1 1  22 ILE H    .  22 . HN   1 1 
        863 1 2 1 1  42 ILE MD   .  42 . HD1* 1 1 
        864 1 1 1 1  42 ILE MD   .  42 . HD1* 1 1 
        864 1 2 1 1  75 PHE QD   .  75 . HD*  1 1 
        865 1 1 1 1  39 TYR QD   .  39 . HD*  1 1 
        865 1 2 1 1  42 ILE MD   .  42 . HD1* 1 1 
        866 1 1 1 1  39 TYR HA   .  39 . HA   1 1 
        866 1 2 1 1  42 ILE MD   .  42 . HD1* 1 1 
        867 1 1 1 1  26 THR MG   .  26 . HG2* 1 1 
        867 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
        868 1 1 1 1  26 THR MG   .  26 . HG2* 1 1 
        868 1 2 1 1  69 PHE QD   .  69 . HD*  1 1 
        869 1 1 1 1  26 THR MG   .  26 . HG2* 1 1 
        869 1 2 1 1  71 VAL MG1  .  71 . HG1* 1 1 
        870 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        870 1 2 1 1  76 PRO HB2  .  76 . HB2  1 1 
        871 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        871 1 2 1 1  76 PRO HB3  .  76 . HB1  1 1 
        872 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        872 1 2 1 1  18 PRO HD3  .  18 . HD1  1 1 
        873 1 1 1 1  16 PRO HA   .  16 . HA   1 1 
        873 1 2 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        874 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        874 1 2 1 1  76 PRO HA   .  76 . HA   1 1 
        875 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        875 1 2 1 1  92 THR H    .  92 . HN   1 1 
        876 1 1 1 1  17 VAL MG2  .  17 . HG2* 1 1 
        876 1 2 1 1  18 PRO HD3  .  18 . HD1  1 1 
        877 1 1 1 1  17 VAL MG2  .  17 . HG2* 1 1 
        877 1 2 1 1  92 THR H    .  92 . HN   1 1 
        878 1 1 1 1  17 VAL MG2  .  17 . HG2* 1 1 
        878 1 2 1 1  18 PRO HD2  .  18 . HD2  1 1 
        879 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        879 1 2 1 1  18 PRO HD2  .  18 . HD2  1 1 
        880 1 1 1 1 112 VAL HA   . 112 . HA   1 1 
        880 1 2 1 1 115 ALA MB   . 115 . HB*  1 1 
        881 1 1 1 1   7 PHE HB3  .   7 . HB1  1 1 
        881 1 2 1 1 115 ALA MB   . 115 . HB*  1 1 
        882 1 1 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        882 1 2 1 1 115 ALA MB   . 115 . HB*  1 1 
        883 1 1 1 1  19 ALA MB   .  19 . HB*  1 1 
        883 1 2 1 1  76 PRO HA   .  76 . HA   1 1 
        884 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        884 1 2 1 1  24 THR HB   .  24 . HB   1 1 
        885 1 1 1 1  22 ILE HA   .  22 . HA   1 1 
        885 1 2 1 1  88 VAL MG2  .  88 . HG2* 1 1 
        886 1 1 1 1  97 ALA MB   .  97 . HB*  1 1 
        886 1 2 1 1 152 SER HB2  . 152 . HB2  1 1 
        887 1 1 1 1 103 ILE MG   . 103 . HG2* 1 1 
        887 1 2 1 1 145 ASP HA   . 145 . HA   1 1 
        888 1 1 1 1 102 TYR HA   . 102 . HA   1 1 
        888 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        889 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
        889 1 2 1 1 120 VAL HA   . 120 . HA   1 1 
        890 1 1 1 1  61 TYR HB3  .  61 . HB1  1 1 
        890 1 2 1 1 131 ALA MB   . 131 . HB*  1 1 
        891 1 1 1 1   7 PHE HB2  .   7 . HB2  1 1 
        891 1 2 1 1 115 ALA MB   . 115 . HB*  1 1 
        892 1 1 1 1 139 PRO HD3  . 139 . HD1  1 1 
        892 1 2 1 1 147 LEU MD1  . 147 . HD1* 1 1 
        893 1 1 1 1 139 PRO HD2  . 139 . HD2  1 1 
        893 1 2 1 1 147 LEU MD1  . 147 . HD1* 1 1 
        894 1 1 1 1  11 LEU HB2  .  11 . HB2  1 1 
        894 1 2 1 1 155 LEU MD1  . 155 . HD1* 1 1 
        895 1 1 1 1  11 LEU MD1  .  11 . HD1* 1 1 
        895 1 2 1 1  98 ALA HA   .  98 . HA   1 1 
        896 1 1 1 1  18 PRO HD2  .  18 . HD2  1 1 
        896 1 2 1 1  91 LEU MD2  .  91 . HD2* 1 1 
        897 1 1 1 1 100 SER HB3  . 100 . HB1  1 1 
        897 1 2 1 1 116 LEU MD1  . 116 . HD1* 1 1 
        898 1 1 1 1  33 SER HA   .  33 . HA   1 1 
        898 1 2 1 1  37 ALA MB   .  37 . HB*  1 1 
        899 1 1 1 1   2 ASP QB   .   2 . HB*  1 1 
        899 1 2 1 1   3 PHE QB   .   3 . HB*  1 1 
        900 1 1 1 1   2 ASP HB3  .   2 . HB1  1 1 
        900 1 2 1 1   3 PHE HB2  .   3 . HB2  1 1 
        901 1 1 1 1   2 ASP HB3  .   2 . HB1  1 1 
        901 1 2 1 1   3 PHE HB3  .   3 . HB1  1 1 
        902 1 1 1 1   4 GLU H    .   4 . HN   1 1 
        902 1 2 1 1   4 GLU QB   .   4 . HB*  1 1 
        903 1 1 1 1   6 GLN H    .   6 . HN   1 1 
        903 1 2 1 1   6 GLN QB   .   6 . HB*  1 1 
        904 1 1 1 1   6 GLN QB   .   6 . HB*  1 1 
        904 1 2 1 1   7 PHE H    .   7 . HN   1 1 
        905 1 1 1 1   7 PHE H    .   7 . HN   1 1 
        905 1 2 1 1   7 PHE QB   .   7 . HB*  1 1 
        906 1 1 1 1   7 PHE QB   .   7 . HB*  1 1 
        906 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
        907 1 1 1 1   8 VAL QG   .   8 . HG*  1 1 
        907 1 2 1 1   9 CYS H    .   9 . HN   1 1 
        908 1 1 1 1   8 VAL QG   .   8 . HG*  1 1 
        908 1 2 1 1 100 SER HA   . 100 . HA   1 1 
        909 1 1 1 1   9 CYS QB   .   9 . HB*  1 1 
        909 1 2 1 1  10 GLU H    .  10 . HN   1 1 
        910 1 1 1 1   9 CYS QB   .   9 . HB*  1 1 
        910 1 2 1 1 100 SER HA   . 100 . HA   1 1 
        911 1 1 1 1   9 CYS QB   .   9 . HB*  1 1 
        911 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
        912 1 1 1 1   9 CYS QB   .   9 . HB*  1 1 
        912 1 2 1 1 119 TRP HD1  . 119 . HD1  1 1 
        913 1 1 1 1  10 GLU H    .  10 . HN   1 1 
        913 1 2 1 1 100 SER QB   . 100 . HB*  1 1 
        914 1 1 1 1  10 GLU QB   .  10 . HB*  1 1 
        914 1 2 1 1  11 LEU H    .  11 . HN   1 1 
        915 1 1 1 1  11 LEU MD1  .  11 . HD1* 1 1 
        915 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
        916 1 1 1 1  11 LEU MD1  .  11 . HD1* 1 1 
        916 1 2 1 1  96 LYS QE   .  96 . HE*  1 1 
        917 1 1 1 1  11 LEU MD2  .  11 . HD2* 1 1 
        917 1 2 1 1  96 LYS QE   .  96 . HE*  1 1 
        918 1 1 1 1  12 LYS H    .  12 . HN   1 1 
        918 1 2 1 1  12 LYS QB   .  12 . HB*  1 1 
        919 1 1 1 1  12 LYS QB   .  12 . HB*  1 1 
        919 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        920 1 1 1 1  12 LYS QB   .  12 . HB*  1 1 
        920 1 2 1 1  14 LEU QD   .  14 . HD*  1 1 
        921 1 1 1 1  12 LYS HB2  .  12 . HB2  1 1 
        921 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
        922 1 1 1 1  12 LYS HB3  .  12 . HB1  1 1 
        922 1 2 1 1  14 LEU MD2  .  14 . HD2* 1 1 
        923 1 1 1 1  12 LYS QG   .  12 . HG*  1 1 
        923 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        924 1 1 1 1  12 LYS QD   .  12 . HD*  1 1 
        924 1 2 1 1  13 GLU H    .  13 . HN   1 1 
        925 1 1 1 1  13 GLU HA   .  13 . HA   1 1 
        925 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
        926 1 1 1 1  13 GLU QB   .  13 . HB*  1 1 
        926 1 2 1 1  14 LEU H    .  14 . HN   1 1 
        927 1 1 1 1  13 GLU QG   .  13 . HG*  1 1 
        927 1 2 1 1  96 LYS HA   .  96 . HA   1 1 
        928 1 1 1 1  13 GLU QG   .  13 . HG*  1 1 
        928 1 2 1 1  96 LYS QG   .  96 . HG*  1 1 
        929 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
        929 1 2 1 1  93 PRO QB   .  93 . HB*  1 1 
        930 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
        930 1 2 1 1  94 SER H    .  94 . HN   1 1 
        931 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
        931 1 2 1 1  94 SER HA   .  94 . HA   1 1 
        932 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
        932 1 2 1 1  95 GLY H    .  95 . HN   1 1 
        933 1 1 1 1  14 LEU QB   .  14 . HB*  1 1 
        933 1 2 1 1  97 ALA MB   .  97 . HB*  1 1 
        934 1 1 1 1  14 LEU QD   .  14 . HD*  1 1 
        934 1 2 1 1  97 ALA MB   .  97 . HB*  1 1 
        935 1 1 1 1  14 LEU QD   .  14 . HD*  1 1 
        935 1 2 1 1 132 TYR QD   . 132 . HD*  1 1 
        936 1 1 1 1  14 LEU QD   .  14 . HD*  1 1 
        936 1 2 1 1 152 SER QB   . 152 . HB*  1 1 
        937 1 1 1 1  16 PRO HA   .  16 . HA   1 1 
        937 1 2 1 1  91 LEU QD   .  91 . HD*  1 1 
        938 1 1 1 1  17 VAL HB   .  17 . HB   1 1 
        938 1 2 1 1  76 PRO QB   .  76 . HB*  1 1 
        939 1 1 1 1  17 VAL MG1  .  17 . HG1* 1 1 
        939 1 2 1 1  76 PRO QG   .  76 . HG*  1 1 
        940 1 1 1 1  18 PRO HA   .  18 . HA   1 1 
        940 1 2 1 1  91 LEU QD   .  91 . HD*  1 1 
        941 1 1 1 1  18 PRO HB2  .  18 . HB2  1 1 
        941 1 2 1 1  91 LEU QD   .  91 . HD*  1 1 
        942 1 1 1 1  18 PRO QG   .  18 . HG*  1 1 
        942 1 2 1 1  77 VAL MG2  .  77 . HG2* 1 1 
        943 1 1 1 1  18 PRO QG   .  18 . HG*  1 1 
        943 1 2 1 1  91 LEU QD   .  91 . HD*  1 1 
        944 1 1 1 1  18 PRO QD   .  18 . HD*  1 1 
        944 1 2 1 1  91 LEU QD   .  91 . HD*  1 1 
        945 1 1 1 1  18 PRO HD2  .  18 . HD2  1 1 
        945 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        946 1 1 1 1  18 PRO HD3  .  18 . HD1  1 1 
        946 1 2 1 1  91 LEU MD1  .  91 . HD1* 1 1 
        947 1 1 1 1  19 ALA H    .  19 . HN   1 1 
        947 1 2 1 1  91 LEU QD   .  91 . HD*  1 1 
        948 1 1 1 1  20 LEU QB   .  20 . HB*  1 1 
        948 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
        949 1 1 1 1  20 LEU HG   .  20 . HG   1 1 
        949 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
        950 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        950 1 2 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        951 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        951 1 2 1 1  77 VAL HB   .  77 . HB   1 1 
        952 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        952 1 2 1 1  81 VAL HB   .  81 . HB   1 1 
        953 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        953 1 2 1 1  82 GLU HA   .  82 . HA   1 1 
        954 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        954 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        955 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        955 1 2 1 1  83 GLY QA   .  83 . HA*  1 1 
        956 1 1 1 1  20 LEU MD1  .  20 . HD1* 1 1 
        956 1 2 1 1  83 GLY HA3  .  83 . HA1  1 1 
        957 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        957 1 2 1 1  87 VAL H    .  87 . HN   1 1 
        958 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        958 1 2 1 1  87 VAL HA   .  87 . HA   1 1 
        959 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        959 1 2 1 1  87 VAL HB   .  87 . HB   1 1 
        960 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        960 1 2 1 1  88 VAL H    .  88 . HN   1 1 
        961 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        961 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
        962 1 1 1 1  20 LEU QD   .  20 . HD*  1 1 
        962 1 2 1 1  90 GLY H    .  90 . HN   1 1 
        963 1 1 1 1  21 LEU H    .  21 . HN   1 1 
        963 1 2 1 1  87 VAL QG   .  87 . HG*  1 1 
        964 1 1 1 1  22 ILE MG   .  22 . HG2* 1 1 
        964 1 2 1 1  86 ARG QB   .  86 . HB*  1 1 
        965 1 1 1 1  22 ILE QG   .  22 . HG1* 1 1 
        965 1 2 1 1  42 ILE MD   .  42 . HD1* 1 1 
        966 1 1 1 1  22 ILE QG   .  22 . HG1* 1 1 
        966 1 2 1 1  87 VAL QG   .  87 . HG*  1 1 
        967 1 1 1 1  22 ILE HG12 .  22 . HG12 1 1 
        967 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        968 1 1 1 1  22 ILE HG13 .  22 . HG11 1 1 
        968 1 2 1 1  87 VAL MG1  .  87 . HG1* 1 1 
        969 1 1 1 1  31 LEU HA   .  31 . HA   1 1 
        969 1 2 1 1  34 LEU QB   .  34 . HB*  1 1 
        970 1 1 1 1  31 LEU QB   .  31 . HB*  1 1 
        970 1 2 1 1  32 GLY H    .  32 . HN   1 1 
        971 1 1 1 1  31 LEU QD   .  31 . HD*  1 1 
        971 1 2 1 1  35 PHE QD   .  35 . HD*  1 1 
        972 1 1 1 1  31 LEU QD   .  31 . HD*  1 1 
        972 1 2 1 1  69 PHE QE   .  69 . HE*  1 1 
        973 1 1 1 1  33 SER HA   .  33 . HA   1 1 
        973 1 2 1 1  36 GLU QB   .  36 . HB*  1 1 
        974 1 1 1 1  33 SER QB   .  33 . HB*  1 1 
        974 1 2 1 1  36 GLU QB   .  36 . HB*  1 1 
        975 1 1 1 1  34 LEU H    .  34 . HN   1 1 
        975 1 2 1 1  34 LEU QB   .  34 . HB*  1 1 
        976 1 1 1 1  34 LEU QB   .  34 . HB*  1 1 
        976 1 2 1 1  35 PHE H    .  35 . HN   1 1 
        977 1 1 1 1  35 PHE QB   .  35 . HB*  1 1 
        977 1 2 1 1  36 GLU H    .  36 . HN   1 1 
        978 1 1 1 1  36 GLU H    .  36 . HN   1 1 
        978 1 2 1 1  36 GLU QB   .  36 . HB*  1 1 
        979 1 1 1 1  36 GLU HA   .  36 . HA   1 1 
        979 1 2 1 1  39 TYR QB   .  39 . HB*  1 1 
        980 1 1 1 1  36 GLU QB   .  36 . HB*  1 1 
        980 1 2 1 1  37 ALA H    .  37 . HN   1 1 
        981 1 1 1 1  40 HIS H    .  40 . HN   1 1 
        981 1 2 1 1  40 HIS QB   .  40 . HB*  1 1 
        982 1 1 1 1  40 HIS QB   .  40 . HB*  1 1 
        982 1 2 1 1  41 ASP H    .  41 . HN   1 1 
        983 1 1 1 1  45 LEU QB   .  45 . HB*  1 1 
        983 1 2 1 1  84 SER QB   .  84 . HB*  1 1 
        984 1 1 1 1  45 LEU HB2  .  45 . HB2  1 1 
        984 1 2 1 1  84 SER HB2  .  84 . HB2  1 1 
        985 1 1 1 1  45 LEU HB3  .  45 . HB1  1 1 
        985 1 2 1 1  84 SER HB2  .  84 . HB2  1 1 
        986 1 1 1 1  45 LEU MD1  .  45 . HD1* 1 1 
        986 1 2 1 1  83 GLY QA   .  83 . HA*  1 1 
        987 1 1 1 1  45 LEU MD2  .  45 . HD2* 1 1 
        987 1 2 1 1  83 GLY QA   .  83 . HA*  1 1 
        988 1 1 1 1  46 LEU HA   .  46 . HA   1 1 
        988 1 2 1 1  49 GLN QB   .  49 . HB*  1 1 
        989 1 1 1 1  46 LEU HA   .  46 . HA   1 1 
        989 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
        990 1 1 1 1  46 LEU MD1  .  46 . HD1* 1 1 
        990 1 2 1 1  53 PRO QG   .  53 . HG*  1 1 
        991 1 1 1 1  49 GLN H    .  49 . HN   1 1 
        991 1 2 1 1  49 GLN QB   .  49 . HB*  1 1 
        992 1 1 1 1  49 GLN QB   .  49 . HB*  1 1 
        992 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
        993 1 1 1 1  49 GLN HB2  .  49 . HB2  1 1 
        993 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        994 1 1 1 1  49 GLN HB3  .  49 . HB1  1 1 
        994 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        995 1 1 1 1  49 GLN QE   .  49 . HE2* 1 1 
        995 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
        996 1 1 1 1  49 GLN HE22 .  49 . HE22 1 1 
        996 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
        997 1 1 1 1  49 GLN QE   .  49 . HE2* 1 1 
        997 1 2 1 1  82 GLU QB   .  82 . HB*  1 1 
        998 1 1 1 1  49 GLN HE22 .  49 . HE22 1 1 
        998 1 2 1 1  82 GLU HB2  .  82 . HB2  1 1 
        999 1 1 1 1  51 LYS H    .  51 . HN   1 1 
        999 1 2 1 1  51 LYS QB   .  51 . HB*  1 1 
       1000 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
       1000 1 2 1 1  51 LYS QD   .  51 . HD*  1 1 
       1001 1 1 1 1  51 LYS HA   .  51 . HA   1 1 
       1001 1 2 1 1  51 LYS QE   .  51 . HE*  1 1 
       1002 1 1 1 1  51 LYS QB   .  51 . HB*  1 1 
       1002 1 2 1 1  52 SER H    .  52 . HN   1 1 
       1003 1 1 1 1  51 LYS QD   .  51 . HD*  1 1 
       1003 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
       1004 1 1 1 1  51 LYS HD2  .  51 . HD2  1 1 
       1004 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       1005 1 1 1 1  51 LYS HD3  .  51 . HD1  1 1 
       1005 1 2 1 1  81 VAL MG2  .  81 . HG2* 1 1 
       1006 1 1 1 1  51 LYS QE   .  51 . HE*  1 1 
       1006 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
       1007 1 1 1 1  51 LYS HE3  .  51 . HE1  1 1 
       1007 1 2 1 1  81 VAL MG1  .  81 . HG1* 1 1 
       1008 1 1 1 1  52 SER H    .  52 . HN   1 1 
       1008 1 2 1 1  52 SER QB   .  52 . HB*  1 1 
       1009 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       1009 1 2 1 1  54 SER H    .  54 . HN   1 1 
       1010 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       1010 1 2 1 1  55 GLY H    .  55 . HN   1 1 
       1011 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       1011 1 2 1 1  75 PHE QB   .  75 . HB*  1 1 
       1012 1 1 1 1  53 PRO HB2  .  53 . HB2  1 1 
       1012 1 2 1 1  75 PHE HB3  .  75 . HB1  1 1 
       1013 1 1 1 1  53 PRO HB3  .  53 . HB1  1 1 
       1013 1 2 1 1  75 PHE HB3  .  75 . HB1  1 1 
       1014 1 1 1 1  53 PRO QB   .  53 . HB*  1 1 
       1014 1 2 1 1  77 VAL MG1  .  77 . HG1* 1 1 
       1015 1 1 1 1  53 PRO QD   .  53 . HD*  1 1 
       1015 1 2 1 1  54 SER H    .  54 . HN   1 1 
       1016 1 1 1 1  58 PHE QB   .  58 . HB*  1 1 
       1016 1 2 1 1  59 ALA H    .  59 . HN   1 1 
       1017 1 1 1 1  58 PHE QB   .  58 . HB*  1 1 
       1017 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
       1018 1 1 1 1  58 PHE QB   .  58 . HB*  1 1 
       1018 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
       1019 1 1 1 1  60 ARG HA   .  60 . HA   1 1 
       1019 1 2 1 1 133 GLU QG   . 133 . HG*  1 1 
       1020 1 1 1 1  61 TYR HA   .  61 . HA   1 1 
       1020 1 2 1 1  70 GLU QG   .  70 . HG*  1 1 
       1021 1 1 1 1  64 MET H    .  64 . HN   1 1 
       1021 1 2 1 1  64 MET QB   .  64 . HB*  1 1 
       1022 1 1 1 1  64 MET QG   .  64 . HG*  1 1 
       1022 1 2 1 1 154 MET H    . 154 . HN   1 1 
       1023 1 1 1 1  69 PHE QB   .  69 . HB*  1 1 
       1023 1 2 1 1  70 GLU H    .  70 . HN   1 1 
       1024 1 1 1 1  70 GLU QG   .  70 . HG*  1 1 
       1024 1 2 1 1  71 VAL H    .  71 . HN   1 1 
       1025 1 1 1 1  70 GLU QG   .  70 . HG*  1 1 
       1025 1 2 1 1  71 VAL HA   .  71 . HA   1 1 
       1026 1 1 1 1  77 VAL HB   .  77 . HB   1 1 
       1026 1 2 1 1  81 VAL QG   .  81 . HG*  1 1 
       1027 1 1 1 1  77 VAL MG2  .  77 . HG2* 1 1 
       1027 1 2 1 1  79 GLY QA   .  79 . HA*  1 1 
       1028 1 1 1 1  78 GLU QB   .  78 . HB*  1 1 
       1028 1 2 1 1  79 GLY H    .  79 . HN   1 1 
       1029 1 1 1 1  82 GLU H    .  82 . HN   1 1 
       1029 1 2 1 1  82 GLU QB   .  82 . HB*  1 1 
       1030 1 1 1 1  82 GLU QB   .  82 . HB*  1 1 
       1030 1 2 1 1  83 GLY H    .  83 . HN   1 1 
       1031 1 1 1 1  82 GLU QB   .  82 . HB*  1 1 
       1031 1 2 1 1  89 THR MG   .  89 . HG2* 1 1 
       1032 1 1 1 1  82 GLU QG   .  82 . HG*  1 1 
       1032 1 2 1 1  83 GLY H    .  83 . HN   1 1 
       1033 1 1 1 1  83 GLY QA   .  83 . HA*  1 1 
       1033 1 2 1 1  88 VAL MG1  .  88 . HG1* 1 1 
       1034 1 1 1 1  83 GLY QA   .  83 . HA*  1 1 
       1034 1 2 1 1  89 THR H    .  89 . HN   1 1 
       1035 1 1 1 1  90 GLY QA   .  90 . HA*  1 1 
       1035 1 2 1 1  91 LEU H    .  91 . HN   1 1 
       1036 1 1 1 1  91 LEU QD   .  91 . HD*  1 1 
       1036 1 2 1 1  92 THR H    .  92 . HN   1 1 
       1037 1 1 1 1  93 PRO QB   .  93 . HB*  1 1 
       1037 1 2 1 1  94 SER H    .  94 . HN   1 1 
       1038 1 1 1 1  94 SER QB   .  94 . HB*  1 1 
       1038 1 2 1 1  95 GLY H    .  95 . HN   1 1 
       1039 1 1 1 1  96 LYS H    .  96 . HN   1 1 
       1039 1 2 1 1  96 LYS QB   .  96 . HB*  1 1 
       1040 1 1 1 1  96 LYS QB   .  96 . HB*  1 1 
       1040 1 2 1 1  97 ALA H    .  97 . HN   1 1 
       1041 1 1 1 1  98 ALA MB   .  98 . HB*  1 1 
       1041 1 2 1 1 153 LEU QB   . 153 . HB*  1 1 
       1042 1 1 1 1 100 SER QB   . 100 . HB*  1 1 
       1042 1 2 1 1 112 VAL MG1  . 112 . HG1* 1 1 
       1043 1 1 1 1 100 SER QB   . 100 . HB*  1 1 
       1043 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
       1044 1 1 1 1 100 SER QB   . 100 . HB*  1 1 
       1044 1 2 1 1 116 LEU HA   . 116 . HA   1 1 
       1045 1 1 1 1 100 SER QB   . 100 . HB*  1 1 
       1045 1 2 1 1 116 LEU MD2  . 116 . HD2* 1 1 
       1046 1 1 1 1 101 LEU QB   . 101 . HB*  1 1 
       1046 1 2 1 1 136 LEU QD   . 136 . HD*  1 1 
       1047 1 1 1 1 102 TYR QB   . 102 . HB*  1 1 
       1047 1 2 1 1 112 VAL MG2  . 112 . HG2* 1 1 
       1048 1 1 1 1 103 ILE MG   . 103 . HG2* 1 1 
       1048 1 2 1 1 146 GLN QG   . 146 . HG*  1 1 
       1049 1 1 1 1 103 ILE MD   . 103 . HD1* 1 1 
       1049 1 2 1 1 148 ARG QB   . 148 . HB*  1 1 
       1050 1 1 1 1 106 TYR QE   . 106 . HE*  1 1 
       1050 1 2 1 1 133 GLU QB   . 133 . HB*  1 1 
       1051 1 1 1 1 106 TYR QE   . 106 . HE*  1 1 
       1051 1 2 1 1 133 GLU QG   . 133 . HG*  1 1 
       1052 1 1 1 1 109 ILE QG   . 109 . HG1* 1 1 
       1052 1 2 1 1 113 TYR QE   . 113 . HE*  1 1 
       1053 1 1 1 1 109 ILE QG   . 109 . HG1* 1 1 
       1053 1 2 1 1 151 VAL MG1  . 151 . HG1* 1 1 
       1054 1 1 1 1 109 ILE QG   . 109 . HG1* 1 1 
       1054 1 2 1 1 151 VAL MG2  . 151 . HG2* 1 1 
       1055 1 1 1 1 110 GLU H    . 110 . HN   1 1 
       1055 1 2 1 1 110 GLU QB   . 110 . HB*  1 1 
       1056 1 1 1 1 110 GLU HA   . 110 . HA   1 1 
       1056 1 2 1 1 113 TYR QB   . 113 . HB*  1 1 
       1057 1 1 1 1 111 ALA HA   . 111 . HA   1 1 
       1057 1 2 1 1 114 ASP QB   . 114 . HB*  1 1 
       1058 1 1 1 1 113 TYR QB   . 113 . HB*  1 1 
       1058 1 2 1 1 114 ASP H    . 114 . HN   1 1 
       1059 1 1 1 1 114 ASP H    . 114 . HN   1 1 
       1059 1 2 1 1 114 ASP QB   . 114 . HB*  1 1 
       1060 1 1 1 1 114 ASP QB   . 114 . HB*  1 1 
       1060 1 2 1 1 115 ALA H    . 115 . HN   1 1 
       1061 1 1 1 1 116 LEU H    . 116 . HN   1 1 
       1061 1 2 1 1 116 LEU QB   . 116 . HB*  1 1 
       1062 1 1 1 1 116 LEU HA   . 116 . HA   1 1 
       1062 1 2 1 1 119 TRP QB   . 119 . HB*  1 1 
       1063 1 1 1 1 118 LYS HA   . 118 . HA   1 1 
       1063 1 2 1 1 121 ASP QB   . 121 . HB*  1 1 
       1064 1 1 1 1 118 LYS QG   . 118 . HG*  1 1 
       1064 1 2 1 1 119 TRP H    . 119 . HN   1 1 
       1065 1 1 1 1 118 LYS QG   . 118 . HG*  1 1 
       1065 1 2 1 1 121 ASP QB   . 121 . HB*  1 1 
       1066 1 1 1 1 119 TRP HA   . 119 . HA   1 1 
       1066 1 2 1 1 122 ASP QB   . 122 . HB*  1 1 
       1067 1 1 1 1 121 ASP QB   . 121 . HB*  1 1 
       1067 1 2 1 1 122 ASP H    . 122 . HN   1 1 
       1068 1 1 1 1 122 ASP H    . 122 . HN   1 1 
       1068 1 2 1 1 122 ASP QB   . 122 . HB*  1 1 
       1069 1 1 1 1 122 ASP QB   . 122 . HB*  1 1 
       1069 1 2 1 1 123 ASN H    . 123 . HN   1 1 
       1070 1 1 1 1 123 ASN H    . 123 . HN   1 1 
       1070 1 2 1 1 123 ASN QB   . 123 . HB*  1 1 
       1071 1 1 1 1 125 PHE HB3  . 125 . HB1  1 1 
       1071 1 2 1 1 155 LEU QB   . 155 . HB*  1 1 
       1072 1 1 1 1 125 PHE QD   . 125 . HD*  1 1 
       1072 1 2 1 1 155 LEU QB   . 155 . HB*  1 1 
       1073 1 1 1 1 132 TYR QD   . 132 . HD*  1 1 
       1073 1 2 1 1 152 SER QB   . 152 . HB*  1 1 
       1074 1 1 1 1 136 LEU QD   . 136 . HD*  1 1 
       1074 1 2 1 1 137 ASP H    . 137 . HN   1 1 
       1075 1 1 1 1 136 LEU QD   . 136 . HD*  1 1 
       1075 1 2 1 1 149 THR HA   . 149 . HA   1 1 
       1076 1 1 1 1 138 ASN H    . 138 . HN   1 1 
       1076 1 2 1 1 138 ASN QB   . 138 . HB*  1 1 
       1077 1 1 1 1 138 ASN QB   . 138 . HB*  1 1 
       1077 1 2 1 1 141 GLU QG   . 141 . HG*  1 1 
       1078 1 1 1 1 140 ALA MB   . 140 . HB*  1 1 
       1078 1 2 1 1 141 GLU QG   . 141 . HG*  1 1 
       1079 1 1 1 1 141 GLU H    . 141 . HN   1 1 
       1079 1 2 1 1 141 GLU QB   . 141 . HB*  1 1 
       1080 1 1 1 1 141 GLU QB   . 141 . HB*  1 1 
       1080 1 2 1 1 142 THR H    . 142 . HN   1 1 
       1081 1 1 1 1 142 THR MG   . 142 . HG2* 1 1 
       1081 1 2 1 1 146 GLN QB   . 146 . HB*  1 1 
       1082 1 1 1 1 143 ALA MB   . 143 . HB*  1 1 
       1082 1 2 1 1 146 GLN QB   . 146 . HB*  1 1 
       1083 1 1 1 1 143 ALA MB   . 143 . HB*  1 1 
       1083 1 2 1 1 146 GLN QG   . 146 . HG*  1 1 
       1084 1 1 1 1 144 PRO HA   . 144 . HA   1 1 
       1084 1 2 1 1 147 LEU QB   . 147 . HB*  1 1 
       1085 1 1 1 1 144 PRO QB   . 144 . HB*  1 1 
       1085 1 2 1 1 145 ASP H    . 145 . HN   1 1 
       1086 1 1 1 1 145 ASP H    . 145 . HN   1 1 
       1086 1 2 1 1 145 ASP QB   . 145 . HB*  1 1 
       1087 1 1 1 1 146 GLN H    . 146 . HN   1 1 
       1087 1 2 1 1 146 GLN QB   . 146 . HB*  1 1 
       1088 1 1 1 1 146 GLN H    . 146 . HN   1 1 
       1088 1 2 1 1 147 LEU QB   . 147 . HB*  1 1 
       1089 1 1 1 1 147 LEU H    . 147 . HN   1 1 
       1089 1 2 1 1 147 LEU QB   . 147 . HB*  1 1 
       1090 1 1 1 1 153 LEU H    . 153 . HN   1 1 
       1090 1 2 1 1 153 LEU QB   . 153 . HB*  1 1 
       1091 1 1 1 1 153 LEU QB   . 153 . HB*  1 1 
       1091 1 2 1 1 155 LEU MD2  . 155 . HD2* 1 1 
       1092 1 1 1 1 154 MET QB   . 154 . HB*  1 1 
       1092 1 2 1 1 159 LEU H    . 159 . HN   1 1 
       1093 1 1 1 1 154 MET QB   . 154 . HB*  1 1 
       1093 1 2 1 1 159 LEU QD   . 159 . HD*  1 1 
       1094 1 1 1 1 155 LEU QB   . 155 . HB*  1 1 
       1094 1 2 1 1 156 HIS H    . 156 . HN   1 1 
       1095 1 1 1 1 156 HIS H    . 156 . HN   1 1 
       1095 1 2 1 1 156 HIS QB   . 156 . HB*  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . .  5.5 0.0  5.5 1 1 
          2 1 . . . . . 3.52 0.0 3.52 1 1 
          3 1 . . . . . 3.45 0.0 3.45 1 1 
          4 1 . . . . . 3.11 0.0 3.11 1 1 
          5 1 . . . . . 4.48 0.0 4.48 1 1 
          6 1 . . . . . 4.48 0.0 4.48 1 1 
          7 1 . . . . . 3.02 0.0 3.02 1 1 
          8 1 . . . . .  5.5 0.0  5.5 1 1 
          9 1 . . . . . 3.21 0.0 3.21 1 1 
         10 1 . . . . . 5.13 0.0 5.13 1 1 
         11 1 . . . . . 3.17 0.0 3.17 1 1 
         12 1 . . . . . 4.48 0.0 4.48 1 1 
         13 1 . . . . . 4.48 0.0 4.48 1 1 
         14 1 . . . . . 4.72 0.0 4.72 1 1 
         15 1 . . . . . 3.24 0.0 3.24 1 1 
         16 1 . . . . . 4.07 0.0 4.07 1 1 
         17 1 . . . . . 4.07 0.0 4.07 1 1 
         18 1 . . . . . 2.86 0.0 2.86 1 1 
         19 1 . . . . . 4.35 0.0 4.35 1 1 
         20 1 . . . . .  5.0 0.0  5.0 1 1 
         21 1 . . . . . 5.41 0.0 5.41 1 1 
         22 1 . . . . . 3.21 0.0 3.21 1 1 
         23 1 . . . . . 4.48 0.0 4.48 1 1 
         24 1 . . . . . 4.48 0.0 4.48 1 1 
         25 1 . . . . . 3.05 0.0 3.05 1 1 
         26 1 . . . . . 4.66 0.0 4.66 1 1 
         27 1 . . . . . 4.66 0.0 4.66 1 1 
         28 1 . . . . . 3.14 0.0 3.14 1 1 
         29 1 . . . . . 2.93 0.0 2.93 1 1 
         30 1 . . . . . 4.29 0.0 4.29 1 1 
         31 1 . . . . . 3.02 0.0 3.02 1 1 
         32 1 . . . . . 3.11 0.0 3.11 1 1 
         33 1 . . . . .  4.6 0.0  4.6 1 1 
         34 1 . . . . .  4.6 0.0  4.6 1 1 
         35 1 . . . . . 2.99 0.0 2.99 1 1 
         36 1 . . . . . 4.66 0.0 4.66 1 1 
         37 1 . . . . . 3.02 0.0 3.02 1 1 
         38 1 . . . . . 5.38 0.0 5.38 1 1 
         39 1 . . . . . 5.38 0.0 5.38 1 1 
         40 1 . . . . .  2.9 0.0  2.9 1 1 
         41 1 . . . . . 4.29 0.0 4.29 1 1 
         42 1 . . . . . 3.08 0.0 3.08 1 1 
         43 1 . . . . . 3.42 0.0 3.42 1 1 
         44 1 . . . . . 4.63 0.0 4.63 1 1 
         45 1 . . . . . 3.48 0.0 3.48 1 1 
         46 1 . . . . . 4.26 0.0 4.26 1 1 
         47 1 . . . . . 4.66 0.0 4.66 1 1 
         48 1 . . . . . 4.66 0.0 4.66 1 1 
         49 1 . . . . . 4.38 0.0 4.38 1 1 
         50 1 . . . . . 4.38 0.0 4.38 1 1 
         51 1 . . . . . 4.04 0.0 4.04 1 1 
         52 1 . . . . . 4.14 0.0 4.14 1 1 
         53 1 . . . . . 3.73 0.0 3.73 1 1 
         54 1 . . . . . 4.72 0.0 4.72 1 1 
         55 1 . . . . . 4.72 0.0 4.72 1 1 
         56 1 . . . . . 3.45 0.0 3.45 1 1 
         57 1 . . . . . 3.95 0.0 3.95 1 1 
         58 1 . . . . .  5.1 0.0  5.1 1 1 
         59 1 . . . . .  5.1 0.0  5.1 1 1 
         60 1 . . . . . 3.42 0.0 3.42 1 1 
         61 1 . . . . .  3.3 0.0  3.3 1 1 
         62 1 . . . . . 4.04 0.0 4.04 1 1 
         63 1 . . . . . 3.27 0.0 3.27 1 1 
         64 1 . . . . . 3.27 0.0 3.27 1 1 
         65 1 . . . . . 2.93 0.0 2.93 1 1 
         66 1 . . . . . 3.64 0.0 3.64 1 1 
         67 1 . . . . . 3.64 0.0 3.64 1 1 
         68 1 . . . . . 3.21 0.0 3.21 1 1 
         69 1 . . . . . 4.07 0.0 4.07 1 1 
         70 1 . . . . . 3.27 0.0 3.27 1 1 
         71 1 . . . . .  3.3 0.0  3.3 1 1 
         72 1 . . . . . 4.85 0.0 4.85 1 1 
         73 1 . . . . . 3.39 0.0 3.39 1 1 
         74 1 . . . . . 3.42 0.0 3.42 1 1 
         75 1 . . . . . 3.42 0.0 3.42 1 1 
         76 1 . . . . . 4.11 0.0 4.11 1 1 
         77 1 . . . . . 5.25 0.0 5.25 1 1 
         78 1 . . . . . 3.52 0.0 3.52 1 1 
         79 1 . . . . . 4.32 0.0 4.32 1 1 
         80 1 . . . . . 5.47 0.0 5.47 1 1 
         81 1 . . . . . 3.17 0.0 3.17 1 1 
         82 1 . . . . . 5.19 0.0 5.19 1 1 
         83 1 . . . . . 3.17 0.0 3.17 1 1 
         84 1 . . . . . 3.52 0.0 3.52 1 1 
         85 1 . . . . . 3.02 0.0 3.02 1 1 
         86 1 . . . . . 4.63 0.0 4.63 1 1 
         87 1 . . . . . 4.63 0.0 4.63 1 1 
         88 1 . . . . . 3.24 0.0 3.24 1 1 
         89 1 . . . . . 3.76 0.0 3.76 1 1 
         90 1 . . . . .  2.8 0.0  2.8 1 1 
         91 1 . . . . . 4.51 0.0 4.51 1 1 
         92 1 . . . . . 2.86 0.0 2.86 1 1 
         93 1 . . . . . 4.82 0.0 4.82 1 1 
         94 1 . . . . . 3.48 0.0 3.48 1 1 
         95 1 . . . . . 3.52 0.0 3.52 1 1 
         96 1 . . . . . 5.38 0.0 5.38 1 1 
         97 1 . . . . . 3.05 0.0 3.05 1 1 
         98 1 . . . . . 3.02 0.0 3.02 1 1 
         99 1 . . . . . 3.42 0.0 3.42 1 1 
        100 1 . . . . . 3.27 0.0 3.27 1 1 
        101 1 . . . . . 3.27 0.0 3.27 1 1 
        102 1 . . . . . 2.96 0.0 2.96 1 1 
        103 1 . . . . .  5.5 0.0  5.5 1 1 
        104 1 . . . . . 2.83 0.0 2.83 1 1 
        105 1 . . . . . 3.98 0.0 3.98 1 1 
        106 1 . . . . . 3.98 0.0 3.98 1 1 
        107 1 . . . . . 3.42 0.0 3.42 1 1 
        108 1 . . . . . 4.26 0.0 4.26 1 1 
        109 1 . . . . . 4.26 0.0 4.26 1 1 
        110 1 . . . . . 3.45 0.0 3.45 1 1 
        111 1 . . . . . 4.63 0.0 4.63 1 1 
        112 1 . . . . . 3.24 0.0 3.24 1 1 
        113 1 . . . . . 4.72 0.0 4.72 1 1 
        114 1 . . . . . 4.72 0.0 4.72 1 1 
        115 1 . . . . . 3.33 0.0 3.33 1 1 
        116 1 . . . . . 3.24 0.0 3.24 1 1 
        117 1 . . . . . 3.11 0.0 3.11 1 1 
        118 1 . . . . . 3.45 0.0 3.45 1 1 
        119 1 . . . . . 3.48 0.0 3.48 1 1 
        120 1 . . . . . 3.21 0.0 3.21 1 1 
        121 1 . . . . . 3.39 0.0 3.39 1 1 
        122 1 . . . . . 5.28 0.0 5.28 1 1 
        123 1 . . . . . 5.28 0.0 5.28 1 1 
        124 1 . . . . . 3.64 0.0 3.64 1 1 
        125 1 . . . . . 3.79 0.0 3.79 1 1 
        126 1 . . . . . 4.66 0.0 4.66 1 1 
        127 1 . . . . . 4.66 0.0 4.66 1 1 
        128 1 . . . . . 3.86 0.0 3.86 1 1 
        129 1 . . . . . 4.04 0.0 4.04 1 1 
        130 1 . . . . . 4.04 0.0 4.04 1 1 
        131 1 . . . . . 3.83 0.0 3.83 1 1 
        132 1 . . . . . 3.86 0.0 3.86 1 1 
        133 1 . . . . . 3.73 0.0 3.73 1 1 
        134 1 . . . . . 3.67 0.0 3.67 1 1 
        135 1 . . . . . 4.35 0.0 4.35 1 1 
        136 1 . . . . . 4.35 0.0 4.35 1 1 
        137 1 . . . . . 3.48 0.0 3.48 1 1 
        138 1 . . . . . 4.76 0.0 4.76 1 1 
        139 1 . . . . . 3.27 0.0 3.27 1 1 
        140 1 . . . . . 3.83 0.0 3.83 1 1 
        141 1 . . . . . 3.17 0.0 3.17 1 1 
        142 1 . . . . . 5.04 0.0 5.04 1 1 
        143 1 . . . . . 5.04 0.0 5.04 1 1 
        144 1 . . . . . 3.24 0.0 3.24 1 1 
        145 1 . . . . . 5.16 0.0 5.16 1 1 
        146 1 . . . . . 4.29 0.0 4.29 1 1 
        147 1 . . . . . 3.39 0.0 3.39 1 1 
        148 1 . . . . . 3.27 0.0 3.27 1 1 
        149 1 . . . . . 3.11 0.0 3.11 1 1 
        150 1 . . . . . 3.21 0.0 3.21 1 1 
        151 1 . . . . . 4.79 0.0 4.79 1 1 
        152 1 . . . . . 4.79 0.0 4.79 1 1 
        153 1 . . . . . 5.28 0.0 5.28 1 1 
        154 1 . . . . . 3.45 0.0 3.45 1 1 
        155 1 . . . . . 3.11 0.0 3.11 1 1 
        156 1 . . . . . 4.23 0.0 4.23 1 1 
        157 1 . . . . . 4.23 0.0 4.23 1 1 
        158 1 . . . . . 3.48 0.0 3.48 1 1 
        159 1 . . . . . 5.19 0.0 5.19 1 1 
        160 1 . . . . .  4.2 0.0  4.2 1 1 
        161 1 . . . . . 3.36 0.0 3.36 1 1 
        162 1 . . . . . 3.27 0.0 3.27 1 1 
        163 1 . . . . . 3.52 0.0 3.52 1 1 
        164 1 . . . . . 3.08 0.0 3.08 1 1 
        165 1 . . . . . 3.52 0.0 3.52 1 1 
        166 1 . . . . . 5.07 0.0 5.07 1 1 
        167 1 . . . . . 5.07 0.0 5.07 1 1 
        168 1 . . . . . 5.44 0.0 5.44 1 1 
        169 1 . . . . . 4.38 0.0 4.38 1 1 
        170 1 . . . . . 4.38 0.0 4.38 1 1 
        171 1 . . . . .  5.5 0.0  5.5 1 1 
        172 1 . . . . . 4.29 0.0 4.29 1 1 
        173 1 . . . . . 2.86 0.0 2.86 1 1 
        174 1 . . . . . 3.95 0.0 3.95 1 1 
        175 1 . . . . . 3.95 0.0 3.95 1 1 
        176 1 . . . . . 3.95 0.0 3.95 1 1 
        177 1 . . . . . 3.45 0.0 3.45 1 1 
        178 1 . . . . . 4.01 0.0 4.01 1 1 
        179 1 . . . . . 4.01 0.0 4.01 1 1 
        180 1 . . . . . 3.79 0.0 3.79 1 1 
        181 1 . . . . . 3.79 0.0 3.79 1 1 
        182 1 . . . . . 3.79 0.0 3.79 1 1 
        183 1 . . . . . 3.95 0.0 3.95 1 1 
        184 1 . . . . . 3.95 0.0 3.95 1 1 
        185 1 . . . . . 3.52 0.0 3.52 1 1 
        186 1 . . . . . 3.92 0.0 3.92 1 1 
        187 1 . . . . . 3.64 0.0 3.64 1 1 
        188 1 . . . . . 3.73 0.0 3.73 1 1 
        189 1 . . . . . 3.73 0.0 3.73 1 1 
        190 1 . . . . . 3.33 0.0 3.33 1 1 
        191 1 . . . . . 3.79 0.0 3.79 1 1 
        192 1 . . . . . 3.83 0.0 3.83 1 1 
        193 1 . . . . . 3.83 0.0 3.83 1 1 
        194 1 . . . . . 3.98 0.0 3.98 1 1 
        195 1 . . . . . 3.98 0.0 3.98 1 1 
        196 1 . . . . . 3.98 0.0 3.98 1 1 
        197 1 . . . . . 3.98 0.0 3.98 1 1 
        198 1 . . . . . 4.04 0.0 4.04 1 1 
        199 1 . . . . . 4.04 0.0 4.04 1 1 
        200 1 . . . . . 3.48 0.0 3.48 1 1 
        201 1 . . . . . 3.11 0.0 3.11 1 1 
        202 1 . . . . . 3.33 0.0 3.33 1 1 
        203 1 . . . . . 3.95 0.0 3.95 1 1 
        204 1 . . . . . 3.67 0.0 3.67 1 1 
        205 1 . . . . . 3.67 0.0 3.67 1 1 
        206 1 . . . . . 3.24 0.0 3.24 1 1 
        207 1 . . . . . 3.61 0.0 3.61 1 1 
        208 1 . . . . . 3.61 0.0 3.61 1 1 
        209 1 . . . . . 3.89 0.0 3.89 1 1 
        210 1 . . . . . 3.89 0.0 3.89 1 1 
        211 1 . . . . . 4.07 0.0 4.07 1 1 
        212 1 . . . . . 4.07 0.0 4.07 1 1 
        213 1 . . . . . 3.42 0.0 3.42 1 1 
        214 1 . . . . . 3.24 0.0 3.24 1 1 
        215 1 . . . . . 3.42 0.0 3.42 1 1 
        216 1 . . . . . 3.42 0.0 3.42 1 1 
        217 1 . . . . . 3.48 0.0 3.48 1 1 
        218 1 . . . . . 3.48 0.0 3.48 1 1 
        219 1 . . . . . 4.17 0.0 4.17 1 1 
        220 1 . . . . . 4.17 0.0 4.17 1 1 
        221 1 . . . . . 4.01 0.0 4.01 1 1 
        222 1 . . . . . 3.48 0.0 3.48 1 1 
        223 1 . . . . .  3.3 0.0  3.3 1 1 
        224 1 . . . . . 3.95 0.0 3.95 1 1 
        225 1 . . . . . 3.89 0.0 3.89 1 1 
        226 1 . . . . . 3.95 0.0 3.95 1 1 
        227 1 . . . . . 3.86 0.0 3.86 1 1 
        228 1 . . . . . 3.86 0.0 3.86 1 1 
        229 1 . . . . .  3.3 0.0  3.3 1 1 
        230 1 . . . . . 3.79 0.0 3.79 1 1 
        231 1 . . . . . 3.79 0.0 3.79 1 1 
        232 1 . . . . . 4.14 0.0 4.14 1 1 
        233 1 . . . . . 4.14 0.0 4.14 1 1 
        234 1 . . . . . 3.92 0.0 3.92 1 1 
        235 1 . . . . . 3.92 0.0 3.92 1 1 
        236 1 . . . . . 3.73 0.0 3.73 1 1 
        237 1 . . . . . 4.04 0.0 4.04 1 1 
        238 1 . . . . . 4.04 0.0 4.04 1 1 
        239 1 . . . . . 3.73 0.0 3.73 1 1 
        240 1 . . . . . 3.73 0.0 3.73 1 1 
        241 1 . . . . .  2.8 0.0  2.8 1 1 
        242 1 . . . . . 4.11 0.0 4.11 1 1 
        243 1 . . . . . 4.88 0.0 4.88 1 1 
        244 1 . . . . . 4.54 0.0 4.54 1 1 
        245 1 . . . . . 4.72 0.0 4.72 1 1 
        246 1 . . . . . 5.16 0.0 5.16 1 1 
        247 1 . . . . . 3.86 0.0 3.86 1 1 
        248 1 . . . . . 3.52 0.0 3.52 1 1 
        249 1 . . . . . 3.86 0.0 3.86 1 1 
        250 1 . . . . . 3.61 0.0 3.61 1 1 
        251 1 . . . . . 3.42 0.0 3.42 1 1 
        252 1 . . . . . 3.79 0.0 3.79 1 1 
        253 1 . . . . . 3.67 0.0 3.67 1 1 
        254 1 . . . . . 2.99 0.0 2.99 1 1 
        255 1 . . . . . 3.58 0.0 3.58 1 1 
        256 1 . . . . . 5.04 0.0 5.04 1 1 
        257 1 . . . . . 5.07 0.0 5.07 1 1 
        258 1 . . . . . 3.86 0.0 3.86 1 1 
        259 1 . . . . .  5.5 0.0  5.5 1 1 
        260 1 . . . . . 3.73 0.0 3.73 1 1 
        261 1 . . . . . 4.66 0.0 4.66 1 1 
        262 1 . . . . . 4.04 0.0 4.04 1 1 
        263 1 . . . . . 4.76 0.0 4.76 1 1 
        264 1 . . . . . 5.31 0.0 5.31 1 1 
        265 1 . . . . . 4.57 0.0 4.57 1 1 
        266 1 . . . . . 3.76 0.0 3.76 1 1 
        267 1 . . . . . 3.79 0.0 3.79 1 1 
        268 1 . . . . . 3.33 0.0 3.33 1 1 
        269 1 . . . . . 3.73 0.0 3.73 1 1 
        270 1 . . . . . 4.51 0.0 4.51 1 1 
        271 1 . . . . . 3.61 0.0 3.61 1 1 
        272 1 . . . . . 3.21 0.0 3.21 1 1 
        273 1 . . . . . 4.11 0.0 4.11 1 1 
        274 1 . . . . .  3.7 0.0  3.7 1 1 
        275 1 . . . . . 2.83 0.0 2.83 1 1 
        276 1 . . . . . 3.14 0.0 3.14 1 1 
        277 1 . . . . . 3.02 0.0 3.02 1 1 
        278 1 . . . . . 4.48 0.0 4.48 1 1 
        279 1 . . . . .  4.2 0.0  4.2 1 1 
        280 1 . . . . .  4.2 0.0  4.2 1 1 
        281 1 . . . . . 4.57 0.0 4.57 1 1 
        282 1 . . . . . 3.92 0.0 3.92 1 1 
        283 1 . . . . . 3.92 0.0 3.92 1 1 
        284 1 . . . . . 3.95 0.0 3.95 1 1 
        285 1 . . . . . 4.85 0.0 4.85 1 1 
        286 1 . . . . . 3.95 0.0 3.95 1 1 
        287 1 . . . . . 3.95 0.0 3.95 1 1 
        288 1 . . . . . 4.29 0.0 4.29 1 1 
        289 1 . . . . . 4.17 0.0 4.17 1 1 
        290 1 . . . . . 4.23 0.0 4.23 1 1 
        291 1 . . . . . 3.98 0.0 3.98 1 1 
        292 1 . . . . . 4.42 0.0 4.42 1 1 
        293 1 . . . . . 3.95 0.0 3.95 1 1 
        294 1 . . . . . 4.38 0.0 4.38 1 1 
        295 1 . . . . . 4.94 0.0 4.94 1 1 
        296 1 . . . . . 4.51 0.0 4.51 1 1 
        297 1 . . . . . 4.17 0.0 4.17 1 1 
        298 1 . . . . .  3.7 0.0  3.7 1 1 
        299 1 . . . . .  5.5 0.0  5.5 1 1 
        300 1 . . . . . 3.73 0.0 3.73 1 1 
        301 1 . . . . .  3.7 0.0  3.7 1 1 
        302 1 . . . . . 4.07 0.0 4.07 1 1 
        303 1 . . . . . 4.29 0.0 4.29 1 1 
        304 1 . . . . . 3.52 0.0 3.52 1 1 
        305 1 . . . . . 4.11 0.0 4.11 1 1 
        306 1 . . . . . 4.85 0.0 4.85 1 1 
        307 1 . . . . . 3.73 0.0 3.73 1 1 
        308 1 . . . . . 5.04 0.0 5.04 1 1 
        309 1 . . . . . 4.88 0.0 4.88 1 1 
        310 1 . . . . . 4.26 0.0 4.26 1 1 
        311 1 . . . . . 4.42 0.0 4.42 1 1 
        312 1 . . . . . 4.48 0.0 4.48 1 1 
        313 1 . . . . . 4.26 0.0 4.26 1 1 
        314 1 . . . . . 4.91 0.0 4.91 1 1 
        315 1 . . . . . 4.76 0.0 4.76 1 1 
        316 1 . . . . . 4.57 0.0 4.57 1 1 
        317 1 . . . . . 4.63 0.0 4.63 1 1 
        318 1 . . . . .  5.5 0.0  5.5 1 1 
        319 1 . . . . . 5.13 0.0 5.13 1 1 
        320 1 . . . . . 3.76 0.0 3.76 1 1 
        321 1 . . . . . 4.69 0.0 4.69 1 1 
        322 1 . . . . .  3.7 0.0  3.7 1 1 
        323 1 . . . . . 3.58 0.0 3.58 1 1 
        324 1 . . . . .  5.5 0.0  5.5 1 1 
        325 1 . . . . .  5.5 0.0  5.5 1 1 
        326 1 . . . . .  5.5 0.0  5.5 1 1 
        327 1 . . . . .  5.5 0.0  5.5 1 1 
        328 1 . . . . .  5.5 0.0  5.5 1 1 
        329 1 . . . . .  5.5 0.0  5.5 1 1 
        330 1 . . . . .  5.5 0.0  5.5 1 1 
        331 1 . . . . . 7.63 0.0 7.63 1 1 
        332 1 . . . . .  5.5 0.0  5.5 1 1 
        333 1 . . . . .  5.5 0.0  5.5 1 1 
        334 1 . . . . .  5.5 0.0  5.5 1 1 
        335 1 . . . . .  5.5 0.0  5.5 1 1 
        336 1 . . . . .  5.5 0.0  5.5 1 1 
        337 1 . . . . .  5.5 0.0  5.5 1 1 
        338 1 . . . . .  5.5 0.0  5.5 1 1 
        339 1 . . . . .  5.5 0.0  5.5 1 1 
        340 1 . . . . .  5.5 0.0  5.5 1 1 
        341 1 . . . . .  5.5 0.0  5.5 1 1 
        342 1 . . . . .  5.5 0.0  5.5 1 1 
        343 1 . . . . .  5.5 0.0  5.5 1 1 
        344 1 . . . . .  5.5 0.0  5.5 1 1 
        345 1 . . . . .  5.5 0.0  5.5 1 1 
        346 1 . . . . .  5.5 0.0  5.5 1 1 
        347 1 . . . . .  5.5 0.0  5.5 1 1 
        348 1 . . . . .  5.5 0.0  5.5 1 1 
        349 1 . . . . .  5.5 0.0  5.5 1 1 
        350 1 . . . . .  5.5 0.0  5.5 1 1 
        351 1 . . . . .  5.5 0.0  5.5 1 1 
        352 1 . . . . .  5.5 0.0  5.5 1 1 
        353 1 . . . . .  5.5 0.0  5.5 1 1 
        354 1 . . . . .  5.5 0.0  5.5 1 1 
        355 1 . . . . .  5.5 0.0  5.5 1 1 
        356 1 . . . . .  5.5 0.0  5.5 1 1 
        357 1 . . . . .  5.5 0.0  5.5 1 1 
        358 1 . . . . .  5.5 0.0  5.5 1 1 
        359 1 . . . . .  5.5 0.0  5.5 1 1 
        360 1 . . . . .  5.5 0.0  5.5 1 1 
        361 1 . . . . .  5.5 0.0  5.5 1 1 
        362 1 . . . . .  5.5 0.0  5.5 1 1 
        363 1 . . . . .  5.5 0.0  5.5 1 1 
        364 1 . . . . .  5.5 0.0  5.5 1 1 
        365 1 . . . . .  5.5 0.0  5.5 1 1 
        366 1 . . . . . 7.63 0.0 7.63 1 1 
        367 1 . . . . .  5.5 0.0  5.5 1 1 
        368 1 . . . . . 7.23 0.0 7.23 1 1 
        369 1 . . . . . 7.23 0.0 7.23 1 1 
        370 1 . . . . . 7.23 0.0 7.23 1 1 
        371 1 . . . . .  5.5 0.0  5.5 1 1 
        372 1 . . . . .  5.5 0.0  5.5 1 1 
        373 1 . . . . .  5.5 0.0  5.5 1 1 
        374 1 . . . . .  5.5 0.0  5.5 1 1 
        375 1 . . . . .  5.5 0.0  5.5 1 1 
        376 1 . . . . . 6.52 0.0 6.52 1 1 
        377 1 . . . . . 6.52 0.0 6.52 1 1 
        378 1 . . . . . 6.52 0.0 6.52 1 1 
        379 1 . . . . . 6.52 0.0 6.52 1 1 
        380 1 . . . . . 6.52 0.0 6.52 1 1 
        381 1 . . . . . 6.49 0.0 6.49 1 1 
        382 1 . . . . . 6.52 0.0 6.52 1 1 
        383 1 . . . . . 6.05 0.0 6.05 1 1 
        384 1 . . . . . 6.52 0.0 6.52 1 1 
        385 1 . . . . . 6.52 0.0 6.52 1 1 
        386 1 . . . . . 6.18 0.0 6.18 1 1 
        387 1 . . . . . 6.52 0.0 6.52 1 1 
        388 1 . . . . . 6.52 0.0 6.52 1 1 
        389 1 . . . . . 6.52 0.0 6.52 1 1 
        390 1 . . . . . 6.52 0.0 6.52 1 1 
        391 1 . . . . . 6.52 0.0 6.52 1 1 
        392 1 . . . . . 6.52 0.0 6.52 1 1 
        393 1 . . . . . 6.52 0.0 6.52 1 1 
        394 1 . . . . . 6.52 0.0 6.52 1 1 
        395 1 . . . . . 6.52 0.0 6.52 1 1 
        396 1 . . . . . 6.52 0.0 6.52 1 1 
        397 1 . . . . . 6.52 0.0 6.52 1 1 
        398 1 . . . . . 6.52 0.0 6.52 1 1 
        399 1 . . . . . 6.52 0.0 6.52 1 1 
        400 1 . . . . . 6.52 0.0 6.52 1 1 
        401 1 . . . . . 6.52 0.0 6.52 1 1 
        402 1 . . . . . 6.52 0.0 6.52 1 1 
        403 1 . . . . . 6.52 0.0 6.52 1 1 
        404 1 . . . . . 6.52 0.0 6.52 1 1 
        405 1 . . . . . 6.52 0.0 6.52 1 1 
        406 1 . . . . . 6.52 0.0 6.52 1 1 
        407 1 . . . . . 6.33 0.0 6.33 1 1 
        408 1 . . . . . 6.52 0.0 6.52 1 1 
        409 1 . . . . . 6.52 0.0 6.52 1 1 
        410 1 . . . . . 6.52 0.0 6.52 1 1 
        411 1 . . . . . 8.25 0.0 8.25 1 1 
        412 1 . . . . . 6.52 0.0 6.52 1 1 
        413 1 . . . . . 3.95 0.0 3.95 1 1 
        414 1 . . . . . 3.24 0.0 3.24 1 1 
        415 1 . . . . . 3.39 0.0 3.39 1 1 
        416 1 . . . . . 3.86 0.0 3.86 1 1 
        417 1 . . . . . 3.86 0.0 3.86 1 1 
        418 1 . . . . . 3.52 0.0 3.52 1 1 
        419 1 . . . . . 3.92 0.0 3.92 1 1 
        420 1 . . . . . 3.64 0.0 3.64 1 1 
        421 1 . . . . . 3.61 0.0 3.61 1 1 
        422 1 . . . . . 3.42 0.0 3.42 1 1 
        423 1 . . . . . 4.01 0.0 4.01 1 1 
        424 1 . . . . . 4.01 0.0 4.01 1 1 
        425 1 . . . . . 3.45 0.0 3.45 1 1 
        426 1 . . . . . 3.95 0.0 3.95 1 1 
        427 1 . . . . .  5.5 0.0  5.5 1 1 
        428 1 . . . . .  4.6 0.0  4.6 1 1 
        429 1 . . . . .  4.6 0.0  4.6 1 1 
        430 1 . . . . . 4.14 0.0 4.14 1 1 
        431 1 . . . . . 4.14 0.0 4.14 1 1 
        432 1 . . . . . 4.45 0.0 4.45 1 1 
        433 1 . . . . . 4.45 0.0 4.45 1 1 
        434 1 . . . . . 4.07 0.0 4.07 1 1 
        435 1 . . . . . 4.85 0.0 4.85 1 1 
        436 1 . . . . . 4.32 0.0 4.32 1 1 
        437 1 . . . . . 3.36 0.0 3.36 1 1 
        438 1 . . . . . 4.26 0.0 4.26 1 1 
        439 1 . . . . . 4.26 0.0 4.26 1 1 
        440 1 . . . . . 3.52 0.0 3.52 1 1 
        441 1 . . . . . 4.23 0.0 4.23 1 1 
        442 1 . . . . . 4.23 0.0 4.23 1 1 
        443 1 . . . . .  5.5 0.0  5.5 1 1 
        444 1 . . . . . 3.45 0.0 3.45 1 1 
        445 1 . . . . . 4.91 0.0 4.91 1 1 
        446 1 . . . . . 4.91 0.0 4.91 1 1 
        447 1 . . . . . 4.38 0.0 4.38 1 1 
        448 1 . . . . . 4.85 0.0 4.85 1 1 
        449 1 . . . . . 4.76 0.0 4.76 1 1 
        450 1 . . . . . 4.51 0.0 4.51 1 1 
        451 1 . . . . . 5.28 0.0 5.28 1 1 
        452 1 . . . . .  4.2 0.0  4.2 1 1 
        453 1 . . . . .  5.5 0.0  5.5 1 1 
        454 1 . . . . .  5.5 0.0  5.5 1 1 
        455 1 . . . . .  5.5 0.0  5.5 1 1 
        456 1 . . . . .  5.5 0.0  5.5 1 1 
        457 1 . . . . . 4.63 0.0 4.63 1 1 
        458 1 . . . . . 4.63 0.0 4.63 1 1 
        459 1 . . . . .  5.5 0.0  5.5 1 1 
        460 1 . . . . .  5.5 0.0  5.5 1 1 
        461 1 . . . . .  5.5 0.0  5.5 1 1 
        462 1 . . . . .  5.5 0.0  5.5 1 1 
        463 1 . . . . .  5.5 0.0  5.5 1 1 
        464 1 . . . . .  5.5 0.0  5.5 1 1 
        465 1 . . . . .  5.5 0.0  5.5 1 1 
        466 1 . . . . . 4.69 0.0 4.69 1 1 
        467 1 . . . . .  5.5 0.0  5.5 1 1 
        468 1 . . . . .  5.5 0.0  5.5 1 1 
        469 1 . . . . . 3.76 0.0 3.76 1 1 
        470 1 . . . . . 3.76 0.0 3.76 1 1 
        471 1 . . . . . 4.45 0.0 4.45 1 1 
        472 1 . . . . . 4.45 0.0 4.45 1 1 
        473 1 . . . . .  5.5 0.0  5.5 1 1 
        474 1 . . . . .  5.5 0.0  5.5 1 1 
        475 1 . . . . .  5.5 0.0  5.5 1 1 
        476 1 . . . . .  5.5 0.0  5.5 1 1 
        477 1 . . . . .  5.5 0.0  5.5 1 1 
        478 1 . . . . .  5.5 0.0  5.5 1 1 
        479 1 . . . . .  5.5 0.0  5.5 1 1 
        480 1 . . . . .  5.5 0.0  5.5 1 1 
        481 1 . . . . .  5.5 0.0  5.5 1 1 
        482 1 . . . . .  5.5 0.0  5.5 1 1 
        483 1 . . . . .  5.5 0.0  5.5 1 1 
        484 1 . . . . .  5.5 0.0  5.5 1 1 
        485 1 . . . . .  5.5 0.0  5.5 1 1 
        486 1 . . . . .  5.5 0.0  5.5 1 1 
        487 1 . . . . .  5.5 0.0  5.5 1 1 
        488 1 . . . . .  5.5 0.0  5.5 1 1 
        489 1 . . . . .  5.5 0.0  5.5 1 1 
        490 1 . . . . .  5.5 0.0  5.5 1 1 
        491 1 . . . . .  5.5 0.0  5.5 1 1 
        492 1 . . . . . 5.22 0.0 5.22 1 1 
        493 1 . . . . .  5.5 0.0  5.5 1 1 
        494 1 . . . . .  5.5 0.0  5.5 1 1 
        495 1 . . . . .  5.5 0.0  5.5 1 1 
        496 1 . . . . .  5.5 0.0  5.5 1 1 
        497 1 . . . . .  5.5 0.0  5.5 1 1 
        498 1 . . . . .  5.5 0.0  5.5 1 1 
        499 1 . . . . . 5.16 0.0 5.16 1 1 
        500 1 . . . . .  5.5 0.0  5.5 1 1 
        501 1 . . . . .  5.5 0.0  5.5 1 1 
        502 1 . . . . . 5.16 0.0 5.16 1 1 
        503 1 . . . . .  5.5 0.0  5.5 1 1 
        504 1 . . . . .  5.5 0.0  5.5 1 1 
        505 1 . . . . .  5.5 0.0  5.5 1 1 
        506 1 . . . . .  5.5 0.0  5.5 1 1 
        507 1 . . . . .  5.5 0.0  5.5 1 1 
        508 1 . . . . .  5.5 0.0  5.5 1 1 
        509 1 . . . . .  5.5 0.0  5.5 1 1 
        510 1 . . . . .  5.5 0.0  5.5 1 1 
        511 1 . . . . .  5.5 0.0  5.5 1 1 
        512 1 . . . . .  5.5 0.0  5.5 1 1 
        513 1 . . . . .  5.5 0.0  5.5 1 1 
        514 1 . . . . .  5.5 0.0  5.5 1 1 
        515 1 . . . . .  5.5 0.0  5.5 1 1 
        516 1 . . . . .  5.5 0.0  5.5 1 1 
        517 1 . . . . .  5.5 0.0  5.5 1 1 
        518 1 . . . . .  5.5 0.0  5.5 1 1 
        519 1 . . . . .  5.5 0.0  5.5 1 1 
        520 1 . . . . .  5.5 0.0  5.5 1 1 
        521 1 . . . . .  5.5 0.0  5.5 1 1 
        522 1 . . . . .  5.5 0.0  5.5 1 1 
        523 1 . . . . .  5.5 0.0  5.5 1 1 
        524 1 . . . . .  5.5 0.0  5.5 1 1 
        525 1 . . . . .  5.5 0.0  5.5 1 1 
        526 1 . . . . .  5.5 0.0  5.5 1 1 
        527 1 . . . . .  5.5 0.0  5.5 1 1 
        528 1 . . . . .  5.5 0.0  5.5 1 1 
        529 1 . . . . .  5.5 0.0  5.5 1 1 
        530 1 . . . . .  5.5 0.0  5.5 1 1 
        531 1 . . . . .  5.5 0.0  5.5 1 1 
        532 1 . . . . .  5.5 0.0  5.5 1 1 
        533 1 . . . . .  5.5 0.0  5.5 1 1 
        534 1 . . . . .  5.5 0.0  5.5 1 1 
        535 1 . . . . .  5.5 0.0  5.5 1 1 
        536 1 . . . . .  5.5 0.0  5.5 1 1 
        537 1 . . . . .  5.5 0.0  5.5 1 1 
        538 1 . . . . .  5.5 0.0  5.5 1 1 
        539 1 . . . . .  5.5 0.0  5.5 1 1 
        540 1 . . . . .  5.5 0.0  5.5 1 1 
        541 1 . . . . .  5.5 0.0  5.5 1 1 
        542 1 . . . . .  5.5 0.0  5.5 1 1 
        543 1 . . . . .  5.5 0.0  5.5 1 1 
        544 1 . . . . .  5.5 0.0  5.5 1 1 
        545 1 . . . . .  5.5 0.0  5.5 1 1 
        546 1 . . . . .  5.5 0.0  5.5 1 1 
        547 1 . . . . . 7.63 0.0 7.63 1 1 
        548 1 . . . . .  5.5 0.0  5.5 1 1 
        549 1 . . . . .  5.5 0.0  5.5 1 1 
        550 1 . . . . . 7.63 0.0 7.63 1 1 
        551 1 . . . . .  5.5 0.0  5.5 1 1 
        552 1 . . . . .  5.5 0.0  5.5 1 1 
        553 1 . . . . .  5.5 0.0  5.5 1 1 
        554 1 . . . . .  5.5 0.0  5.5 1 1 
        555 1 . . . . .  5.5 0.0  5.5 1 1 
        556 1 . . . . .  5.5 0.0  5.5 1 1 
        557 1 . . . . .  5.5 0.0  5.5 1 1 
        558 1 . . . . . 7.63 0.0 7.63 1 1 
        559 1 . . . . .  5.5 0.0  5.5 1 1 
        560 1 . . . . .  5.5 0.0  5.5 1 1 
        561 1 . . . . .  5.5 0.0  5.5 1 1 
        562 1 . . . . . 7.63 0.0 7.63 1 1 
        563 1 . . . . .  5.5 0.0  5.5 1 1 
        564 1 . . . . .  5.5 0.0  5.5 1 1 
        565 1 . . . . . 6.95 0.0 6.95 1 1 
        566 1 . . . . . 6.95 0.0 6.95 1 1 
        567 1 . . . . .  5.5 0.0  5.5 1 1 
        568 1 . . . . .  5.5 0.0  5.5 1 1 
        569 1 . . . . . 7.26 0.0 7.26 1 1 
        570 1 . . . . . 7.63 0.0 7.63 1 1 
        571 1 . . . . .  5.5 0.0  5.5 1 1 
        572 1 . . . . . 7.26 0.0 7.26 1 1 
        573 1 . . . . . 6.38 0.0 6.38 1 1 
        574 1 . . . . . 6.38 0.0 6.38 1 1 
        575 1 . . . . . 7.63 0.0 7.63 1 1 
        576 1 . . . . .  5.5 0.0  5.5 1 1 
        577 1 . . . . .  5.5 0.0  5.5 1 1 
        578 1 . . . . .  5.5 0.0  5.5 1 1 
        579 1 . . . . .  5.5 0.0  5.5 1 1 
        580 1 . . . . .  5.5 0.0  5.5 1 1 
        581 1 . . . . .  5.5 0.0  5.5 1 1 
        582 1 . . . . . 7.63 0.0 7.63 1 1 
        583 1 . . . . . 7.63 0.0 7.63 1 1 
        584 1 . . . . . 7.63 0.0 7.63 1 1 
        585 1 . . . . . 9.76 0.0 9.76 1 1 
        586 1 . . . . . 9.77 0.0 9.77 1 1 
        587 1 . . . . . 7.63 0.0 7.63 1 1 
        588 1 . . . . . 7.63 0.0 7.63 1 1 
        589 1 . . . . . 7.63 0.0 7.63 1 1 
        590 1 . . . . . 7.63 0.0 7.63 1 1 
        591 1 . . . . .  5.5 0.0  5.5 1 1 
        592 1 . . . . . 7.63 0.0 7.63 1 1 
        593 1 . . . . . 9.76 0.0 9.76 1 1 
        594 1 . . . . . 7.63 0.0 7.63 1 1 
        595 1 . . . . . 7.63 0.0 7.63 1 1 
        596 1 . . . . .  5.5 0.0  5.5 1 1 
        597 1 . . . . .  5.5 0.0  5.5 1 1 
        598 1 . . . . . 6.38 0.0 6.38 1 1 
        599 1 . . . . . 6.38 0.0 6.38 1 1 
        600 1 . . . . . 9.76 0.0 9.76 1 1 
        601 1 . . . . . 7.26 0.0 7.26 1 1 
        602 1 . . . . . 7.26 0.0 7.26 1 1 
        603 1 . . . . .  5.5 0.0  5.5 1 1 
        604 1 . . . . .  5.5 0.0  5.5 1 1 
        605 1 . . . . . 7.63 0.0 7.63 1 1 
        606 1 . . . . .  5.5 0.0  5.5 1 1 
        607 1 . . . . .  5.5 0.0  5.5 1 1 
        608 1 . . . . .  5.5 0.0  5.5 1 1 
        609 1 . . . . .  5.5 0.0  5.5 1 1 
        610 1 . . . . .  5.5 0.0  5.5 1 1 
        611 1 . . . . .  5.5 0.0  5.5 1 1 
        612 1 . . . . . 7.63 0.0 7.63 1 1 
        613 1 . . . . . 7.63 0.0 7.63 1 1 
        614 1 . . . . . 6.52 0.0 6.52 1 1 
        615 1 . . . . . 6.52 0.0 6.52 1 1 
        616 1 . . . . . 6.52 0.0 6.52 1 1 
        617 1 . . . . . 6.52 0.0 6.52 1 1 
        618 1 . . . . . 6.52 0.0 6.52 1 1 
        619 1 . . . . . 6.52 0.0 6.52 1 1 
        620 1 . . . . . 6.52 0.0 6.52 1 1 
        621 1 . . . . . 6.52 0.0 6.52 1 1 
        622 1 . . . . . 6.52 0.0 6.52 1 1 
        623 1 . . . . . 6.52 0.0 6.52 1 1 
        624 1 . . . . . 6.52 0.0 6.52 1 1 
        625 1 . . . . . 6.52 0.0 6.52 1 1 
        626 1 . . . . . 6.52 0.0 6.52 1 1 
        627 1 . . . . . 6.52 0.0 6.52 1 1 
        628 1 . . . . . 6.52 0.0 6.52 1 1 
        629 1 . . . . . 6.52 0.0 6.52 1 1 
        630 1 . . . . . 6.52 0.0 6.52 1 1 
        631 1 . . . . . 6.52 0.0 6.52 1 1 
        632 1 . . . . . 6.52 0.0 6.52 1 1 
        633 1 . . . . . 6.52 0.0 6.52 1 1 
        634 1 . . . . . 6.52 0.0 6.52 1 1 
        635 1 . . . . . 6.49 0.0 6.49 1 1 
        636 1 . . . . . 6.18 0.0 6.18 1 1 
        637 1 . . . . . 6.52 0.0 6.52 1 1 
        638 1 . . . . . 6.52 0.0 6.52 1 1 
        639 1 . . . . . 6.52 0.0 6.52 1 1 
        640 1 . . . . . 6.52 0.0 6.52 1 1 
        641 1 . . . . . 6.52 0.0 6.52 1 1 
        642 1 . . . . . 6.52 0.0 6.52 1 1 
        643 1 . . . . . 6.52 0.0 6.52 1 1 
        644 1 . . . . . 6.52 0.0 6.52 1 1 
        645 1 . . . . . 6.52 0.0 6.52 1 1 
        646 1 . . . . . 6.52 0.0 6.52 1 1 
        647 1 . . . . . 6.52 0.0 6.52 1 1 
        648 1 . . . . . 6.52 0.0 6.52 1 1 
        649 1 . . . . . 6.52 0.0 6.52 1 1 
        650 1 . . . . . 6.52 0.0 6.52 1 1 
        651 1 . . . . . 6.52 0.0 6.52 1 1 
        652 1 . . . . . 9.61 0.0 9.61 1 1 
        653 1 . . . . . 9.61 0.0 9.61 1 1 
        654 1 . . . . . 7.54 0.0 7.54 1 1 
        655 1 . . . . . 6.52 0.0 6.52 1 1 
        656 1 . . . . . 6.52 0.0 6.52 1 1 
        657 1 . . . . . 6.52 0.0 6.52 1 1 
        658 1 . . . . . 6.52 0.0 6.52 1 1 
        659 1 . . . . . 6.52 0.0 6.52 1 1 
        660 1 . . . . . 6.52 0.0 6.52 1 1 
        661 1 . . . . . 9.62 0.0 9.62 1 1 
        662 1 . . . . . 9.62 0.0 9.62 1 1 
        663 1 . . . . . 6.52 0.0 6.52 1 1 
        664 1 . . . . . 6.52 0.0 6.52 1 1 
        665 1 . . . . . 6.52 0.0 6.52 1 1 
        666 1 . . . . . 7.54 0.0 7.54 1 1 
        667 1 . . . . . 7.54 0.0 7.54 1 1 
        668 1 . . . . . 6.52 0.0 6.52 1 1 
        669 1 . . . . . 6.52 0.0 6.52 1 1 
        670 1 . . . . . 6.52 0.0 6.52 1 1 
        671 1 . . . . . 6.52 0.0 6.52 1 1 
        672 1 . . . . . 6.52 0.0 6.52 1 1 
        673 1 . . . . . 6.52 0.0 6.52 1 1 
        674 1 . . . . . 6.52 0.0 6.52 1 1 
        675 1 . . . . . 6.52 0.0 6.52 1 1 
        676 1 . . . . . 6.52 0.0 6.52 1 1 
        677 1 . . . . . 6.52 0.0 6.52 1 1 
        678 1 . . . . . 6.52 0.0 6.52 1 1 
        679 1 . . . . . 6.52 0.0 6.52 1 1 
        680 1 . . . . . 6.52 0.0 6.52 1 1 
        681 1 . . . . . 8.17 0.0 8.17 1 1 
        682 1 . . . . . 8.17 0.0 8.17 1 1 
        683 1 . . . . . 8.28 0.0 8.28 1 1 
        684 1 . . . . . 8.28 0.0 8.28 1 1 
        685 1 . . . . . 8.65 0.0 8.65 1 1 
        686 1 . . . . . 6.52 0.0 6.52 1 1 
        687 1 . . . . .  7.4 0.0  7.4 1 1 
        688 1 . . . . . 6.52 0.0 6.52 1 1 
        689 1 . . . . . 6.52 0.0 6.52 1 1 
        690 1 . . . . . 6.52 0.0 6.52 1 1 
        691 1 . . . . . 6.52 0.0 6.52 1 1 
        692 1 . . . . . 6.52 0.0 6.52 1 1 
        693 1 . . . . . 7.54 0.0 7.54 1 1 
        694 1 . . . . . 6.52 0.0 6.52 1 1 
        695 1 . . . . .  7.4 0.0  7.4 1 1 
        696 1 . . . . . 5.87 0.0 5.87 1 1 
        697 1 . . . . . 7.54 0.0 7.54 1 1 
        698 1 . . . . . 6.02 0.0 6.02 1 1 
        699 1 . . . . . 8.28 0.0 8.28 1 1 
        700 1 . . . . . 9.62 0.0 9.62 1 1 
        701 1 . . . . . 9.62 0.0 9.62 1 1 
        702 1 . . . . . 8.28 0.0 8.28 1 1 
        703 1 . . . . . 8.28 0.0 8.28 1 1 
        704 1 . . . . . 8.28 0.0 8.28 1 1 
        705 1 . . . . . 6.52 0.0 6.52 1 1 
        706 1 . . . . . 6.52 0.0 6.52 1 1 
        707 1 . . . . . 6.52 0.0 6.52 1 1 
        708 1 . . . . . 6.12 0.0 6.12 1 1 
        709 1 . . . . . 6.52 0.0 6.52 1 1 
        710 1 . . . . . 6.52 0.0 6.52 1 1 
        711 1 . . . . . 6.52 0.0 6.52 1 1 
        712 1 . . . . . 9.61 0.0 9.61 1 1 
        713 1 . . . . . 6.52 0.0 6.52 1 1 
        714 1 . . . . . 6.52 0.0 6.52 1 1 
        715 1 . . . . .  7.4 0.0  7.4 1 1 
        716 1 . . . . . 6.52 0.0 6.52 1 1 
        717 1 . . . . . 7.54 0.0 7.54 1 1 
        718 1 . . . . . 6.52 0.0 6.52 1 1 
        719 1 . . . . . 6.52 0.0 6.52 1 1 
        720 1 . . . . . 6.52 0.0 6.52 1 1 
        721 1 . . . . . 6.52 0.0 6.52 1 1 
        722 1 . . . . . 6.52 0.0 6.52 1 1 
        723 1 . . . . . 6.52 0.0 6.52 1 1 
        724 1 . . . . . 6.52 0.0 6.52 1 1 
        725 1 . . . . . 7.54 0.0 7.54 1 1 
        726 1 . . . . . 7.54 0.0 7.54 1 1 
        727 1 . . . . . 6.52 0.0 6.52 1 1 
        728 1 . . . . . 6.52 0.0 6.52 1 1 
        729 1 . . . . . 6.52 0.0 6.52 1 1 
        730 1 . . . . . 6.52 0.0 6.52 1 1 
        731 1 . . . . . 6.08 0.0 6.08 1 1 
        732 1 . . . . . 6.52 0.0 6.52 1 1 
        733 1 . . . . . 6.52 0.0 6.52 1 1 
        734 1 . . . . . 6.52 0.0 6.52 1 1 
        735 1 . . . . .  7.4 0.0  7.4 1 1 
        736 1 . . . . . 6.52 0.0 6.52 1 1 
        737 1 . . . . . 6.52 0.0 6.52 1 1 
        738 1 . . . . . 6.36 0.0 6.36 1 1 
        739 1 . . . . . 7.54 0.0 7.54 1 1 
        740 1 . . . . . 6.52 0.0 6.52 1 1 
        741 1 . . . . . 6.52 0.0 6.52 1 1 
        742 1 . . . . . 6.52 0.0 6.52 1 1 
        743 1 . . . . . 6.52 0.0 6.52 1 1 
        744 1 . . . . . 6.52 0.0 6.52 1 1 
        745 1 . . . . . 6.52 0.0 6.52 1 1 
        746 1 . . . . . 6.05 0.0 6.05 1 1 
        747 1 . . . . . 6.52 0.0 6.52 1 1 
        748 1 . . . . . 6.52 0.0 6.52 1 1 
        749 1 . . . . . 6.52 0.0 6.52 1 1 
        750 1 . . . . . 7.54 0.0 7.54 1 1 
        751 1 . . . . . 7.54 0.0 7.54 1 1 
        752 1 . . . . .  7.4 0.0  7.4 1 1 
        753 1 . . . . . 6.52 0.0 6.52 1 1 
        754 1 . . . . . 6.52 0.0 6.52 1 1 
        755 1 . . . . . 7.54 0.0 7.54 1 1 
        756 1 . . . . . 7.54 0.0 7.54 1 1 
        757 1 . . . . . 7.54 0.0 7.54 1 1 
        758 1 . . . . . 6.52 0.0 6.52 1 1 
        759 1 . . . . . 6.52 0.0 6.52 1 1 
        760 1 . . . . . 6.52 0.0 6.52 1 1 
        761 1 . . . . . 6.21 0.0 6.21 1 1 
        762 1 . . . . . 6.52 0.0 6.52 1 1 
        763 1 . . . . . 8.65 0.0 8.65 1 1 
        764 1 . . . . . 8.65 0.0 8.65 1 1 
        765 1 . . . . . 8.65 0.0 8.65 1 1 
        766 1 . . . . . 6.52 0.0 6.52 1 1 
        767 1 . . . . . 6.52 0.0 6.52 1 1 
        768 1 . . . . . 6.52 0.0 6.52 1 1 
        769 1 . . . . . 6.52 0.0 6.52 1 1 
        770 1 . . . . . 6.52 0.0 6.52 1 1 
        771 1 . . . . . 6.52 0.0 6.52 1 1 
        772 1 . . . . . 8.65 0.0 8.65 1 1 
        773 1 . . . . . 8.65 0.0 8.65 1 1 
        774 1 . . . . . 6.52 0.0 6.52 1 1 
        775 1 . . . . . 6.52 0.0 6.52 1 1 
        776 1 . . . . . 8.65 0.0 8.65 1 1 
        777 1 . . . . . 8.65 0.0 8.65 1 1 
        778 1 . . . . . 6.52 0.0 6.52 1 1 
        779 1 . . . . . 6.52 0.0 6.52 1 1 
        780 1 . . . . . 8.65 0.0 8.65 1 1 
        781 1 . . . . . 6.52 0.0 6.52 1 1 
        782 1 . . . . . 8.65 0.0 8.65 1 1 
        783 1 . . . . . 6.52 0.0 6.52 1 1 
        784 1 . . . . . 6.52 0.0 6.52 1 1 
        785 1 . . . . . 6.52 0.0 6.52 1 1 
        786 1 . . . . . 6.52 0.0 6.52 1 1 
        787 1 . . . . . 6.52 0.0 6.52 1 1 
        788 1 . . . . . 6.52 0.0 6.52 1 1 
        789 1 . . . . . 8.25 0.0 8.25 1 1 
        790 1 . . . . . 6.52 0.0 6.52 1 1 
        791 1 . . . . . 6.52 0.0 6.52 1 1 
        792 1 . . . . . 8.25 0.0 8.25 1 1 
        793 1 . . . . . 6.52 0.0 6.52 1 1 
        794 1 . . . . . 6.52 0.0 6.52 1 1 
        795 1 . . . . . 5.87 0.0 5.87 1 1 
        796 1 . . . . . 6.52 0.0 6.52 1 1 
        797 1 . . . . . 6.52 0.0 6.52 1 1 
        798 1 . . . . . 6.52 0.0 6.52 1 1 
        799 1 . . . . . 6.52 0.0 6.52 1 1 
        800 1 . . . . . 6.52 0.0 6.52 1 1 
        801 1 . . . . . 6.52 0.0 6.52 1 1 
        802 1 . . . . . 6.52 0.0 6.52 1 1 
        803 1 . . . . . 6.52 0.0 6.52 1 1 
        804 1 . . . . . 8.65 0.0 8.65 1 1 
        805 1 . . . . . 8.65 0.0 8.65 1 1 
        806 1 . . . . . 8.65 0.0 8.65 1 1 
        807 1 . . . . . 8.65 0.0 8.65 1 1 
        808 1 . . . . . 8.65 0.0 8.65 1 1 
        809 1 . . . . . 8.65 0.0 8.65 1 1 
        810 1 . . . . . 8.65 0.0 8.65 1 1 
        811 1 . . . . . 8.65 0.0 8.65 1 1 
        812 1 . . . . . 8.65 0.0 8.65 1 1 
        813 1 . . . . . 6.52 0.0 6.52 1 1 
        814 1 . . . . . 6.52 0.0 6.52 1 1 
        815 1 . . . . . 6.52 0.0 6.52 1 1 
        816 1 . . . . . 6.52 0.0 6.52 1 1 
        817 1 . . . . . 8.65 0.0 8.65 1 1 
        818 1 . . . . . 6.52 0.0 6.52 1 1 
        819 1 . . . . . 8.65 0.0 8.65 1 1 
        820 1 . . . . . 8.65 0.0 8.65 1 1 
        821 1 . . . . . 8.65 0.0 8.65 1 1 
        822 1 . . . . . 6.52 0.0 6.52 1 1 
        823 1 . . . . . 8.65 0.0 8.65 1 1 
        824 1 . . . . . 8.65 0.0 8.65 1 1 
        825 1 . . . . . 8.65 0.0 8.65 1 1 
        826 1 . . . . . 8.65 0.0 8.65 1 1 
        827 1 . . . . . 6.52 0.0 6.52 1 1 
        828 1 . . . . . 6.52 0.0 6.52 1 1 
        829 1 . . . . . 6.52 0.0 6.52 1 1 
        830 1 . . . . . 6.52 0.0 6.52 1 1 
        831 1 . . . . . 8.65 0.0 8.65 1 1 
        832 1 . . . . . 6.52 0.0 6.52 1 1 
        833 1 . . . . . 6.52 0.0 6.52 1 1 
        834 1 . . . . . 8.65 0.0 8.65 1 1 
        835 1 . . . . . 7.54 0.0 7.54 1 1 
        836 1 . . . . . 7.54 0.0 7.54 1 1 
        837 1 . . . . . 8.65 0.0 8.65 1 1 
        838 1 . . . . . 6.52 0.0 6.52 1 1 
        839 1 . . . . . 8.65 0.0 8.65 1 1 
        840 1 . . . . . 6.52 0.0 6.52 1 1 
        841 1 . . . . . 8.65 0.0 8.65 1 1 
        842 1 . . . . . 8.65 0.0 8.65 1 1 
        843 1 . . . . . 8.65 0.0 8.65 1 1 
        844 1 . . . . . 6.52 0.0 6.52 1 1 
        845 1 . . . . .  7.4 0.0  7.4 1 1 
        846 1 . . . . . 7.54 0.0 7.54 1 1 
        847 1 . . . . . 7.54 0.0 7.54 1 1 
        848 1 . . . . . 7.54 0.0 7.54 1 1 
        849 1 . . . . . 7.54 0.0 7.54 1 1 
        850 1 . . . . . 6.52 0.0 6.52 1 1 
        851 1 . . . . . 6.24 0.0 6.24 1 1 
        852 1 . . . . . 6.52 0.0 6.52 1 1 
        853 1 . . . . . 6.52 0.0 6.52 1 1 
        854 1 . . . . . 6.52 0.0 6.52 1 1 
        855 1 . . . . . 6.52 0.0 6.52 1 1 
        856 1 . . . . . 6.52 0.0 6.52 1 1 
        857 1 . . . . . 6.52 0.0 6.52 1 1 
        858 1 . . . . . 6.52 0.0 6.52 1 1 
        859 1 . . . . . 6.52 0.0 6.52 1 1 
        860 1 . . . . . 6.52 0.0 6.52 1 1 
        861 1 . . . . . 6.52 0.0 6.52 1 1 
        862 1 . . . . . 6.52 0.0 6.52 1 1 
        863 1 . . . . . 6.52 0.0 6.52 1 1 
        864 1 . . . . . 8.65 0.0 8.65 1 1 
        865 1 . . . . . 8.65 0.0 8.65 1 1 
        866 1 . . . . . 6.52 0.0 6.52 1 1 
        867 1 . . . . . 8.65 0.0 8.65 1 1 
        868 1 . . . . . 8.65 0.0 8.65 1 1 
        869 1 . . . . . 7.54 0.0 7.54 1 1 
        870 1 . . . . . 6.52 0.0 6.52 1 1 
        871 1 . . . . . 6.52 0.0 6.52 1 1 
        872 1 . . . . . 6.52 0.0 6.52 1 1 
        873 1 . . . . . 6.52 0.0 6.52 1 1 
        874 1 . . . . . 6.52 0.0 6.52 1 1 
        875 1 . . . . . 6.52 0.0 6.52 1 1 
        876 1 . . . . . 6.52 0.0 6.52 1 1 
        877 1 . . . . . 6.52 0.0 6.52 1 1 
        878 1 . . . . . 6.52 0.0 6.52 1 1 
        879 1 . . . . . 6.52 0.0 6.52 1 1 
        880 1 . . . . . 6.52 0.0 6.52 1 1 
        881 1 . . . . . 6.52 0.0 6.52 1 1 
        882 1 . . . . . 7.54 0.0 7.54 1 1 
        883 1 . . . . . 6.27 0.0 6.27 1 1 
        884 1 . . . . . 6.52 0.0 6.52 1 1 
        885 1 . . . . . 6.52 0.0 6.52 1 1 
        886 1 . . . . . 6.52 0.0 6.52 1 1 
        887 1 . . . . . 6.52 0.0 6.52 1 1 
        888 1 . . . . . 6.52 0.0 6.52 1 1 
        889 1 . . . . . 6.52 0.0 6.52 1 1 
        890 1 . . . . . 6.52 0.0 6.52 1 1 
        891 1 . . . . . 6.52 0.0 6.52 1 1 
        892 1 . . . . . 6.52 0.0 6.52 1 1 
        893 1 . . . . . 6.52 0.0 6.52 1 1 
        894 1 . . . . . 6.52 0.0 6.52 1 1 
        895 1 . . . . . 6.52 0.0 6.52 1 1 
        896 1 . . . . . 9.61 0.0 9.61 1 1 
        897 1 . . . . . 6.52 0.0 6.52 1 1 
        898 1 . . . . . 6.52 0.0 6.52 1 1 
        899 1 . . . . . 5.87 0.0 5.87 1 1 
        900 1 . . . . . 6.95 0.0 6.95 1 1 
        901 1 . . . . . 6.95 0.0 6.95 1 1 
        902 1 . . . . . 3.91 0.0 3.91 1 1 
        903 1 . . . . . 3.77 0.0 3.77 1 1 
        904 1 . . . . . 4.31 0.0 4.31 1 1 
        905 1 . . . . . 3.79 0.0 3.79 1 1 
        906 1 . . . . .  7.4 0.0  7.4 1 1 
        907 1 . . . . . 6.18 0.0 6.18 1 1 
        908 1 . . . . . 8.07 0.0 8.07 1 1 
        909 1 . . . . . 4.19 0.0 4.19 1 1 
        910 1 . . . . . 6.38 0.0 6.38 1 1 
        911 1 . . . . .  7.4 0.0  7.4 1 1 
        912 1 . . . . . 6.38 0.0 6.38 1 1 
        913 1 . . . . . 6.38 0.0 6.38 1 1 
        914 1 . . . . . 3.85 0.0 3.85 1 1 
        915 1 . . . . . 7.21 0.0 7.21 1 1 
        916 1 . . . . .  7.4 0.0  7.4 1 1 
        917 1 . . . . .  7.4 0.0  7.4 1 1 
        918 1 . . . . . 3.73 0.0 3.73 1 1 
        919 1 . . . . . 4.25 0.0 4.25 1 1 
        920 1 . . . . . 8.02 0.0 8.02 1 1 
        921 1 . . . . . 9.61 0.0 9.61 1 1 
        922 1 . . . . . 9.61 0.0 9.61 1 1 
        923 1 . . . . . 6.38 0.0 6.38 1 1 
        924 1 . . . . . 6.38 0.0 6.38 1 1 
        925 1 . . . . . 6.38 0.0 6.38 1 1 
        926 1 . . . . . 4.21 0.0 4.21 1 1 
        927 1 . . . . . 6.38 0.0 6.38 1 1 
        928 1 . . . . . 6.92 0.0 6.92 1 1 
        929 1 . . . . . 7.26 0.0 7.26 1 1 
        930 1 . . . . . 6.38 0.0 6.38 1 1 
        931 1 . . . . . 6.38 0.0 6.38 1 1 
        932 1 . . . . . 6.38 0.0 6.38 1 1 
        933 1 . . . . .  7.4 0.0  7.4 1 1 
        934 1 . . . . . 9.09 0.0 9.09 1 1 
        935 1 . . . . . 10.2 0.0 10.2 1 1 
        936 1 . . . . . 8.95 0.0 8.95 1 1 
        937 1 . . . . . 8.07 0.0 8.07 1 1 
        938 1 . . . . . 6.38 0.0 6.38 1 1 
        939 1 . . . . . 7.41 0.0 7.41 1 1 
        940 1 . . . . . 7.63 0.0 7.63 1 1 
        941 1 . . . . . 8.07 0.0 8.07 1 1 
        942 1 . . . . . 7.41 0.0 7.41 1 1 
        943 1 . . . . . 8.95 0.0 8.95 1 1 
        944 1 . . . . . 8.02 0.0 8.02 1 1 
        945 1 . . . . . 9.61 0.0 9.61 1 1 
        946 1 . . . . . 9.61 0.0 9.61 1 1 
        947 1 . . . . . 8.04 0.0 8.04 1 1 
        948 1 . . . . . 5.85 0.0 5.85 1 1 
        949 1 . . . . . 8.07 0.0 8.07 1 1 
        950 1 . . . . . 8.84 0.0 8.84 1 1 
        951 1 . . . . . 8.07 0.0 8.07 1 1 
        952 1 . . . . . 8.07 0.0 8.07 1 1 
        953 1 . . . . . 8.07 0.0 8.07 1 1 
        954 1 . . . . . 8.07 0.0 8.07 1 1 
        955 1 . . . . . 6.77 0.0 6.77 1 1 
        956 1 . . . . . 8.28 0.0 8.28 1 1 
        957 1 . . . . . 8.07 0.0 8.07 1 1 
        958 1 . . . . . 8.07 0.0 8.07 1 1 
        959 1 . . . . . 8.07 0.0 8.07 1 1 
        960 1 . . . . . 8.07 0.0 8.07 1 1 
        961 1 . . . . . 8.22 0.0 8.22 1 1 
        962 1 . . . . . 8.07 0.0 8.07 1 1 
        963 1 . . . . . 8.07 0.0 8.07 1 1 
        964 1 . . . . .  7.4 0.0  7.4 1 1 
        965 1 . . . . .  7.4 0.0  7.4 1 1 
        966 1 . . . . . 8.02 0.0 8.02 1 1 
        967 1 . . . . . 9.62 0.0 9.62 1 1 
        968 1 . . . . . 9.62 0.0 9.62 1 1 
        969 1 . . . . . 5.11 0.0 5.11 1 1 
        970 1 . . . . . 4.15 0.0 4.15 1 1 
        971 1 . . . . . 10.2 0.0 10.2 1 1 
        972 1 . . . . . 10.2 0.0 10.2 1 1 
        973 1 . . . . . 4.84 0.0 4.84 1 1 
        974 1 . . . . . 7.26 0.0 7.26 1 1 
        975 1 . . . . . 3.72 0.0 3.72 1 1 
        976 1 . . . . . 3.93 0.0 3.93 1 1 
        977 1 . . . . . 4.45 0.0 4.45 1 1 
        978 1 . . . . . 3.42 0.0 3.42 1 1 
        979 1 . . . . . 6.26 0.0 6.26 1 1 
        980 1 . . . . . 3.97 0.0 3.97 1 1 
        981 1 . . . . . 3.56 0.0 3.56 1 1 
        982 1 . . . . . 4.13 0.0 4.13 1 1 
        983 1 . . . . . 6.32 0.0 6.32 1 1 
        984 1 . . . . . 7.26 0.0 7.26 1 1 
        985 1 . . . . . 7.26 0.0 7.26 1 1 
        986 1 . . . . . 5.98 0.0 5.98 1 1 
        987 1 . . . . . 6.29 0.0 6.29 1 1 
        988 1 . . . . . 5.23 0.0 5.23 1 1 
        989 1 . . . . . 8.07 0.0 8.07 1 1 
        990 1 . . . . . 7.41 0.0 7.41 1 1 
        991 1 . . . . . 3.57 0.0 3.57 1 1 
        992 1 . . . . . 8.02 0.0 8.02 1 1 
        993 1 . . . . . 9.62 0.0 9.62 1 1 
        994 1 . . . . . 9.62 0.0 9.62 1 1 
        995 1 . . . . . 6.76 0.0 6.76 1 1 
        996 1 . . . . . 8.25 0.0 8.25 1 1 
        997 1 . . . . . 5.85 0.0 5.85 1 1 
        998 1 . . . . . 7.23 0.0 7.23 1 1 
        999 1 . . . . . 3.73 0.0 3.73 1 1 
       1000 1 . . . . . 5.01 0.0 5.01 1 1 
       1001 1 . . . . .  5.0 0.0  5.0 1 1 
       1002 1 . . . . . 3.32 0.0 3.32 1 1 
       1003 1 . . . . . 7.05 0.0 7.05 1 1 
       1004 1 . . . . . 8.17 0.0 8.17 1 1 
       1005 1 . . . . . 8.17 0.0 8.17 1 1 
       1006 1 . . . . . 6.68 0.0 6.68 1 1 
       1007 1 . . . . . 8.28 0.0 8.28 1 1 
       1008 1 . . . . . 3.73 0.0 3.73 1 1 
       1009 1 . . . . . 3.88 0.0 3.88 1 1 
       1010 1 . . . . . 3.71 0.0 3.71 1 1 
       1011 1 . . . . . 6.32 0.0 6.32 1 1 
       1012 1 . . . . . 7.26 0.0 7.26 1 1 
       1013 1 . . . . . 7.26 0.0 7.26 1 1 
       1014 1 . . . . .  7.4 0.0  7.4 1 1 
       1015 1 . . . . .  5.5 0.0  5.5 1 1 
       1016 1 . . . . . 4.48 0.0 4.48 1 1 
       1017 1 . . . . .  7.4 0.0  7.4 1 1 
       1018 1 . . . . .  7.4 0.0  7.4 1 1 
       1019 1 . . . . . 6.38 0.0 6.38 1 1 
       1020 1 . . . . . 6.38 0.0 6.38 1 1 
       1021 1 . . . . . 3.82 0.0 3.82 1 1 
       1022 1 . . . . . 6.38 0.0 6.38 1 1 
       1023 1 . . . . . 4.09 0.0 4.09 1 1 
       1024 1 . . . . . 5.37 0.0 5.37 1 1 
       1025 1 . . . . . 6.38 0.0 6.38 1 1 
       1026 1 . . . . . 7.36 0.0 7.36 1 1 
       1027 1 . . . . .  7.4 0.0  7.4 1 1 
       1028 1 . . . . . 4.11 0.0 4.11 1 1 
       1029 1 . . . . . 3.85 0.0 3.85 1 1 
       1030 1 . . . . . 4.08 0.0 4.08 1 1 
       1031 1 . . . . .  7.4 0.0  7.4 1 1 
       1032 1 . . . . . 5.35 0.0 5.35 1 1 
       1033 1 . . . . .  7.4 0.0  7.4 1 1 
       1034 1 . . . . . 5.26 0.0 5.26 1 1 
       1035 1 . . . . . 3.08 0.0 3.08 1 1 
       1036 1 . . . . . 6.07 0.0 6.07 1 1 
       1037 1 . . . . . 3.77 0.0 3.77 1 1 
       1038 1 . . . . . 3.86 0.0 3.86 1 1 
       1039 1 . . . . . 3.88 0.0 3.88 1 1 
       1040 1 . . . . . 4.16 0.0 4.16 1 1 
       1041 1 . . . . .  7.4 0.0  7.4 1 1 
       1042 1 . . . . .  7.4 0.0  7.4 1 1 
       1043 1 . . . . . 6.02 0.0 6.02 1 1 
       1044 1 . . . . . 6.38 0.0 6.38 1 1 
       1045 1 . . . . . 6.11 0.0 6.11 1 1 
       1046 1 . . . . . 8.95 0.0 8.95 1 1 
       1047 1 . . . . .  7.4 0.0  7.4 1 1 
       1048 1 . . . . .  7.4 0.0  7.4 1 1 
       1049 1 . . . . .  7.4 0.0  7.4 1 1 
       1050 1 . . . . . 8.51 0.0 8.51 1 1 
       1051 1 . . . . . 8.51 0.0 8.51 1 1 
       1052 1 . . . . . 8.51 0.0 8.51 1 1 
       1053 1 . . . . .  7.4 0.0  7.4 1 1 
       1054 1 . . . . .  7.4 0.0  7.4 1 1 
       1055 1 . . . . . 3.36 0.0 3.36 1 1 
       1056 1 . . . . . 6.38 0.0 6.38 1 1 
       1057 1 . . . . . 4.99 0.0 4.99 1 1 
       1058 1 . . . . . 4.32 0.0 4.32 1 1 
       1059 1 . . . . . 3.76 0.0 3.76 1 1 
       1060 1 . . . . . 3.82 0.0 3.82 1 1 
       1061 1 . . . . . 3.73 0.0 3.73 1 1 
       1062 1 . . . . . 5.14 0.0 5.14 1 1 
       1063 1 . . . . . 4.32 0.0 4.32 1 1 
       1064 1 . . . . . 6.38 0.0 6.38 1 1 
       1065 1 . . . . . 7.26 0.0 7.26 1 1 
       1066 1 . . . . . 6.38 0.0 6.38 1 1 
       1067 1 . . . . . 3.91 0.0 3.91 1 1 
       1068 1 . . . . . 3.24 0.0 3.24 1 1 
       1069 1 . . . . .  4.4 0.0  4.4 1 1 
       1070 1 . . . . . 3.71 0.0 3.71 1 1 
       1071 1 . . . . . 6.38 0.0 6.38 1 1 
       1072 1 . . . . . 8.51 0.0 8.51 1 1 
       1073 1 . . . . . 8.51 0.0 8.51 1 1 
       1074 1 . . . . . 8.07 0.0 8.07 1 1 
       1075 1 . . . . . 8.07 0.0 8.07 1 1 
       1076 1 . . . . . 3.75 0.0 3.75 1 1 
       1077 1 . . . . . 7.26 0.0 7.26 1 1 
       1078 1 . . . . .  7.4 0.0  7.4 1 1 
       1079 1 . . . . . 3.62 0.0 3.62 1 1 
       1080 1 . . . . . 4.08 0.0 4.08 1 1 
       1081 1 . . . . .  7.4 0.0  7.4 1 1 
       1082 1 . . . . .  7.4 0.0  7.4 1 1 
       1083 1 . . . . . 6.62 0.0 6.62 1 1 
       1084 1 . . . . . 6.38 0.0 6.38 1 1 
       1085 1 . . . . . 3.83 0.0 3.83 1 1 
       1086 1 . . . . . 3.59 0.0 3.59 1 1 
       1087 1 . . . . . 3.67 0.0 3.67 1 1 
       1088 1 . . . . . 5.08 0.0 5.08 1 1 
       1089 1 . . . . . 3.62 0.0 3.62 1 1 
       1090 1 . . . . .  3.8 0.0  3.8 1 1 
       1091 1 . . . . . 6.75 0.0 6.75 1 1 
       1092 1 . . . . . 6.38 0.0 6.38 1 1 
       1093 1 . . . . . 8.11 0.0 8.11 1 1 
       1094 1 . . . . . 4.11 0.0 4.11 1 1 
       1095 1 . . . . . 3.52 0.0 3.52 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1  14 LEU H .  14 . HN 1 2 
        1 1 2 1 1  95 GLY O .  95 . O  1 2 
        2 1 1 1 1  14 LEU N .  14 . N  1 2 
        2 1 2 1 1  95 GLY O .  95 . O  1 2 
        3 1 1 1 1  19 ALA H .  19 . HN 1 2 
        3 1 2 1 1  90 GLY O .  90 . O  1 2 
        4 1 1 1 1  19 ALA N .  19 . N  1 2 
        4 1 2 1 1  90 GLY O .  90 . O  1 2 
        5 1 1 1 1  21 LEU H .  21 . HN 1 2 
        5 1 2 1 1  88 VAL O .  88 . O  1 2 
        6 1 1 1 1  21 LEU N .  21 . N  1 2 
        6 1 2 1 1  88 VAL O .  88 . O  1 2 
        7 1 1 1 1  24 THR H .  24 . HN 1 2 
        7 1 2 1 1  71 VAL O .  71 . O  1 2 
        8 1 1 1 1  24 THR N .  24 . N  1 2 
        8 1 2 1 1  71 VAL O .  71 . O  1 2 
        9 1 1 1 1  26 THR H .  26 . HN 1 2 
        9 1 2 1 1  69 PHE O .  69 . O  1 2 
       10 1 1 1 1  26 THR N .  26 . N  1 2 
       10 1 2 1 1  69 PHE O .  69 . O  1 2 
       11 1 1 1 1  43 LEU O .  43 . O  1 2 
       11 1 2 1 1  47 ALA H .  47 . HN 1 2 
       12 1 1 1 1  43 LEU O .  43 . O  1 2 
       12 1 2 1 1  47 ALA N .  47 . N  1 2 
       13 1 1 1 1  58 PHE H .  58 . HN 1 2 
       13 1 2 1 1  74 GLY O .  74 . O  1 2 
       14 1 1 1 1  58 PHE N .  58 . N  1 2 
       14 1 2 1 1  74 GLY O .  74 . O  1 2 
       15 1 1 1 1  59 ALA H .  59 . HN 1 2 
       15 1 2 1 1 133 GLU O . 133 . O  1 2 
       16 1 1 1 1  59 ALA N .  59 . N  1 2 
       16 1 2 1 1 133 GLU O . 133 . O  1 2 
       17 1 1 1 1  60 ARG H .  60 . HN 1 2 
       17 1 2 1 1  72 GLU O .  72 . O  1 2 
       18 1 1 1 1  60 ARG N .  60 . N  1 2 
       18 1 2 1 1  72 GLU O .  72 . O  1 2 
       19 1 1 1 1  61 TYR H .  61 . HN 1 2 
       19 1 2 1 1 131 ALA O . 131 . O  1 2 
       20 1 1 1 1  61 TYR N .  61 . N  1 2 
       20 1 2 1 1 131 ALA O . 131 . O  1 2 
       21 1 1 1 1  62 PHE O .  62 . O  1 2 
       21 1 2 1 1  70 GLU H .  70 . HN 1 2 
       22 1 1 1 1  62 PHE O .  62 . O  1 2 
       22 1 2 1 1  70 GLU N .  70 . N  1 2 
       23 1 1 1 1  60 ARG O .  60 . O  1 2 
       23 1 2 1 1  72 GLU H .  72 . HN 1 2 
       24 1 1 1 1  60 ARG O .  60 . O  1 2 
       24 1 2 1 1  72 GLU N .  72 . N  1 2 
       25 1 1 1 1  20 LEU O .  20 . O  1 2 
       25 1 2 1 1  75 PHE H .  75 . HN 1 2 
       26 1 1 1 1  20 LEU O .  20 . O  1 2 
       26 1 2 1 1  75 PHE N .  75 . N  1 2 
       27 1 1 1 1  21 LEU O .  21 . O  1 2 
       27 1 2 1 1  88 VAL H .  88 . HN 1 2 
       28 1 1 1 1  21 LEU O .  21 . O  1 2 
       28 1 2 1 1  88 VAL N .  88 . N  1 2 
       29 1 1 1 1  19 ALA O .  19 . O  1 2 
       29 1 2 1 1  90 GLY H .  90 . HN 1 2 
       30 1 1 1 1  19 ALA O .  19 . O  1 2 
       30 1 2 1 1  90 GLY N .  90 . N  1 2 
       31 1 1 1 1  12 LYS O .  12 . O  1 2 
       31 1 2 1 1  97 ALA H .  97 . HN 1 2 
       32 1 1 1 1  12 LYS O .  12 . O  1 2 
       32 1 2 1 1  97 ALA N .  97 . N  1 2 
       33 1 1 1 1 110 GLU O . 110 . O  1 2 
       33 1 2 1 1 114 ASP H . 114 . HN 1 2 
       34 1 1 1 1 110 GLU O . 110 . O  1 2 
       34 1 2 1 1 114 ASP N . 114 . N  1 2 
       35 1 1 1 1  61 TYR O .  61 . O  1 2 
       35 1 2 1 1 131 ALA H . 131 . HN 1 2 
       36 1 1 1 1  61 TYR O .  61 . O  1 2 
       36 1 2 1 1 131 ALA N . 131 . N  1 2 
       37 1 1 1 1 132 TYR H . 132 . HN 1 2 
       37 1 2 1 1 152 SER O . 152 . O  1 2 
       38 1 1 1 1 132 TYR N . 132 . N  1 2 
       38 1 2 1 1 152 SER O . 152 . O  1 2 
       39 1 1 1 1  59 ALA O .  59 . O  1 2 
       39 1 2 1 1 133 GLU H . 133 . HN 1 2 
       40 1 1 1 1  59 ALA O .  59 . O  1 2 
       40 1 2 1 1 133 GLU N . 133 . N  1 2 
       41 1 1 1 1  57 PRO O .  57 . O  1 2 
       41 1 2 1 1 135 TYR H . 135 . HN 1 2 
       42 1 1 1 1  57 PRO O .  57 . O  1 2 
       42 1 2 1 1 135 TYR N . 135 . N  1 2 
       43 1 1 1 1  98 ALA O .  98 . O  1 2 
       43 1 2 1 1 153 LEU H . 153 . HN 1 2 
       44 1 1 1 1  98 ALA O .  98 . O  1 2 
       44 1 2 1 1 153 LEU N . 153 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . 2.0 0.0 2.0 1 2 
        2 1 . . . . . 3.0 0.0 3.0 1 2 
        3 1 . . . . . 2.0 0.0 2.0 1 2 
        4 1 . . . . . 3.0 0.0 3.0 1 2 
        5 1 . . . . . 2.0 0.0 2.0 1 2 
        6 1 . . . . . 3.0 0.0 3.0 1 2 
        7 1 . . . . . 2.0 0.0 2.0 1 2 
        8 1 . . . . . 3.0 0.0 3.0 1 2 
        9 1 . . . . . 2.0 0.0 2.0 1 2 
       10 1 . . . . . 3.0 0.0 3.0 1 2 
       11 1 . . . . . 2.0 0.0 2.0 1 2 
       12 1 . . . . . 3.0 0.0 3.0 1 2 
       13 1 . . . . . 2.0 0.0 2.0 1 2 
       14 1 . . . . . 3.0 0.0 3.0 1 2 
       15 1 . . . . . 2.0 0.0 2.0 1 2 
       16 1 . . . . . 3.0 0.0 3.0 1 2 
       17 1 . . . . . 2.0 0.0 2.0 1 2 
       18 1 . . . . . 3.0 0.0 3.0 1 2 
       19 1 . . . . . 2.0 0.0 2.0 1 2 
       20 1 . . . . . 3.0 0.0 3.0 1 2 
       21 1 . . . . . 2.0 0.0 2.0 1 2 
       22 1 . . . . . 3.0 0.0 3.0 1 2 
       23 1 . . . . . 2.0 0.0 2.0 1 2 
       24 1 . . . . . 3.0 0.0 3.0 1 2 
       25 1 . . . . . 2.0 0.0 2.0 1 2 
       26 1 . . . . . 3.0 0.0 3.0 1 2 
       27 1 . . . . . 2.0 0.0 2.0 1 2 
       28 1 . . . . . 3.0 0.0 3.0 1 2 
       29 1 . . . . . 2.0 0.0 2.0 1 2 
       30 1 . . . . . 3.0 0.0 3.0 1 2 
       31 1 . . . . . 2.0 0.0 2.0 1 2 
       32 1 . . . . . 3.0 0.0 3.0 1 2 
       33 1 . . . . . 2.0 0.0 2.0 1 2 
       34 1 . . . . . 3.0 0.0 3.0 1 2 
       35 1 . . . . . 2.0 0.0 2.0 1 2 
       36 1 . . . . . 3.0 0.0 3.0 1 2 
       37 1 . . . . . 2.0 0.0 2.0 1 2 
       38 1 . . . . . 3.0 0.0 3.0 1 2 
       39 1 . . . . . 2.0 0.0 2.0 1 2 
       40 1 . . . . . 3.0 0.0 3.0 1 2 
       41 1 . . . . . 2.0 0.0 2.0 1 2 
       42 1 . . . . . 3.0 0.0 3.0 1 2 
       43 1 . . . . . 2.0 0.0 2.0 1 2 
       44 1 . . . . . 3.0 0.0 3.0 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_2
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   7 PHE C  1 1   8 VAL N  1 1   8 VAL CA  1 1   8 VAL C       -121.0 -44.999996 .   7 . C  .   8 . N  .   8 . CA  .   8 . C   1 1 
         2 . 1 1   8 VAL N  1 1   8 VAL CA 1 1   8 VAL C   1 1   9 CYS N        107.0      165.0 .   8 . N  .   8 . CA .   8 . C   .   9 . N   1 1 
         3 . 1 1   8 VAL C  1 1   9 CYS N  1 1   9 CYS CA  1 1   9 CYS C       -137.0      -73.0 .   8 . C  .   9 . N  .   9 . CA  .   9 . C   1 1 
         4 . 1 1   9 CYS N  1 1   9 CYS CA 1 1   9 CYS C   1 1  10 GLU N         91.0  162.99998 .   9 . N  .   9 . CA .   9 . C   .  10 . N   1 1 
         5 . 1 1  10 GLU C  1 1  11 LEU N  1 1  11 LEU CA  1 1  11 LEU C       -137.0      -83.0 .  10 . C  .  11 . N  .  11 . CA  .  11 . C   1 1 
         6 . 1 1  11 LEU N  1 1  11 LEU CA 1 1  11 LEU C   1 1  12 LYS N        103.0      141.0 .  11 . N  .  11 . CA .  11 . C   .  12 . N   1 1 
         7 . 1 1  11 LEU C  1 1  12 LYS N  1 1  12 LYS CA  1 1  12 LYS C       -155.0      -93.0 .  11 . C  .  12 . N  .  12 . CA  .  12 . C   1 1 
         8 . 1 1  12 LYS N  1 1  12 LYS CA 1 1  12 LYS C   1 1  13 GLU N    115.00001      177.0 .  12 . N  .  12 . CA .  12 . C   .  13 . N   1 1 
         9 . 1 1  12 LYS C  1 1  13 GLU N  1 1  13 GLU CA  1 1  13 GLU C       -113.0      -69.0 .  12 . C  .  13 . N  .  13 . CA  .  13 . C   1 1 
        10 . 1 1  13 GLU N  1 1  13 GLU CA 1 1  13 GLU C   1 1  14 LEU N        107.0      155.0 .  13 . N  .  13 . CA .  13 . C   .  14 . N   1 1 
        11 . 1 1  13 GLU C  1 1  14 LEU N  1 1  14 LEU CA  1 1  14 LEU C       -137.0      -47.0 .  13 . C  .  14 . N  .  14 . CA  .  14 . C   1 1 
        12 . 1 1  14 LEU N  1 1  14 LEU CA 1 1  14 LEU C   1 1  15 ALA N         81.0      187.0 .  14 . N  .  14 . CA .  14 . C   .  15 . N   1 1 
        13 . 1 1  14 LEU C  1 1  15 ALA N  1 1  15 ALA CA  1 1  15 ALA C       -125.0 -44.999996 .  14 . C  .  15 . N  .  15 . CA  .  15 . C   1 1 
        14 . 1 1  15 ALA N  1 1  15 ALA CA 1 1  15 ALA C   1 1  16 PRO N         83.0      165.0 .  15 . N  .  15 . CA .  15 . C   .  16 . N   1 1 
        15 . 1 1  15 ALA N  1 1  15 ALA CA 1 1  15 ALA C   1 1  16 PRO N       -215.0       85.0 .  15 . N  .  15 . CA .  15 . C   .  16 . N   1 1 
        16 . 1 1  18 PRO C  1 1  19 ALA N  1 1  19 ALA CA  1 1  19 ALA C   -162.99998      -69.0 .  18 . C  .  19 . N  .  19 . CA  .  19 . C   1 1 
        17 . 1 1  19 ALA N  1 1  19 ALA CA 1 1  19 ALA C   1 1  20 LEU N        131.0      181.0 .  19 . N  .  19 . CA .  19 . C   .  20 . N   1 1 
        18 . 1 1  19 ALA C  1 1  20 LEU N  1 1  20 LEU CA  1 1  20 LEU C       -171.0      -93.0 .  19 . C  .  20 . N  .  20 . CA  .  20 . C   1 1 
        19 . 1 1  20 LEU N  1 1  20 LEU CA 1 1  20 LEU C   1 1  21 LEU N        123.0      181.0 .  20 . N  .  20 . CA .  20 . C   .  21 . N   1 1 
        20 . 1 1  20 LEU C  1 1  21 LEU N  1 1  21 LEU CA  1 1  21 LEU C       -183.0      -85.0 .  20 . C  .  21 . N  .  21 . CA  .  21 . C   1 1 
        21 . 1 1  21 LEU N  1 1  21 LEU CA 1 1  21 LEU C   1 1  22 ILE N        133.0      173.0 .  21 . N  .  21 . CA .  21 . C   .  22 . N   1 1 
        22 . 1 1  21 LEU C  1 1  22 ILE N  1 1  22 ILE CA  1 1  22 ILE C   -174.99998      -87.0 .  21 . C  .  22 . N  .  22 . CA  .  22 . C   1 1 
        23 . 1 1  22 ILE N  1 1  22 ILE CA 1 1  22 ILE C   1 1  23 ARG N        107.0      171.0 .  22 . N  .  22 . CA .  22 . C   .  23 . N   1 1 
        24 . 1 1  22 ILE C  1 1  23 ARG N  1 1  23 ARG CA  1 1  23 ARG C       -145.0      -83.0 .  22 . C  .  23 . N  .  23 . CA  .  23 . C   1 1 
        25 . 1 1  23 ARG N  1 1  23 ARG CA 1 1  23 ARG C   1 1  24 THR N        101.0      159.0 .  23 . N  .  23 . CA .  23 . C   .  24 . N   1 1 
        26 . 1 1  23 ARG C  1 1  24 THR N  1 1  24 THR CA  1 1  24 THR C       -149.0      -85.0 .  23 . C  .  24 . N  .  24 . CA  .  24 . C   1 1 
        27 . 1 1  24 THR N  1 1  24 THR CA 1 1  24 THR C   1 1  25 GLN N        103.0      167.0 .  24 . N  .  24 . CA .  24 . C   .  25 . N   1 1 
        28 . 1 1  24 THR C  1 1  25 GLN N  1 1  25 GLN CA  1 1  25 GLN C       -139.0      -81.0 .  24 . C  .  25 . N  .  25 . CA  .  25 . C   1 1 
        29 . 1 1  25 GLN N  1 1  25 GLN CA 1 1  25 GLN C   1 1  26 THR N         89.0      159.0 .  25 . N  .  25 . CA .  25 . C   .  26 . N   1 1 
        30 . 1 1  25 GLN C  1 1  26 THR N  1 1  26 THR CA  1 1  26 THR C       -177.0      -57.0 .  25 . C  .  26 . N  .  26 . CA  .  26 . C   1 1 
        31 . 1 1  26 THR N  1 1  26 THR CA 1 1  26 THR C   1 1  27 ALA N        101.0      195.0 .  26 . N  .  26 . CA .  26 . C   .  27 . N   1 1 
        32 . 1 1  26 THR C  1 1  27 ALA N  1 1  27 ALA CA  1 1  27 ALA C       -173.0      -47.0 .  26 . C  .  27 . N  .  27 . CA  .  27 . C   1 1 
        33 . 1 1  27 ALA N  1 1  27 ALA CA 1 1  27 ALA C   1 1  28 MET N    127.00001      191.0 .  27 . N  .  27 . CA .  27 . C   .  28 . N   1 1 
        34 . 1 1  30 GLU C  1 1  31 LEU N  1 1  31 LEU CA  1 1  31 LEU C        -75.0 -44.999996 .  30 . C  .  31 . N  .  31 . CA  .  31 . C   1 1 
        35 . 1 1  31 LEU N  1 1  31 LEU CA 1 1  31 LEU C   1 1  32 GLY N        -59.0      -17.0 .  31 . N  .  31 . CA .  31 . C   .  32 . N   1 1 
        36 . 1 1  32 GLY C  1 1  33 SER N  1 1  33 SER CA  1 1  33 SER C        -77.0      -55.0 .  32 . C  .  33 . N  .  33 . CA  .  33 . C   1 1 
        37 . 1 1  33 SER N  1 1  33 SER CA 1 1  33 SER C   1 1  34 LEU N        -53.0 -30.999998 .  33 . N  .  33 . CA .  33 . C   .  34 . N   1 1 
        38 . 1 1  33 SER C  1 1  34 LEU N  1 1  34 LEU CA  1 1  34 LEU C        -73.0 -50.999996 .  33 . C  .  34 . N  .  34 . CA  .  34 . C   1 1 
        39 . 1 1  34 LEU N  1 1  34 LEU CA 1 1  34 LEU C   1 1  35 PHE N        -65.0      -21.0 .  34 . N  .  34 . CA .  34 . C   .  35 . N   1 1 
        40 . 1 1  34 LEU C  1 1  35 PHE N  1 1  35 PHE CA  1 1  35 PHE C        -97.0 -44.999996 .  34 . C  .  35 . N  .  35 . CA  .  35 . C   1 1 
        41 . 1 1  35 PHE N  1 1  35 PHE CA 1 1  35 PHE C   1 1  36 GLU N        -65.0       -5.0 .  35 . N  .  35 . CA .  35 . C   .  36 . N   1 1 
        42 . 1 1  35 PHE C  1 1  36 GLU N  1 1  36 GLU CA  1 1  36 GLU C        -73.0 -44.999996 .  35 . C  .  36 . N  .  36 . CA  .  36 . C   1 1 
        43 . 1 1  36 GLU N  1 1  36 GLU CA 1 1  36 GLU C   1 1  37 ALA N        -63.0      -19.0 .  36 . N  .  36 . CA .  36 . C   .  37 . N   1 1 
        44 . 1 1  36 GLU C  1 1  37 ALA N  1 1  37 ALA CA  1 1  37 ALA C        -97.0 -44.999996 .  36 . C  .  37 . N  .  37 . CA  .  37 . C   1 1 
        45 . 1 1  37 ALA N  1 1  37 ALA CA 1 1  37 ALA C   1 1  38 GLY N        -69.0       -5.0 .  37 . N  .  37 . CA .  37 . C   .  38 . N   1 1 
        46 . 1 1  37 ALA C  1 1  38 GLY N  1 1  38 GLY CA  1 1  38 GLY C        -75.0      -53.0 .  37 . C  .  38 . N  .  38 . CA  .  38 . C   1 1 
        47 . 1 1  38 GLY N  1 1  38 GLY CA 1 1  38 GLY C   1 1  39 TYR N        -55.0 -26.999998 .  38 . N  .  38 . CA .  38 . C   .  39 . N   1 1 
        48 . 1 1  38 GLY C  1 1  39 TYR N  1 1  39 TYR CA  1 1  39 TYR C        -81.0 -50.999996 .  38 . C  .  39 . N  .  39 . CA  .  39 . C   1 1 
        49 . 1 1  39 TYR N  1 1  39 TYR CA 1 1  39 TYR C   1 1  40 HIS N    -66.99999      -17.0 .  39 . N  .  39 . CA .  39 . C   .  40 . N   1 1 
        50 . 1 1  39 TYR C  1 1  40 HIS N  1 1  40 HIS CA  1 1  40 HIS C        -71.0      -49.0 .  39 . C  .  40 . N  .  40 . CA  .  40 . C   1 1 
        51 . 1 1  40 HIS N  1 1  40 HIS CA 1 1  40 HIS C   1 1  41 ASP N        -53.0      -33.0 .  40 . N  .  40 . CA .  40 . C   .  41 . N   1 1 
        52 . 1 1  50 GLY C  1 1  51 LYS N  1 1  51 LYS CA  1 1  51 LYS C       -157.0      -75.0 .  50 . C  .  51 . N  .  51 . CA  .  51 . C   1 1 
        53 . 1 1  51 LYS N  1 1  51 LYS CA 1 1  51 LYS C   1 1  52 SER N        141.0      183.0 .  51 . N  .  51 . CA .  51 . C   .  52 . N   1 1 
        54 . 1 1  51 LYS C  1 1  52 SER N  1 1  52 SER CA  1 1  52 SER C   -174.99998      -53.0 .  51 . C  .  52 . N  .  52 . CA  .  52 . C   1 1 
        55 . 1 1  52 SER N  1 1  52 SER CA 1 1  52 SER C   1 1  53 PRO N         69.0      165.0 .  52 . N  .  52 . CA .  52 . C   .  53 . N   1 1 
        56 . 1 1  52 SER N  1 1  52 SER CA 1 1  52 SER C   1 1  53 PRO N       -215.0       85.0 .  52 . N  .  52 . CA .  52 . C   .  53 . N   1 1 
        57 . 1 1  57 PRO C  1 1  58 PHE N  1 1  58 PHE CA  1 1  58 PHE C       -157.0 -116.99999 .  57 . C  .  58 . N  .  58 . CA  .  58 . C   1 1 
        58 . 1 1  58 PHE N  1 1  58 PHE CA 1 1  58 PHE C   1 1  59 ALA N    118.99999      181.0 .  58 . N  .  58 . CA .  58 . C   .  59 . N   1 1 
        59 . 1 1  58 PHE C  1 1  59 ALA N  1 1  59 ALA CA  1 1  59 ALA C       -165.0      -95.0 .  58 . C  .  59 . N  .  59 . CA  .  59 . C   1 1 
        60 . 1 1  59 ALA N  1 1  59 ALA CA 1 1  59 ALA C   1 1  60 ARG N        111.0      139.0 .  59 . N  .  59 . CA .  59 . C   .  60 . N   1 1 
        61 . 1 1  59 ALA C  1 1  60 ARG N  1 1  60 ARG CA  1 1  60 ARG C       -147.0      -85.0 .  59 . C  .  60 . N  .  60 . CA  .  60 . C   1 1 
        62 . 1 1  60 ARG N  1 1  60 ARG CA 1 1  60 ARG C   1 1  61 TYR N        111.0      161.0 .  60 . N  .  60 . CA .  60 . C   .  61 . N   1 1 
        63 . 1 1  60 ARG C  1 1  61 TYR N  1 1  61 TYR CA  1 1  61 TYR C   -150.99998     -101.0 .  60 . C  .  61 . N  .  61 . CA  .  61 . C   1 1 
        64 . 1 1  61 TYR N  1 1  61 TYR CA 1 1  61 TYR C   1 1  62 PHE N        109.0      165.0 .  61 . N  .  61 . CA .  61 . C   .  62 . N   1 1 
        65 . 1 1  61 TYR C  1 1  62 PHE N  1 1  62 PHE CA  1 1  62 PHE C   -118.99999      -57.0 .  61 . C  .  62 . N  .  62 . CA  .  62 . C   1 1 
        66 . 1 1  62 PHE N  1 1  62 PHE CA 1 1  62 PHE C   1 1  63 GLY N         95.0      173.0 .  62 . N  .  62 . CA .  62 . C   .  63 . N   1 1 
        67 . 1 1  67 GLY C  1 1  68 THR N  1 1  68 THR CA  1 1  68 THR C   -174.99998      -65.0 .  67 . C  .  68 . N  .  68 . CA  .  68 . C   1 1 
        68 . 1 1  68 THR N  1 1  68 THR CA 1 1  68 THR C   1 1  69 PHE N    127.00001      173.0 .  68 . N  .  68 . CA .  68 . C   .  69 . N   1 1 
        69 . 1 1  68 THR C  1 1  69 PHE N  1 1  69 PHE CA  1 1  69 PHE C       -177.0      -81.0 .  68 . C  .  69 . N  .  69 . CA  .  69 . C   1 1 
        70 . 1 1  69 PHE N  1 1  69 PHE CA 1 1  69 PHE C   1 1  70 GLU N    115.00001      185.0 .  69 . N  .  69 . CA .  69 . C   .  70 . N   1 1 
        71 . 1 1  69 PHE C  1 1  70 GLU N  1 1  70 GLU CA  1 1  70 GLU C   -162.99998  -66.99999 .  69 . C  .  70 . N  .  70 . CA  .  70 . C   1 1 
        72 . 1 1  70 GLU N  1 1  70 GLU CA 1 1  70 GLU C   1 1  71 VAL N         99.0  174.99998 .  70 . N  .  70 . CA .  70 . C   .  71 . N   1 1 
        73 . 1 1  70 GLU C  1 1  71 VAL N  1 1  71 VAL CA  1 1  71 VAL C       -155.0     -107.0 .  70 . C  .  71 . N  .  71 . CA  .  71 . C   1 1 
        74 . 1 1  71 VAL N  1 1  71 VAL CA 1 1  71 VAL C   1 1  72 GLU N        121.0      181.0 .  71 . N  .  71 . CA .  71 . C   .  72 . N   1 1 
        75 . 1 1  72 GLU C  1 1  73 PHE N  1 1  73 PHE CA  1 1  73 PHE C        -75.0      -53.0 .  72 . C  .  73 . N  .  73 . CA  .  73 . C   1 1 
        76 . 1 1  73 PHE N  1 1  73 PHE CA 1 1  73 PHE C   1 1  74 GLY N        -57.0       -5.0 .  73 . N  .  73 . CA .  73 . C   .  74 . N   1 1 
        77 . 1 1  74 GLY C  1 1  75 PHE N  1 1  75 PHE CA  1 1  75 PHE C       -161.0      -99.0 .  74 . C  .  75 . N  .  75 . CA  .  75 . C   1 1 
        78 . 1 1  75 PHE N  1 1  75 PHE CA 1 1  75 PHE C   1 1  76 PRO N        145.0      165.0 .  75 . N  .  75 . CA .  75 . C   .  76 . N   1 1 
        79 . 1 1  76 PRO C  1 1  77 VAL N  1 1  77 VAL CA  1 1  77 VAL C       -153.0 -116.99999 .  76 . C  .  77 . N  .  77 . CA  .  77 . C   1 1 
        80 . 1 1  77 VAL N  1 1  77 VAL CA 1 1  77 VAL C   1 1  78 GLU N        135.0      189.0 .  77 . N  .  77 . CA .  77 . C   .  78 . N   1 1 
        81 . 1 1  87 VAL C  1 1  88 VAL N  1 1  88 VAL CA  1 1  88 VAL C       -157.0      -99.0 .  87 . C  .  88 . N  .  88 . CA  .  88 . C   1 1 
        82 . 1 1  88 VAL N  1 1  88 VAL CA 1 1  88 VAL C   1 1  89 THR N        135.0      191.0 .  88 . N  .  88 . CA .  88 . C   .  89 . N   1 1 
        83 . 1 1  88 VAL C  1 1  89 THR N  1 1  89 THR CA  1 1  89 THR C       -181.0      -75.0 .  88 . C  .  89 . N  .  89 . CA  .  89 . C   1 1 
        84 . 1 1  89 THR N  1 1  89 THR CA 1 1  89 THR C   1 1  90 GLY N        143.0      183.0 .  89 . N  .  89 . CA .  89 . C   .  90 . N   1 1 
        85 . 1 1  90 GLY C  1 1  91 LEU N  1 1  91 LEU CA  1 1  91 LEU C       -161.0     -101.0 .  90 . C  .  91 . N  .  91 . CA  .  91 . C   1 1 
        86 . 1 1  91 LEU N  1 1  91 LEU CA 1 1  91 LEU C   1 1  92 THR N        131.0      189.0 .  91 . N  .  91 . CA .  91 . C   .  92 . N   1 1 
        87 . 1 1  91 LEU C  1 1  92 THR N  1 1  92 THR CA  1 1  92 THR C   -174.99998      -81.0 .  91 . C  .  92 . N  .  92 . CA  .  92 . C   1 1 
        88 . 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR C   1 1  93 PRO N         83.0      165.0 .  92 . N  .  92 . CA .  92 . C   .  93 . N   1 1 
        89 . 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR C   1 1  93 PRO N       -215.0       85.0 .  92 . N  .  92 . CA .  92 . C   .  93 . N   1 1 
        90 . 1 1  93 PRO C  1 1  94 SER N  1 1  94 SER CA  1 1  94 SER C   -174.99998      -79.0 .  93 . C  .  94 . N  .  94 . CA  .  94 . C   1 1 
        91 . 1 1  94 SER N  1 1  94 SER CA 1 1  94 SER C   1 1  95 GLY N        133.0      189.0 .  94 . N  .  94 . CA .  94 . C   .  95 . N   1 1 
        92 . 1 1  96 LYS C  1 1  97 ALA N  1 1  97 ALA CA  1 1  97 ALA C       -161.0 -115.00001 .  96 . C  .  97 . N  .  97 . CA  .  97 . C   1 1 
        93 . 1 1  97 ALA N  1 1  97 ALA CA 1 1  97 ALA C   1 1  98 ALA N        129.0  174.99998 .  97 . N  .  97 . CA .  97 . C   .  98 . N   1 1 
        94 . 1 1  97 ALA C  1 1  98 ALA N  1 1  98 ALA CA  1 1  98 ALA C       -167.0      -79.0 .  97 . C  .  98 . N  .  98 . CA  .  98 . C   1 1 
        95 . 1 1  98 ALA N  1 1  98 ALA CA 1 1  98 ALA C   1 1  99 SER N        101.0      165.0 .  98 . N  .  98 . CA .  98 . C   .  99 . N   1 1 
        96 . 1 1  98 ALA C  1 1  99 SER N  1 1  99 SER CA  1 1  99 SER C       -143.0      -81.0 .  98 . C  .  99 . N  .  99 . CA  .  99 . C   1 1 
        97 . 1 1  99 SER N  1 1  99 SER CA 1 1  99 SER C   1 1 100 SER N        121.0      161.0 .  99 . N  .  99 . CA .  99 . C   . 100 . N   1 1 
        98 . 1 1  99 SER C  1 1 100 SER N  1 1 100 SER CA  1 1 100 SER C       -165.0      -79.0 .  99 . C  . 100 . N  . 100 . CA  . 100 . C   1 1 
        99 . 1 1 100 SER N  1 1 100 SER CA 1 1 100 SER C   1 1 101 LEU N         89.0      173.0 . 100 . N  . 100 . CA . 100 . C   . 101 . N   1 1 
       100 . 1 1 100 SER C  1 1 101 LEU N  1 1 101 LEU CA  1 1 101 LEU C       -129.0      -63.0 . 100 . C  . 101 . N  . 101 . CA  . 101 . C   1 1 
       101 . 1 1 101 LEU N  1 1 101 LEU CA 1 1 101 LEU C   1 1 102 TYR N        101.0      157.0 . 101 . N  . 101 . CA . 101 . C   . 102 . N   1 1 
       102 . 1 1 101 LEU C  1 1 102 TYR N  1 1 102 TYR CA  1 1 102 TYR C       -159.0 -60.999996 . 101 . C  . 102 . N  . 102 . CA  . 102 . C   1 1 
       103 . 1 1 102 TYR N  1 1 102 TYR CA 1 1 102 TYR C   1 1 103 ILE N         97.0      149.0 . 102 . N  . 102 . CA . 102 . C   . 103 . N   1 1 
       104 . 1 1 102 TYR C  1 1 103 ILE N  1 1 103 ILE CA  1 1 103 ILE C       -137.0      -95.0 . 102 . C  . 103 . N  . 103 . CA  . 103 . C   1 1 
       105 . 1 1 103 ILE N  1 1 103 ILE CA 1 1 103 ILE C   1 1 104 GLY N        105.0      145.0 . 103 . N  . 103 . CA . 103 . C   . 104 . N   1 1 
       106 . 1 1 105 PRO C  1 1 106 TYR N  1 1 106 TYR CA  1 1 106 TYR C       -167.0      -97.0 . 105 . C  . 106 . N  . 106 . CA  . 106 . C   1 1 
       107 . 1 1 106 TYR N  1 1 106 TYR CA 1 1 106 TYR C   1 1 107 GLY N        135.0  174.99998 . 106 . N  . 106 . CA . 106 . C   . 107 . N   1 1 
       108 . 1 1 108 GLU C  1 1 109 ILE N  1 1 109 ILE CA  1 1 109 ILE C        -75.0 -44.999996 . 108 . C  . 109 . N  . 109 . CA  . 109 . C   1 1 
       109 . 1 1 109 ILE N  1 1 109 ILE CA 1 1 109 ILE C   1 1 110 GLU N        -73.0      -11.0 . 109 . N  . 109 . CA . 109 . C   . 110 . N   1 1 
       110 . 1 1 109 ILE C  1 1 110 GLU N  1 1 110 GLU CA  1 1 110 GLU C        -75.0      -49.0 . 109 . C  . 110 . N  . 110 . CA  . 110 . C   1 1 
       111 . 1 1 110 GLU N  1 1 110 GLU CA 1 1 110 GLU C   1 1 111 ALA N        -49.0      -23.0 . 110 . N  . 110 . CA . 110 . C   . 111 . N   1 1 
       112 . 1 1 110 GLU C  1 1 111 ALA N  1 1 111 ALA CA  1 1 111 ALA C        -77.0      -47.0 . 110 . C  . 111 . N  . 111 . CA  . 111 . C   1 1 
       113 . 1 1 111 ALA N  1 1 111 ALA CA 1 1 111 ALA C   1 1 112 VAL N        -59.0      -21.0 . 111 . N  . 111 . CA . 111 . C   . 112 . N   1 1 
       114 . 1 1 111 ALA C  1 1 112 VAL N  1 1 112 VAL CA  1 1 112 VAL C        -85.0      -55.0 . 111 . C  . 112 . N  . 112 . CA  . 112 . C   1 1 
       115 . 1 1 112 VAL N  1 1 112 VAL CA 1 1 112 VAL C   1 1 113 TYR N        -55.0      -29.0 . 112 . N  . 112 . CA . 112 . C   . 113 . N   1 1 
       116 . 1 1 112 VAL C  1 1 113 TYR N  1 1 113 TYR CA  1 1 113 TYR C        -71.0      -49.0 . 112 . C  . 113 . N  . 113 . CA  . 113 . C   1 1 
       117 . 1 1 113 TYR N  1 1 113 TYR CA 1 1 113 TYR C   1 1 114 ASP N        -71.0      -29.0 . 113 . N  . 113 . CA . 113 . C   . 114 . N   1 1 
       118 . 1 1 113 TYR C  1 1 114 ASP N  1 1 114 ASP CA  1 1 114 ASP C        -73.0 -50.999996 . 113 . C  . 114 . N  . 114 . CA  . 114 . C   1 1 
       119 . 1 1 114 ASP N  1 1 114 ASP CA 1 1 114 ASP C   1 1 115 ALA N        -53.0      -23.0 . 114 . N  . 114 . CA . 114 . C   . 115 . N   1 1 
       120 . 1 1 114 ASP C  1 1 115 ALA N  1 1 115 ALA CA  1 1 115 ALA C        -95.0 -44.999996 . 114 . C  . 115 . N  . 115 . CA  . 115 . C   1 1 
       121 . 1 1 115 ALA N  1 1 115 ALA CA 1 1 115 ALA C   1 1 116 LEU N        -53.0      -21.0 . 115 . N  . 115 . CA . 115 . C   . 116 . N   1 1 
       122 . 1 1 115 ALA C  1 1 116 LEU N  1 1 116 LEU CA  1 1 116 LEU C        -75.0 -50.999996 . 115 . C  . 116 . N  . 116 . CA  . 116 . C   1 1 
       123 . 1 1 116 LEU N  1 1 116 LEU CA 1 1 116 LEU C   1 1 117 MET N        -57.0      -29.0 . 116 . N  . 116 . CA . 116 . C   . 117 . N   1 1 
       124 . 1 1 116 LEU C  1 1 117 MET N  1 1 117 MET CA  1 1 117 MET C        -73.0 -50.999996 . 116 . C  . 117 . N  . 117 . CA  . 117 . C   1 1 
       125 . 1 1 117 MET N  1 1 117 MET CA 1 1 117 MET C   1 1 118 LYS N   -50.999996      -29.0 . 117 . N  . 117 . CA . 117 . C   . 118 . N   1 1 
       126 . 1 1 117 MET C  1 1 118 LYS N  1 1 118 LYS CA  1 1 118 LYS C        -77.0      -55.0 . 117 . C  . 118 . N  . 118 . CA  . 118 . C   1 1 
       127 . 1 1 118 LYS N  1 1 118 LYS CA 1 1 118 LYS C   1 1 119 TRP N   -60.999996      -23.0 . 118 . N  . 118 . CA . 118 . C   . 119 . N   1 1 
       128 . 1 1 118 LYS C  1 1 119 TRP N  1 1 119 TRP CA  1 1 119 TRP C        -75.0      -49.0 . 118 . C  . 119 . N  . 119 . CA  . 119 . C   1 1 
       129 . 1 1 119 TRP N  1 1 119 TRP CA 1 1 119 TRP C   1 1 120 VAL N        -53.0 -30.999998 . 119 . N  . 119 . CA . 119 . C   . 120 . N   1 1 
       130 . 1 1 119 TRP C  1 1 120 VAL N  1 1 120 VAL CA  1 1 120 VAL C        -75.0      -53.0 . 119 . C  . 120 . N  . 120 . CA  . 120 . C   1 1 
       131 . 1 1 120 VAL N  1 1 120 VAL CA 1 1 120 VAL C   1 1 121 ASP N        -53.0 -30.999998 . 120 . N  . 120 . CA . 120 . C   . 121 . N   1 1 
       132 . 1 1 120 VAL C  1 1 121 ASP N  1 1 121 ASP CA  1 1 121 ASP C        -71.0      -49.0 . 120 . C  . 121 . N  . 121 . CA  . 121 . C   1 1 
       133 . 1 1 121 ASP N  1 1 121 ASP CA 1 1 121 ASP C   1 1 122 ASP N        -57.0      -19.0 . 121 . N  . 121 . CA . 121 . C   . 122 . N   1 1 
       134 . 1 1 121 ASP C  1 1 122 ASP N  1 1 122 ASP CA  1 1 122 ASP C        -81.0      -49.0 . 121 . C  . 122 . N  . 122 . CA  . 122 . C   1 1 
       135 . 1 1 122 ASP N  1 1 122 ASP CA 1 1 122 ASP C   1 1 123 ASN N        -57.0      -13.0 . 122 . N  . 122 . CA . 122 . C   . 123 . N   1 1 
       136 . 1 1 122 ASP C  1 1 123 ASN N  1 1 123 ASN CA  1 1 123 ASN C       -129.0 -60.999996 . 122 . C  . 123 . N  . 123 . CA  . 123 . C   1 1 
       137 . 1 1 123 ASN N  1 1 123 ASN CA 1 1 123 ASN C   1 1 124 GLY N        -37.0  30.999998 . 123 . N  . 123 . CA . 123 . C   . 124 . N   1 1 
       138 . 1 1 123 ASN C  1 1 124 GLY N  1 1 124 GLY CA  1 1 124 GLY C         49.0       89.0 . 123 . C  . 124 . N  . 124 . CA  . 124 . C   1 1 
       139 . 1 1 124 GLY N  1 1 124 GLY CA 1 1 124 GLY C   1 1 125 PHE N         -9.0       63.0 . 124 . N  . 124 . CA . 124 . C   . 125 . N   1 1 
       140 . 1 1 124 GLY C  1 1 125 PHE N  1 1 125 PHE CA  1 1 125 PHE C       -177.0      -87.0 . 124 . C  . 125 . N  . 125 . CA  . 125 . C   1 1 
       141 . 1 1 125 PHE N  1 1 125 PHE CA 1 1 125 PHE C   1 1 126 ASP N        137.0      177.0 . 125 . N  . 125 . CA . 125 . C   . 126 . N   1 1 
       142 . 1 1 125 PHE C  1 1 126 ASP N  1 1 126 ASP CA  1 1 126 ASP C       -169.0      -83.0 . 125 . C  . 126 . N  . 126 . CA  . 126 . C   1 1 
       143 . 1 1 126 ASP N  1 1 126 ASP CA 1 1 126 ASP C   1 1 127 LEU N    127.00001      179.0 . 126 . N  . 126 . CA . 126 . C   . 127 . N   1 1 
       144 . 1 1 126 ASP C  1 1 127 LEU N  1 1 127 LEU CA  1 1 127 LEU C       -145.0 -44.999996 . 126 . C  . 127 . N  . 127 . CA  . 127 . C   1 1 
       145 . 1 1 127 LEU N  1 1 127 LEU CA 1 1 127 LEU C   1 1 128 SER N    116.99999      167.0 . 127 . N  . 127 . CA . 127 . C   . 128 . N   1 1 
       146 . 1 1 129 GLY C  1 1 130 GLU N  1 1 130 GLU CA  1 1 130 GLU C       -153.0      -81.0 . 129 . C  . 130 . N  . 130 . CA  . 130 . C   1 1 
       147 . 1 1 130 GLU N  1 1 130 GLU CA 1 1 130 GLU C   1 1 131 ALA N        103.0      169.0 . 130 . N  . 130 . CA . 130 . C   . 131 . N   1 1 
       148 . 1 1 130 GLU C  1 1 131 ALA N  1 1 131 ALA CA  1 1 131 ALA C       -153.0      -89.0 . 130 . C  . 131 . N  . 131 . CA  . 131 . C   1 1 
       149 . 1 1 131 ALA N  1 1 131 ALA CA 1 1 131 ALA C   1 1 132 TYR N        111.0      153.0 . 131 . N  . 131 . CA . 131 . C   . 132 . N   1 1 
       150 . 1 1 131 ALA C  1 1 132 TYR N  1 1 132 TYR CA  1 1 132 TYR C       -143.0      -91.0 . 131 . C  . 132 . N  . 132 . CA  . 132 . C   1 1 
       151 . 1 1 132 TYR N  1 1 132 TYR CA 1 1 132 TYR C   1 1 133 GLU N        113.0      149.0 . 132 . N  . 132 . CA . 132 . C   . 133 . N   1 1 
       152 . 1 1 132 TYR C  1 1 133 GLU N  1 1 133 GLU CA  1 1 133 GLU C   -162.99998      -81.0 . 132 . C  . 133 . N  . 133 . CA  . 133 . C   1 1 
       153 . 1 1 133 GLU N  1 1 133 GLU CA 1 1 133 GLU C   1 1 134 ILE N    118.99999      167.0 . 133 . N  . 133 . CA . 133 . C   . 134 . N   1 1 
       154 . 1 1 133 GLU C  1 1 134 ILE N  1 1 134 ILE CA  1 1 134 ILE C       -171.0      -83.0 . 133 . C  . 134 . N  . 134 . CA  . 134 . C   1 1 
       155 . 1 1 134 ILE N  1 1 134 ILE CA 1 1 134 ILE C   1 1 135 TYR N        109.0      173.0 . 134 . N  . 134 . CA . 134 . C   . 135 . N   1 1 
       156 . 1 1 147 LEU C  1 1 148 ARG N  1 1 148 ARG CA  1 1 148 ARG C       -157.0      -79.0 . 147 . C  . 148 . N  . 148 . CA  . 148 . C   1 1 
       157 . 1 1 148 ARG N  1 1 148 ARG CA 1 1 148 ARG C   1 1 149 THR N        105.0  162.99998 . 148 . N  . 148 . CA . 148 . C   . 149 . N   1 1 
       158 . 1 1 148 ARG C  1 1 149 THR N  1 1 149 THR CA  1 1 149 THR C       -149.0     -101.0 . 148 . C  . 149 . N  . 149 . CA  . 149 . C   1 1 
       159 . 1 1 149 THR N  1 1 149 THR CA 1 1 149 THR C   1 1 150 ARG N         91.0      187.0 . 149 . N  . 149 . CA . 149 . C   . 150 . N   1 1 
       160 . 1 1 149 THR C  1 1 150 ARG N  1 1 150 ARG CA  1 1 150 ARG C       -133.0  -66.99999 . 149 . C  . 150 . N  . 150 . CA  . 150 . C   1 1 
       161 . 1 1 150 ARG N  1 1 150 ARG CA 1 1 150 ARG C   1 1 151 VAL N         91.0      145.0 . 150 . N  . 150 . CA . 150 . C   . 151 . N   1 1 
       162 . 1 1 150 ARG C  1 1 151 VAL N  1 1 151 VAL CA  1 1 151 VAL C       -123.0      -91.0 . 150 . C  . 151 . N  . 151 . CA  . 151 . C   1 1 
       163 . 1 1 151 VAL N  1 1 151 VAL CA 1 1 151 VAL C   1 1 152 SER N    115.00001      149.0 . 151 . N  . 151 . CA . 151 . C   . 152 . N   1 1 
       164 . 1 1 151 VAL C  1 1 152 SER N  1 1 152 SER CA  1 1 152 SER C   -162.99998     -105.0 . 151 . C  . 152 . N  . 152 . CA  . 152 . C   1 1 
       165 . 1 1 152 SER N  1 1 152 SER CA 1 1 152 SER C   1 1 153 LEU N        121.0      187.0 . 152 . N  . 152 . CA . 152 . C   . 153 . N   1 1 
       166 . 1 1 152 SER C  1 1 153 LEU N  1 1 153 LEU CA  1 1 153 LEU C       -179.0      -65.0 . 152 . C  . 153 . N  . 153 . CA  . 153 . C   1 1 
       167 . 1 1 153 LEU N  1 1 153 LEU CA 1 1 153 LEU C   1 1 154 MET N    60.999996      195.0 . 153 . N  . 153 . CA . 153 . C   . 154 . N   1 1 
       168 . 1 1   1 MET N  1 1   1 MET CA 1 1   1 MET CB  1 1   1 MET CG        25.0      335.0 .   1 . N  .   1 . CA .   1 . CB  .   1 . CG  1 1 
       169 . 1 1   1 MET N  1 1   1 MET CA 1 1   1 MET CB  1 1   1 MET CG      -205.0       95.0 .   1 . N  .   1 . CA .   1 . CB  .   1 . CG  1 1 
       170 . 1 1   1 MET CA 1 1   1 MET CB 1 1   1 MET CG  1 1   1 MET SD   44.999996      315.0 .   1 . CA .   1 . CB .   1 . CG  .   1 . SD  1 1 
       171 . 1 1   1 MET N  1 1   1 MET CA 1 1   1 MET C   1 1   2 ASP N        -85.0      195.0 .   1 . N  .   1 . CA .   1 . C   .   2 . N   1 1 
       172 . 1 1   1 MET C  1 1   2 ASP N  1 1   2 ASP CA  1 1   2 ASP C    44.999996      315.0 .   1 . C  .   2 . N  .   2 . CA  .   2 . C   1 1 
       173 . 1 1   1 MET C  1 1   2 ASP N  1 1   2 ASP CA  1 1   2 ASP C       -185.0       75.0 .   1 . C  .   2 . N  .   2 . CA  .   2 . C   1 1 
       174 . 1 1   2 ASP N  1 1   2 ASP CA 1 1   2 ASP CB  1 1   2 ASP CG      -225.0  115.00001 .   2 . N  .   2 . CA .   2 . CB  .   2 . CG  1 1 
       175 . 1 1   2 ASP N  1 1   2 ASP CA 1 1   2 ASP C   1 1   3 PHE N        -85.0      205.0 .   2 . N  .   2 . CA .   2 . C   .   3 . N   1 1 
       176 . 1 1   2 ASP C  1 1   3 PHE N  1 1   3 PHE CA  1 1   3 PHE C    44.999996      315.0 .   2 . C  .   3 . N  .   3 . CA  .   3 . C   1 1 
       177 . 1 1   2 ASP C  1 1   3 PHE N  1 1   3 PHE CA  1 1   3 PHE C       -185.0       75.0 .   2 . C  .   3 . N  .   3 . CA  .   3 . C   1 1 
       178 . 1 1   3 PHE N  1 1   3 PHE CA 1 1   3 PHE CB  1 1   3 PHE CG        25.0      335.0 .   3 . N  .   3 . CA .   3 . CB  .   3 . CG  1 1 
       179 . 1 1   3 PHE N  1 1   3 PHE CA 1 1   3 PHE CB  1 1   3 PHE CG      -205.0       95.0 .   3 . N  .   3 . CA .   3 . CB  .   3 . CG  1 1 
       180 . 1 1   3 PHE CA 1 1   3 PHE CB 1 1   3 PHE CG  1 1   3 PHE CD1       25.0      335.0 .   3 . CA .   3 . CB .   3 . CG  .   3 . CD1 1 1 
       181 . 1 1   3 PHE CA 1 1   3 PHE CB 1 1   3 PHE CG  1 1   3 PHE CD1     -155.0      155.0 .   3 . CA .   3 . CB .   3 . CG  .   3 . CD1 1 1 
       182 . 1 1   3 PHE N  1 1   3 PHE CA 1 1   3 PHE C   1 1   4 GLU N        -85.0      195.0 .   3 . N  .   3 . CA .   3 . C   .   4 . N   1 1 
       183 . 1 1   3 PHE C  1 1   4 GLU N  1 1   4 GLU CA  1 1   4 GLU C    44.999996      315.0 .   3 . C  .   4 . N  .   4 . CA  .   4 . C   1 1 
       184 . 1 1   3 PHE C  1 1   4 GLU N  1 1   4 GLU CA  1 1   4 GLU C       -185.0       75.0 .   3 . C  .   4 . N  .   4 . CA  .   4 . C   1 1 
       185 . 1 1   4 GLU N  1 1   4 GLU CA 1 1   4 GLU CB  1 1   4 GLU CG        25.0      335.0 .   4 . N  .   4 . CA .   4 . CB  .   4 . CG  1 1 
       186 . 1 1   4 GLU N  1 1   4 GLU CA 1 1   4 GLU CB  1 1   4 GLU CG      -205.0       95.0 .   4 . N  .   4 . CA .   4 . CB  .   4 . CG  1 1 
       187 . 1 1   4 GLU CA 1 1   4 GLU CB 1 1   4 GLU CG  1 1   4 GLU CD        15.0      345.0 .   4 . CA .   4 . CB .   4 . CG  .   4 . CD  1 1 
       188 . 1 1   4 GLU N  1 1   4 GLU CA 1 1   4 GLU C   1 1   5 CYS N        -85.0      195.0 .   4 . N  .   4 . CA .   4 . C   .   5 . N   1 1 
       189 . 1 1   4 GLU C  1 1   5 CYS N  1 1   5 CYS CA  1 1   5 CYS C    44.999996      315.0 .   4 . C  .   5 . N  .   5 . CA  .   5 . C   1 1 
       190 . 1 1   4 GLU C  1 1   5 CYS N  1 1   5 CYS CA  1 1   5 CYS C       -185.0       75.0 .   4 . C  .   5 . N  .   5 . CA  .   5 . C   1 1 
       191 . 1 1   5 CYS N  1 1   5 CYS CA 1 1   5 CYS CB  1 1   5 CYS SG        25.0      335.0 .   5 . N  .   5 . CA .   5 . CB  .   5 . SG  1 1 
       192 . 1 1   5 CYS N  1 1   5 CYS CA 1 1   5 CYS CB  1 1   5 CYS SG      -205.0       85.0 .   5 . N  .   5 . CA .   5 . CB  .   5 . SG  1 1 
       193 . 1 1   5 CYS N  1 1   5 CYS CA 1 1   5 CYS C   1 1   6 GLN N        -85.0      195.0 .   5 . N  .   5 . CA .   5 . C   .   6 . N   1 1 
       194 . 1 1   5 CYS C  1 1   6 GLN N  1 1   6 GLN CA  1 1   6 GLN C    44.999996      315.0 .   5 . C  .   6 . N  .   6 . CA  .   6 . C   1 1 
       195 . 1 1   5 CYS C  1 1   6 GLN N  1 1   6 GLN CA  1 1   6 GLN C       -185.0       75.0 .   5 . C  .   6 . N  .   6 . CA  .   6 . C   1 1 
       196 . 1 1   6 GLN N  1 1   6 GLN CA 1 1   6 GLN CB  1 1   6 GLN CG        25.0      335.0 .   6 . N  .   6 . CA .   6 . CB  .   6 . CG  1 1 
       197 . 1 1   6 GLN N  1 1   6 GLN CA 1 1   6 GLN CB  1 1   6 GLN CG      -205.0       95.0 .   6 . N  .   6 . CA .   6 . CB  .   6 . CG  1 1 
       198 . 1 1   6 GLN CA 1 1   6 GLN CB 1 1   6 GLN CG  1 1   6 GLN CD        15.0      345.0 .   6 . CA .   6 . CB .   6 . CG  .   6 . CD  1 1 
       199 . 1 1   6 GLN N  1 1   6 GLN CA 1 1   6 GLN C   1 1   7 PHE N   -174.99998      165.0 .   6 . N  .   6 . CA .   6 . C   .   7 . N   1 1 
       200 . 1 1   6 GLN N  1 1   6 GLN CA 1 1   6 GLN C   1 1   7 PHE N         -5.0      195.0 .   6 . N  .   6 . CA .   6 . C   .   7 . N   1 1 
       201 . 1 1   6 GLN C  1 1   7 PHE N  1 1   7 PHE CA  1 1   7 PHE C    44.999996      315.0 .   6 . C  .   7 . N  .   7 . CA  .   7 . C   1 1 
       202 . 1 1   6 GLN C  1 1   7 PHE N  1 1   7 PHE CA  1 1   7 PHE C       -185.0       75.0 .   6 . C  .   7 . N  .   7 . CA  .   7 . C   1 1 
       203 . 1 1   7 PHE N  1 1   7 PHE CA 1 1   7 PHE CB  1 1   7 PHE CG        25.0      335.0 .   7 . N  .   7 . CA .   7 . CB  .   7 . CG  1 1 
       204 . 1 1   7 PHE N  1 1   7 PHE CA 1 1   7 PHE CB  1 1   7 PHE CG      -205.0       95.0 .   7 . N  .   7 . CA .   7 . CB  .   7 . CG  1 1 
       205 . 1 1   7 PHE CA 1 1   7 PHE CB 1 1   7 PHE CG  1 1   7 PHE CD1       25.0      335.0 .   7 . CA .   7 . CB .   7 . CG  .   7 . CD1 1 1 
       206 . 1 1   7 PHE CA 1 1   7 PHE CB 1 1   7 PHE CG  1 1   7 PHE CD1     -155.0      155.0 .   7 . CA .   7 . CB .   7 . CG  .   7 . CD1 1 1 
       207 . 1 1   7 PHE N  1 1   7 PHE CA 1 1   7 PHE C   1 1   8 VAL N          5.0      195.0 .   7 . N  .   7 . CA .   7 . C   .   8 . N   1 1 
       208 . 1 1   8 VAL N  1 1   8 VAL CA 1 1   8 VAL CB  1 1   8 VAL CG1  44.999996      205.0 .   8 . N  .   8 . CA .   8 . CB  .   8 . CG1 1 1 
       209 . 1 1   8 VAL N  1 1   8 VAL CA 1 1   8 VAL CB  1 1   8 VAL CG1     -195.0       85.0 .   8 . N  .   8 . CA .   8 . CB  .   8 . CG1 1 1 
       210 . 1 1   9 CYS N  1 1   9 CYS CA 1 1   9 CYS CB  1 1   9 CYS SG        25.0      335.0 .   9 . N  .   9 . CA .   9 . CB  .   9 . SG  1 1 
       211 . 1 1   9 CYS N  1 1   9 CYS CA 1 1   9 CYS CB  1 1   9 CYS SG      -205.0       85.0 .   9 . N  .   9 . CA .   9 . CB  .   9 . SG  1 1 
       212 . 1 1   9 CYS C  1 1  10 GLU N  1 1  10 GLU CA  1 1  10 GLU C    44.999996      315.0 .   9 . C  .  10 . N  .  10 . CA  .  10 . C   1 1 
       213 . 1 1   9 CYS C  1 1  10 GLU N  1 1  10 GLU CA  1 1  10 GLU C       -185.0       75.0 .   9 . C  .  10 . N  .  10 . CA  .  10 . C   1 1 
       214 . 1 1  10 GLU N  1 1  10 GLU CA 1 1  10 GLU CB  1 1  10 GLU CG        25.0      335.0 .  10 . N  .  10 . CA .  10 . CB  .  10 . CG  1 1 
       215 . 1 1  10 GLU N  1 1  10 GLU CA 1 1  10 GLU CB  1 1  10 GLU CG      -205.0       95.0 .  10 . N  .  10 . CA .  10 . CB  .  10 . CG  1 1 
       216 . 1 1  10 GLU CA 1 1  10 GLU CB 1 1  10 GLU CG  1 1  10 GLU CD        15.0      345.0 .  10 . CA .  10 . CB .  10 . CG  .  10 . CD  1 1 
       217 . 1 1  10 GLU N  1 1  10 GLU CA 1 1  10 GLU C   1 1  11 LEU N       -255.0       15.0 .  10 . N  .  10 . CA .  10 . C   .  11 . N   1 1 
       218 . 1 1  10 GLU N  1 1  10 GLU CA 1 1  10 GLU C   1 1  11 LEU N        -25.0      195.0 .  10 . N  .  10 . CA .  10 . C   .  11 . N   1 1 
       219 . 1 1  11 LEU N  1 1  11 LEU CA 1 1  11 LEU CB  1 1  11 LEU CG        15.0      335.0 .  11 . N  .  11 . CA .  11 . CB  .  11 . CG  1 1 
       220 . 1 1  11 LEU N  1 1  11 LEU CA 1 1  11 LEU CB  1 1  11 LEU CG      -215.0       55.0 .  11 . N  .  11 . CA .  11 . CB  .  11 . CG  1 1 
       221 . 1 1  11 LEU CA 1 1  11 LEU CB 1 1  11 LEU CG  1 1  11 LEU CD1       35.0      325.0 .  11 . CA .  11 . CB .  11 . CG  .  11 . CD1 1 1 
       222 . 1 1  11 LEU CA 1 1  11 LEU CB 1 1  11 LEU CG  1 1  11 LEU CD1      -95.0      205.0 .  11 . CA .  11 . CB .  11 . CG  .  11 . CD1 1 1 
       223 . 1 1  12 LYS N  1 1  12 LYS CA 1 1  12 LYS CB  1 1  12 LYS CG        25.0      335.0 .  12 . N  .  12 . CA .  12 . CB  .  12 . CG  1 1 
       224 . 1 1  12 LYS N  1 1  12 LYS CA 1 1  12 LYS CB  1 1  12 LYS CG      -205.0       95.0 .  12 . N  .  12 . CA .  12 . CB  .  12 . CG  1 1 
       225 . 1 1  12 LYS CA 1 1  12 LYS CB 1 1  12 LYS CG  1 1  12 LYS CD        35.0      325.0 .  12 . CA .  12 . CB .  12 . CG  .  12 . CD  1 1 
       226 . 1 1  13 GLU N  1 1  13 GLU CA 1 1  13 GLU CB  1 1  13 GLU CG        25.0      335.0 .  13 . N  .  13 . CA .  13 . CB  .  13 . CG  1 1 
       227 . 1 1  13 GLU N  1 1  13 GLU CA 1 1  13 GLU CB  1 1  13 GLU CG      -205.0       95.0 .  13 . N  .  13 . CA .  13 . CB  .  13 . CG  1 1 
       228 . 1 1  13 GLU CA 1 1  13 GLU CB 1 1  13 GLU CG  1 1  13 GLU CD        15.0      345.0 .  13 . CA .  13 . CB .  13 . CG  .  13 . CD  1 1 
       229 . 1 1  14 LEU N  1 1  14 LEU CA 1 1  14 LEU CB  1 1  14 LEU CG         5.0  354.99997 .  14 . N  .  14 . CA .  14 . CB  .  14 . CG  1 1 
       230 . 1 1  14 LEU N  1 1  14 LEU CA 1 1  14 LEU CB  1 1  14 LEU CG      -215.0      105.0 .  14 . N  .  14 . CA .  14 . CB  .  14 . CG  1 1 
       231 . 1 1  14 LEU CA 1 1  14 LEU CB 1 1  14 LEU CG  1 1  14 LEU CD1       35.0      325.0 .  14 . CA .  14 . CB .  14 . CG  .  14 . CD1 1 1 
       232 . 1 1  14 LEU CA 1 1  14 LEU CB 1 1  14 LEU CG  1 1  14 LEU CD1      -95.0      205.0 .  14 . CA .  14 . CB .  14 . CG  .  14 . CD1 1 1 
       233 . 1 1  16 PRO N  1 1  16 PRO CA 1 1  16 PRO C   1 1  17 VAL N         65.0      195.0 .  16 . N  .  16 . CA .  16 . C   .  17 . N   1 1 
       234 . 1 1  16 PRO C  1 1  17 VAL N  1 1  17 VAL CA  1 1  17 VAL C    44.999996      315.0 .  16 . C  .  17 . N  .  17 . CA  .  17 . C   1 1 
       235 . 1 1  16 PRO C  1 1  17 VAL N  1 1  17 VAL CA  1 1  17 VAL C       -185.0       75.0 .  16 . C  .  17 . N  .  17 . CA  .  17 . C   1 1 
       236 . 1 1  17 VAL N  1 1  17 VAL CA 1 1  17 VAL CB  1 1  17 VAL CG1  44.999996      305.0 .  17 . N  .  17 . CA .  17 . CB  .  17 . CG1 1 1 
       237 . 1 1  17 VAL N  1 1  17 VAL CA 1 1  17 VAL CB  1 1  17 VAL CG1     -185.0       55.0 .  17 . N  .  17 . CA .  17 . CB  .  17 . CG1 1 1 
       238 . 1 1  17 VAL N  1 1  17 VAL CA 1 1  17 VAL CB  1 1  17 VAL CG1      -95.0      205.0 .  17 . N  .  17 . CA .  17 . CB  .  17 . CG1 1 1 
       239 . 1 1  17 VAL N  1 1  17 VAL CA 1 1  17 VAL C   1 1  18 PRO N         55.0      165.0 .  17 . N  .  17 . CA .  17 . C   .  18 . N   1 1 
       240 . 1 1  17 VAL N  1 1  17 VAL CA 1 1  17 VAL C   1 1  18 PRO N       -215.0       85.0 .  17 . N  .  17 . CA .  17 . C   .  18 . N   1 1 
       241 . 1 1  18 PRO N  1 1  18 PRO CA 1 1  18 PRO C   1 1  19 ALA N         85.0      195.0 .  18 . N  .  18 . CA .  18 . C   .  19 . N   1 1 
       242 . 1 1  20 LEU N  1 1  20 LEU CA 1 1  20 LEU CB  1 1  20 LEU CG         5.0  354.99997 .  20 . N  .  20 . CA .  20 . CB  .  20 . CG  1 1 
       243 . 1 1  20 LEU N  1 1  20 LEU CA 1 1  20 LEU CB  1 1  20 LEU CG      -215.0      105.0 .  20 . N  .  20 . CA .  20 . CB  .  20 . CG  1 1 
       244 . 1 1  20 LEU CA 1 1  20 LEU CB 1 1  20 LEU CG  1 1  20 LEU CD1       35.0      325.0 .  20 . CA .  20 . CB .  20 . CG  .  20 . CD1 1 1 
       245 . 1 1  20 LEU CA 1 1  20 LEU CB 1 1  20 LEU CG  1 1  20 LEU CD1      -95.0      205.0 .  20 . CA .  20 . CB .  20 . CG  .  20 . CD1 1 1 
       246 . 1 1  21 LEU N  1 1  21 LEU CA 1 1  21 LEU CB  1 1  21 LEU CG         5.0  354.99997 .  21 . N  .  21 . CA .  21 . CB  .  21 . CG  1 1 
       247 . 1 1  21 LEU N  1 1  21 LEU CA 1 1  21 LEU CB  1 1  21 LEU CG      -215.0      105.0 .  21 . N  .  21 . CA .  21 . CB  .  21 . CG  1 1 
       248 . 1 1  21 LEU CA 1 1  21 LEU CB 1 1  21 LEU CG  1 1  21 LEU CD1       35.0      325.0 .  21 . CA .  21 . CB .  21 . CG  .  21 . CD1 1 1 
       249 . 1 1  21 LEU CA 1 1  21 LEU CB 1 1  21 LEU CG  1 1  21 LEU CD1      -95.0      205.0 .  21 . CA .  21 . CB .  21 . CG  .  21 . CD1 1 1 
       250 . 1 1  22 ILE N  1 1  22 ILE CA 1 1  22 ILE CB  1 1  22 ILE CG1       25.0      335.0 .  22 . N  .  22 . CA .  22 . CB  .  22 . CG1 1 1 
       251 . 1 1  22 ILE N  1 1  22 ILE CA 1 1  22 ILE CB  1 1  22 ILE CG1     -195.0       85.0 .  22 . N  .  22 . CA .  22 . CB  .  22 . CG1 1 1 
       252 . 1 1  22 ILE N  1 1  22 ILE CA 1 1  22 ILE CB  1 1  22 ILE CG1      -75.0      205.0 .  22 . N  .  22 . CA .  22 . CB  .  22 . CG1 1 1 
       253 . 1 1  22 ILE CA 1 1  22 ILE CB 1 1  22 ILE CG1 1 1  22 ILE CD1  44.999996      315.0 .  22 . CA .  22 . CB .  22 . CG1 .  22 . CD1 1 1 
       254 . 1 1  22 ILE CA 1 1  22 ILE CB 1 1  22 ILE CG1 1 1  22 ILE CD1      -85.0      195.0 .  22 . CA .  22 . CB .  22 . CG1 .  22 . CD1 1 1 
       255 . 1 1  23 ARG N  1 1  23 ARG CA 1 1  23 ARG CB  1 1  23 ARG CG        25.0      335.0 .  23 . N  .  23 . CA .  23 . CB  .  23 . CG  1 1 
       256 . 1 1  23 ARG N  1 1  23 ARG CA 1 1  23 ARG CB  1 1  23 ARG CG      -205.0       95.0 .  23 . N  .  23 . CA .  23 . CB  .  23 . CG  1 1 
       257 . 1 1  23 ARG CA 1 1  23 ARG CB 1 1  23 ARG CG  1 1  23 ARG CD        35.0      325.0 .  23 . CA .  23 . CB .  23 . CG  .  23 . CD  1 1 
       258 . 1 1  24 THR N  1 1  24 THR CA 1 1  24 THR CB  1 1  24 THR OG1     -215.0       95.0 .  24 . N  .  24 . CA .  24 . CB  .  24 . OG1 1 1 
       259 . 1 1  24 THR N  1 1  24 THR CA 1 1  24 THR CB  1 1  24 THR OG1      -75.0      205.0 .  24 . N  .  24 . CA .  24 . CB  .  24 . OG1 1 1 
       260 . 1 1  25 GLN N  1 1  25 GLN CA 1 1  25 GLN CB  1 1  25 GLN CG        25.0      335.0 .  25 . N  .  25 . CA .  25 . CB  .  25 . CG  1 1 
       261 . 1 1  25 GLN N  1 1  25 GLN CA 1 1  25 GLN CB  1 1  25 GLN CG      -205.0       95.0 .  25 . N  .  25 . CA .  25 . CB  .  25 . CG  1 1 
       262 . 1 1  25 GLN CA 1 1  25 GLN CB 1 1  25 GLN CG  1 1  25 GLN CD        15.0      345.0 .  25 . CA .  25 . CB .  25 . CG  .  25 . CD  1 1 
       263 . 1 1  26 THR N  1 1  26 THR CA 1 1  26 THR CB  1 1  26 THR OG1     -215.0       95.0 .  26 . N  .  26 . CA .  26 . CB  .  26 . OG1 1 1 
       264 . 1 1  26 THR N  1 1  26 THR CA 1 1  26 THR CB  1 1  26 THR OG1      -75.0      205.0 .  26 . N  .  26 . CA .  26 . CB  .  26 . OG1 1 1 
       265 . 1 1  27 ALA C  1 1  28 MET N  1 1  28 MET CA  1 1  28 MET C    44.999996      315.0 .  27 . C  .  28 . N  .  28 . CA  .  28 . C   1 1 
       266 . 1 1  27 ALA C  1 1  28 MET N  1 1  28 MET CA  1 1  28 MET C       -185.0       75.0 .  27 . C  .  28 . N  .  28 . CA  .  28 . C   1 1 
       267 . 1 1  28 MET N  1 1  28 MET CA 1 1  28 MET CB  1 1  28 MET CG        25.0      335.0 .  28 . N  .  28 . CA .  28 . CB  .  28 . CG  1 1 
       268 . 1 1  28 MET N  1 1  28 MET CA 1 1  28 MET CB  1 1  28 MET CG      -205.0       95.0 .  28 . N  .  28 . CA .  28 . CB  .  28 . CG  1 1 
       269 . 1 1  28 MET CA 1 1  28 MET CB 1 1  28 MET CG  1 1  28 MET SD   44.999996      315.0 .  28 . CA .  28 . CB .  28 . CG  .  28 . SD  1 1 
       270 . 1 1  28 MET N  1 1  28 MET CA 1 1  28 MET C   1 1  29 SER N        -85.0      195.0 .  28 . N  .  28 . CA .  28 . C   .  29 . N   1 1 
       271 . 1 1  28 MET C  1 1  29 SER N  1 1  29 SER CA  1 1  29 SER C    44.999996      315.0 .  28 . C  .  29 . N  .  29 . CA  .  29 . C   1 1 
       272 . 1 1  28 MET C  1 1  29 SER N  1 1  29 SER CA  1 1  29 SER C       -185.0       75.0 .  28 . C  .  29 . N  .  29 . CA  .  29 . C   1 1 
       273 . 1 1  29 SER N  1 1  29 SER CA 1 1  29 SER C   1 1  30 GLU N        -85.0      135.0 .  29 . N  .  29 . CA .  29 . C   .  30 . N   1 1 
       274 . 1 1  29 SER C  1 1  30 GLU N  1 1  30 GLU CA  1 1  30 GLU C    44.999996      315.0 .  29 . C  .  30 . N  .  30 . CA  .  30 . C   1 1 
       275 . 1 1  29 SER C  1 1  30 GLU N  1 1  30 GLU CA  1 1  30 GLU C       -185.0       75.0 .  29 . C  .  30 . N  .  30 . CA  .  30 . C   1 1 
       276 . 1 1  30 GLU N  1 1  30 GLU CA 1 1  30 GLU CB  1 1  30 GLU CG        25.0      335.0 .  30 . N  .  30 . CA .  30 . CB  .  30 . CG  1 1 
       277 . 1 1  30 GLU N  1 1  30 GLU CA 1 1  30 GLU CB  1 1  30 GLU CG      -205.0       95.0 .  30 . N  .  30 . CA .  30 . CB  .  30 . CG  1 1 
       278 . 1 1  30 GLU CA 1 1  30 GLU CB 1 1  30 GLU CG  1 1  30 GLU CD        15.0      345.0 .  30 . CA .  30 . CB .  30 . CG  .  30 . CD  1 1 
       279 . 1 1  30 GLU N  1 1  30 GLU CA 1 1  30 GLU C   1 1  31 LEU N        -85.0  115.00001 .  30 . N  .  30 . CA .  30 . C   .  31 . N   1 1 
       280 . 1 1  31 LEU N  1 1  31 LEU CA 1 1  31 LEU CB  1 1  31 LEU CG      -325.0      -25.0 .  31 . N  .  31 . CA .  31 . CB  .  31 . CG  1 1 
       281 . 1 1  31 LEU N  1 1  31 LEU CA 1 1  31 LEU CB  1 1  31 LEU CG      -215.0      105.0 .  31 . N  .  31 . CA .  31 . CB  .  31 . CG  1 1 
       282 . 1 1  31 LEU CA 1 1  31 LEU CB 1 1  31 LEU CG  1 1  31 LEU CD1       35.0      325.0 .  31 . CA .  31 . CB .  31 . CG  .  31 . CD1 1 1 
       283 . 1 1  31 LEU CA 1 1  31 LEU CB 1 1  31 LEU CG  1 1  31 LEU CD1      -95.0      205.0 .  31 . CA .  31 . CB .  31 . CG  .  31 . CD1 1 1 
       284 . 1 1  31 LEU C  1 1  32 GLY N  1 1  32 GLY CA  1 1  32 GLY C    44.999996      315.0 .  31 . C  .  32 . N  .  32 . CA  .  32 . C   1 1 
       285 . 1 1  32 GLY N  1 1  32 GLY CA 1 1  32 GLY C   1 1  33 SER N       -125.0      125.0 .  32 . N  .  32 . CA .  32 . C   .  33 . N   1 1 
       286 . 1 1  34 LEU N  1 1  34 LEU CA 1 1  34 LEU CB  1 1  34 LEU CG      -325.0      -25.0 .  34 . N  .  34 . CA .  34 . CB  .  34 . CG  1 1 
       287 . 1 1  34 LEU N  1 1  34 LEU CA 1 1  34 LEU CB  1 1  34 LEU CG      -215.0       95.0 .  34 . N  .  34 . CA .  34 . CB  .  34 . CG  1 1 
       288 . 1 1  34 LEU CA 1 1  34 LEU CB 1 1  34 LEU CG  1 1  34 LEU CD1       35.0      325.0 .  34 . CA .  34 . CB .  34 . CG  .  34 . CD1 1 1 
       289 . 1 1  34 LEU CA 1 1  34 LEU CB 1 1  34 LEU CG  1 1  34 LEU CD1      -95.0      205.0 .  34 . CA .  34 . CB .  34 . CG  .  34 . CD1 1 1 
       290 . 1 1  35 PHE N  1 1  35 PHE CA 1 1  35 PHE CB  1 1  35 PHE CG      -325.0      -25.0 .  35 . N  .  35 . CA .  35 . CB  .  35 . CG  1 1 
       291 . 1 1  35 PHE N  1 1  35 PHE CA 1 1  35 PHE CB  1 1  35 PHE CG      -205.0       95.0 .  35 . N  .  35 . CA .  35 . CB  .  35 . CG  1 1 
       292 . 1 1  35 PHE CA 1 1  35 PHE CB 1 1  35 PHE CG  1 1  35 PHE CD1       25.0      335.0 .  35 . CA .  35 . CB .  35 . CG  .  35 . CD1 1 1 
       293 . 1 1  35 PHE CA 1 1  35 PHE CB 1 1  35 PHE CG  1 1  35 PHE CD1     -155.0      155.0 .  35 . CA .  35 . CB .  35 . CG  .  35 . CD1 1 1 
       294 . 1 1  36 GLU N  1 1  36 GLU CA 1 1  36 GLU CB  1 1  36 GLU CG        35.0      325.0 .  36 . N  .  36 . CA .  36 . CB  .  36 . CG  1 1 
       295 . 1 1  36 GLU N  1 1  36 GLU CA 1 1  36 GLU CB  1 1  36 GLU CG      -275.0       65.0 .  36 . N  .  36 . CA .  36 . CB  .  36 . CG  1 1 
       296 . 1 1  36 GLU N  1 1  36 GLU CA 1 1  36 GLU CB  1 1  36 GLU CG      -205.0       95.0 .  36 . N  .  36 . CA .  36 . CB  .  36 . CG  1 1 
       297 . 1 1  36 GLU CA 1 1  36 GLU CB 1 1  36 GLU CG  1 1  36 GLU CD        15.0      345.0 .  36 . CA .  36 . CB .  36 . CG  .  36 . CD  1 1 
       298 . 1 1  39 TYR N  1 1  39 TYR CA 1 1  39 TYR CB  1 1  39 TYR CG      -325.0      -25.0 .  39 . N  .  39 . CA .  39 . CB  .  39 . CG  1 1 
       299 . 1 1  39 TYR N  1 1  39 TYR CA 1 1  39 TYR CB  1 1  39 TYR CG      -205.0       95.0 .  39 . N  .  39 . CA .  39 . CB  .  39 . CG  1 1 
       300 . 1 1  39 TYR CA 1 1  39 TYR CB 1 1  39 TYR CG  1 1  39 TYR CD1       25.0      335.0 .  39 . CA .  39 . CB .  39 . CG  .  39 . CD1 1 1 
       301 . 1 1  39 TYR CA 1 1  39 TYR CB 1 1  39 TYR CG  1 1  39 TYR CD1     -155.0      155.0 .  39 . CA .  39 . CB .  39 . CG  .  39 . CD1 1 1 
       302 . 1 1  40 HIS N  1 1  40 HIS CA 1 1  40 HIS CB  1 1  40 HIS CG        35.0      325.0 .  40 . N  .  40 . CA .  40 . CB  .  40 . CG  1 1 
       303 . 1 1  40 HIS N  1 1  40 HIS CA 1 1  40 HIS CB  1 1  40 HIS CG      -205.0       85.0 .  40 . N  .  40 . CA .  40 . CB  .  40 . CG  1 1 
       304 . 1 1  40 HIS C  1 1  41 ASP N  1 1  41 ASP CA  1 1  41 ASP C    44.999996      315.0 .  40 . C  .  41 . N  .  41 . CA  .  41 . C   1 1 
       305 . 1 1  40 HIS C  1 1  41 ASP N  1 1  41 ASP CA  1 1  41 ASP C       -185.0       75.0 .  40 . C  .  41 . N  .  41 . CA  .  41 . C   1 1 
       306 . 1 1  41 ASP N  1 1  41 ASP CA 1 1  41 ASP CB  1 1  41 ASP CG      -225.0  115.00001 .  41 . N  .  41 . CA .  41 . CB  .  41 . CG  1 1 
       307 . 1 1  41 ASP N  1 1  41 ASP CA 1 1  41 ASP C   1 1  42 ILE N        -85.0      205.0 .  41 . N  .  41 . CA .  41 . C   .  42 . N   1 1 
       308 . 1 1  41 ASP C  1 1  42 ILE N  1 1  42 ILE CA  1 1  42 ILE C    44.999996      315.0 .  41 . C  .  42 . N  .  42 . CA  .  42 . C   1 1 
       309 . 1 1  41 ASP C  1 1  42 ILE N  1 1  42 ILE CA  1 1  42 ILE C       -185.0       75.0 .  41 . C  .  42 . N  .  42 . CA  .  42 . C   1 1 
       310 . 1 1  42 ILE N  1 1  42 ILE CA 1 1  42 ILE CB  1 1  42 ILE CG1       25.0      335.0 .  42 . N  .  42 . CA .  42 . CB  .  42 . CG1 1 1 
       311 . 1 1  42 ILE N  1 1  42 ILE CA 1 1  42 ILE CB  1 1  42 ILE CG1     -195.0       85.0 .  42 . N  .  42 . CA .  42 . CB  .  42 . CG1 1 1 
       312 . 1 1  42 ILE N  1 1  42 ILE CA 1 1  42 ILE CB  1 1  42 ILE CG1      -75.0      205.0 .  42 . N  .  42 . CA .  42 . CB  .  42 . CG1 1 1 
       313 . 1 1  42 ILE CA 1 1  42 ILE CB 1 1  42 ILE CG1 1 1  42 ILE CD1  44.999996      315.0 .  42 . CA .  42 . CB .  42 . CG1 .  42 . CD1 1 1 
       314 . 1 1  42 ILE CA 1 1  42 ILE CB 1 1  42 ILE CG1 1 1  42 ILE CD1      -85.0      195.0 .  42 . CA .  42 . CB .  42 . CG1 .  42 . CD1 1 1 
       315 . 1 1  42 ILE N  1 1  42 ILE CA 1 1  42 ILE C   1 1  43 LEU N        -85.0      195.0 .  42 . N  .  42 . CA .  42 . C   .  43 . N   1 1 
       316 . 1 1  42 ILE C  1 1  43 LEU N  1 1  43 LEU CA  1 1  43 LEU C    44.999996      315.0 .  42 . C  .  43 . N  .  43 . CA  .  43 . C   1 1 
       317 . 1 1  42 ILE C  1 1  43 LEU N  1 1  43 LEU CA  1 1  43 LEU C       -185.0       75.0 .  42 . C  .  43 . N  .  43 . CA  .  43 . C   1 1 
       318 . 1 1  43 LEU N  1 1  43 LEU CA 1 1  43 LEU CB  1 1  43 LEU CG         5.0  354.99997 .  43 . N  .  43 . CA .  43 . CB  .  43 . CG  1 1 
       319 . 1 1  43 LEU N  1 1  43 LEU CA 1 1  43 LEU CB  1 1  43 LEU CG      -215.0      105.0 .  43 . N  .  43 . CA .  43 . CB  .  43 . CG  1 1 
       320 . 1 1  43 LEU CA 1 1  43 LEU CB 1 1  43 LEU CG  1 1  43 LEU CD1       35.0      325.0 .  43 . CA .  43 . CB .  43 . CG  .  43 . CD1 1 1 
       321 . 1 1  43 LEU CA 1 1  43 LEU CB 1 1  43 LEU CG  1 1  43 LEU CD1      -95.0      205.0 .  43 . CA .  43 . CB .  43 . CG  .  43 . CD1 1 1 
       322 . 1 1  43 LEU N  1 1  43 LEU CA 1 1  43 LEU C   1 1  44 GLN N        -85.0      205.0 .  43 . N  .  43 . CA .  43 . C   .  44 . N   1 1 
       323 . 1 1  43 LEU C  1 1  44 GLN N  1 1  44 GLN CA  1 1  44 GLN C    44.999996      315.0 .  43 . C  .  44 . N  .  44 . CA  .  44 . C   1 1 
       324 . 1 1  43 LEU C  1 1  44 GLN N  1 1  44 GLN CA  1 1  44 GLN C       -185.0       75.0 .  43 . C  .  44 . N  .  44 . CA  .  44 . C   1 1 
       325 . 1 1  44 GLN N  1 1  44 GLN CA 1 1  44 GLN CB  1 1  44 GLN CG        25.0      335.0 .  44 . N  .  44 . CA .  44 . CB  .  44 . CG  1 1 
       326 . 1 1  44 GLN N  1 1  44 GLN CA 1 1  44 GLN CB  1 1  44 GLN CG      -205.0       95.0 .  44 . N  .  44 . CA .  44 . CB  .  44 . CG  1 1 
       327 . 1 1  44 GLN CA 1 1  44 GLN CB 1 1  44 GLN CG  1 1  44 GLN CD        15.0      345.0 .  44 . CA .  44 . CB .  44 . CG  .  44 . CD  1 1 
       328 . 1 1  44 GLN N  1 1  44 GLN CA 1 1  44 GLN C   1 1  45 LEU N        -85.0  115.00001 .  44 . N  .  44 . CA .  44 . C   .  45 . N   1 1 
       329 . 1 1  44 GLN C  1 1  45 LEU N  1 1  45 LEU CA  1 1  45 LEU C    44.999996      315.0 .  44 . C  .  45 . N  .  45 . CA  .  45 . C   1 1 
       330 . 1 1  44 GLN C  1 1  45 LEU N  1 1  45 LEU CA  1 1  45 LEU C       -185.0       75.0 .  44 . C  .  45 . N  .  45 . CA  .  45 . C   1 1 
       331 . 1 1  45 LEU N  1 1  45 LEU CA 1 1  45 LEU CB  1 1  45 LEU CG         5.0  354.99997 .  45 . N  .  45 . CA .  45 . CB  .  45 . CG  1 1 
       332 . 1 1  45 LEU N  1 1  45 LEU CA 1 1  45 LEU CB  1 1  45 LEU CG      -215.0      105.0 .  45 . N  .  45 . CA .  45 . CB  .  45 . CG  1 1 
       333 . 1 1  45 LEU CA 1 1  45 LEU CB 1 1  45 LEU CG  1 1  45 LEU CD1       35.0      325.0 .  45 . CA .  45 . CB .  45 . CG  .  45 . CD1 1 1 
       334 . 1 1  45 LEU CA 1 1  45 LEU CB 1 1  45 LEU CG  1 1  45 LEU CD1      -95.0      205.0 .  45 . CA .  45 . CB .  45 . CG  .  45 . CD1 1 1 
       335 . 1 1  45 LEU N  1 1  45 LEU CA 1 1  45 LEU C   1 1  46 LEU N        -85.0      125.0 .  45 . N  .  45 . CA .  45 . C   .  46 . N   1 1 
       336 . 1 1  45 LEU C  1 1  46 LEU N  1 1  46 LEU CA  1 1  46 LEU C       -185.0 -44.999996 .  45 . C  .  46 . N  .  46 . CA  .  46 . C   1 1 
       337 . 1 1  46 LEU N  1 1  46 LEU CA 1 1  46 LEU CB  1 1  46 LEU CG  -174.99998       -5.0 .  46 . N  .  46 . CA .  46 . CB  .  46 . CG  1 1 
       338 . 1 1  46 LEU CA 1 1  46 LEU CB 1 1  46 LEU CG  1 1  46 LEU CD1       35.0      325.0 .  46 . CA .  46 . CB .  46 . CG  .  46 . CD1 1 1 
       339 . 1 1  46 LEU CA 1 1  46 LEU CB 1 1  46 LEU CG  1 1  46 LEU CD1      -95.0      205.0 .  46 . CA .  46 . CB .  46 . CG  .  46 . CD1 1 1 
       340 . 1 1  46 LEU N  1 1  46 LEU CA 1 1  46 LEU C   1 1  47 ALA N        -85.0       -5.0 .  46 . N  .  46 . CA .  46 . C   .  47 . N   1 1 
       341 . 1 1  46 LEU C  1 1  47 ALA N  1 1  47 ALA CA  1 1  47 ALA C    44.999996      315.0 .  46 . C  .  47 . N  .  47 . CA  .  47 . C   1 1 
       342 . 1 1  46 LEU C  1 1  47 ALA N  1 1  47 ALA CA  1 1  47 ALA C       -185.0       75.0 .  46 . C  .  47 . N  .  47 . CA  .  47 . C   1 1 
       343 . 1 1  47 ALA N  1 1  47 ALA CA 1 1  47 ALA C   1 1  48 GLY N        -85.0      105.0 .  47 . N  .  47 . CA .  47 . C   .  48 . N   1 1 
       344 . 1 1  47 ALA C  1 1  48 GLY N  1 1  48 GLY CA  1 1  48 GLY C    44.999996      315.0 .  47 . C  .  48 . N  .  48 . CA  .  48 . C   1 1 
       345 . 1 1  48 GLY N  1 1  48 GLY CA 1 1  48 GLY C   1 1  49 GLN N   -115.00001  115.00001 .  48 . N  .  48 . CA .  48 . C   .  49 . N   1 1 
       346 . 1 1  48 GLY C  1 1  49 GLN N  1 1  49 GLN CA  1 1  49 GLN C    44.999996      315.0 .  48 . C  .  49 . N  .  49 . CA  .  49 . C   1 1 
       347 . 1 1  48 GLY C  1 1  49 GLN N  1 1  49 GLN CA  1 1  49 GLN C       -185.0       75.0 .  48 . C  .  49 . N  .  49 . CA  .  49 . C   1 1 
       348 . 1 1  49 GLN N  1 1  49 GLN CA 1 1  49 GLN CB  1 1  49 GLN CG        25.0      335.0 .  49 . N  .  49 . CA .  49 . CB  .  49 . CG  1 1 
       349 . 1 1  49 GLN N  1 1  49 GLN CA 1 1  49 GLN CB  1 1  49 GLN CG      -205.0       95.0 .  49 . N  .  49 . CA .  49 . CB  .  49 . CG  1 1 
       350 . 1 1  49 GLN CA 1 1  49 GLN CB 1 1  49 GLN CG  1 1  49 GLN CD        15.0      345.0 .  49 . CA .  49 . CB .  49 . CG  .  49 . CD  1 1 
       351 . 1 1  49 GLN N  1 1  49 GLN CA 1 1  49 GLN C   1 1  50 GLY N        -85.0       85.0 .  49 . N  .  49 . CA .  49 . C   .  50 . N   1 1 
       352 . 1 1  49 GLN C  1 1  50 GLY N  1 1  50 GLY CA  1 1  50 GLY C    44.999996      315.0 .  49 . C  .  50 . N  .  50 . CA  .  50 . C   1 1 
       353 . 1 1  50 GLY N  1 1  50 GLY CA 1 1  50 GLY C   1 1  51 LYS N       -125.0      125.0 .  50 . N  .  50 . CA .  50 . C   .  51 . N   1 1 
       354 . 1 1  51 LYS N  1 1  51 LYS CA 1 1  51 LYS CB  1 1  51 LYS CG        25.0      335.0 .  51 . N  .  51 . CA .  51 . CB  .  51 . CG  1 1 
       355 . 1 1  51 LYS N  1 1  51 LYS CA 1 1  51 LYS CB  1 1  51 LYS CG      -155.0       95.0 .  51 . N  .  51 . CA .  51 . CB  .  51 . CG  1 1 
       356 . 1 1  51 LYS CA 1 1  51 LYS CB 1 1  51 LYS CG  1 1  51 LYS CD        35.0      325.0 .  51 . CA .  51 . CB .  51 . CG  .  51 . CD  1 1 
       357 . 1 1  53 PRO N  1 1  53 PRO CA 1 1  53 PRO C   1 1  54 SER N        125.0      195.0 .  53 . N  .  53 . CA .  53 . C   .  54 . N   1 1 
       358 . 1 1  53 PRO C  1 1  54 SER N  1 1  54 SER CA  1 1  54 SER C    44.999996      315.0 .  53 . C  .  54 . N  .  54 . CA  .  54 . C   1 1 
       359 . 1 1  53 PRO C  1 1  54 SER N  1 1  54 SER CA  1 1  54 SER C       -185.0       75.0 .  53 . C  .  54 . N  .  54 . CA  .  54 . C   1 1 
       360 . 1 1  54 SER N  1 1  54 SER CA 1 1  54 SER C   1 1  55 GLY N        -85.0      105.0 .  54 . N  .  54 . CA .  54 . C   .  55 . N   1 1 
       361 . 1 1  54 SER C  1 1  55 GLY N  1 1  55 GLY CA  1 1  55 GLY C    44.999996      315.0 .  54 . C  .  55 . N  .  55 . CA  .  55 . C   1 1 
       362 . 1 1  55 GLY N  1 1  55 GLY CA 1 1  55 GLY C   1 1  56 PRO N         55.0      295.0 .  55 . N  .  55 . CA .  55 . C   .  56 . N   1 1 
       363 . 1 1  55 GLY N  1 1  55 GLY CA 1 1  55 GLY C   1 1  56 PRO N       -205.0       85.0 .  55 . N  .  55 . CA .  55 . C   .  56 . N   1 1 
       364 . 1 1  55 GLY N  1 1  55 GLY CA 1 1  55 GLY C   1 1  56 PRO N        -95.0      205.0 .  55 . N  .  55 . CA .  55 . C   .  56 . N   1 1 
       365 . 1 1  56 PRO N  1 1  56 PRO CA 1 1  56 PRO C   1 1  57 PRO N        155.0  174.99998 .  56 . N  .  56 . CA .  56 . C   .  57 . N   1 1 
       366 . 1 1  57 PRO N  1 1  57 PRO CA 1 1  57 PRO C   1 1  58 PHE N       -295.0       -5.0 .  57 . N  .  57 . CA .  57 . C   .  58 . N   1 1 
       367 . 1 1  57 PRO N  1 1  57 PRO CA 1 1  57 PRO C   1 1  58 PHE N        -35.0      195.0 .  57 . N  .  57 . CA .  57 . C   .  58 . N   1 1 
       368 . 1 1  58 PHE N  1 1  58 PHE CA 1 1  58 PHE CB  1 1  58 PHE CG        25.0      335.0 .  58 . N  .  58 . CA .  58 . CB  .  58 . CG  1 1 
       369 . 1 1  58 PHE N  1 1  58 PHE CA 1 1  58 PHE CB  1 1  58 PHE CG      -205.0       95.0 .  58 . N  .  58 . CA .  58 . CB  .  58 . CG  1 1 
       370 . 1 1  58 PHE CA 1 1  58 PHE CB 1 1  58 PHE CG  1 1  58 PHE CD1       25.0      335.0 .  58 . CA .  58 . CB .  58 . CG  .  58 . CD1 1 1 
       371 . 1 1  58 PHE CA 1 1  58 PHE CB 1 1  58 PHE CG  1 1  58 PHE CD1     -155.0      155.0 .  58 . CA .  58 . CB .  58 . CG  .  58 . CD1 1 1 
       372 . 1 1  60 ARG N  1 1  60 ARG CA 1 1  60 ARG CB  1 1  60 ARG CG        25.0      335.0 .  60 . N  .  60 . CA .  60 . CB  .  60 . CG  1 1 
       373 . 1 1  60 ARG N  1 1  60 ARG CA 1 1  60 ARG CB  1 1  60 ARG CG      -205.0       95.0 .  60 . N  .  60 . CA .  60 . CB  .  60 . CG  1 1 
       374 . 1 1  60 ARG CA 1 1  60 ARG CB 1 1  60 ARG CG  1 1  60 ARG CD        35.0      325.0 .  60 . CA .  60 . CB .  60 . CG  .  60 . CD  1 1 
       375 . 1 1  61 TYR N  1 1  61 TYR CA 1 1  61 TYR CB  1 1  61 TYR CG        25.0      335.0 .  61 . N  .  61 . CA .  61 . CB  .  61 . CG  1 1 
       376 . 1 1  61 TYR N  1 1  61 TYR CA 1 1  61 TYR CB  1 1  61 TYR CG      -205.0       95.0 .  61 . N  .  61 . CA .  61 . CB  .  61 . CG  1 1 
       377 . 1 1  61 TYR CA 1 1  61 TYR CB 1 1  61 TYR CG  1 1  61 TYR CD1       25.0      335.0 .  61 . CA .  61 . CB .  61 . CG  .  61 . CD1 1 1 
       378 . 1 1  61 TYR CA 1 1  61 TYR CB 1 1  61 TYR CG  1 1  61 TYR CD1     -155.0      155.0 .  61 . CA .  61 . CB .  61 . CG  .  61 . CD1 1 1 
       379 . 1 1  62 PHE N  1 1  62 PHE CA 1 1  62 PHE CB  1 1  62 PHE CG        25.0      335.0 .  62 . N  .  62 . CA .  62 . CB  .  62 . CG  1 1 
       380 . 1 1  62 PHE N  1 1  62 PHE CA 1 1  62 PHE CB  1 1  62 PHE CG      -205.0       95.0 .  62 . N  .  62 . CA .  62 . CB  .  62 . CG  1 1 
       381 . 1 1  62 PHE CA 1 1  62 PHE CB 1 1  62 PHE CG  1 1  62 PHE CD1       25.0      335.0 .  62 . CA .  62 . CB .  62 . CG  .  62 . CD1 1 1 
       382 . 1 1  62 PHE CA 1 1  62 PHE CB 1 1  62 PHE CG  1 1  62 PHE CD1     -155.0      155.0 .  62 . CA .  62 . CB .  62 . CG  .  62 . CD1 1 1 
       383 . 1 1  62 PHE C  1 1  63 GLY N  1 1  63 GLY CA  1 1  63 GLY C    44.999996      315.0 .  62 . C  .  63 . N  .  63 . CA  .  63 . C   1 1 
       384 . 1 1  63 GLY C  1 1  64 MET N  1 1  64 MET CA  1 1  64 MET C    44.999996      315.0 .  63 . C  .  64 . N  .  64 . CA  .  64 . C   1 1 
       385 . 1 1  63 GLY C  1 1  64 MET N  1 1  64 MET CA  1 1  64 MET C       -185.0       75.0 .  63 . C  .  64 . N  .  64 . CA  .  64 . C   1 1 
       386 . 1 1  64 MET N  1 1  64 MET CA 1 1  64 MET CB  1 1  64 MET CG        25.0      335.0 .  64 . N  .  64 . CA .  64 . CB  .  64 . CG  1 1 
       387 . 1 1  64 MET N  1 1  64 MET CA 1 1  64 MET CB  1 1  64 MET CG      -205.0       95.0 .  64 . N  .  64 . CA .  64 . CB  .  64 . CG  1 1 
       388 . 1 1  64 MET CA 1 1  64 MET CB 1 1  64 MET CG  1 1  64 MET SD   44.999996      315.0 .  64 . CA .  64 . CB .  64 . CG  .  64 . SD  1 1 
       389 . 1 1  64 MET N  1 1  64 MET CA 1 1  64 MET C   1 1  65 SER N        -85.0      195.0 .  64 . N  .  64 . CA .  64 . C   .  65 . N   1 1 
       390 . 1 1  64 MET C  1 1  65 SER N  1 1  65 SER CA  1 1  65 SER C    44.999996      315.0 .  64 . C  .  65 . N  .  65 . CA  .  65 . C   1 1 
       391 . 1 1  64 MET C  1 1  65 SER N  1 1  65 SER CA  1 1  65 SER C       -185.0       75.0 .  64 . C  .  65 . N  .  65 . CA  .  65 . C   1 1 
       392 . 1 1  65 SER N  1 1  65 SER CA 1 1  65 SER C   1 1  66 ALA N        -85.0      205.0 .  65 . N  .  65 . CA .  65 . C   .  66 . N   1 1 
       393 . 1 1  65 SER C  1 1  66 ALA N  1 1  66 ALA CA  1 1  66 ALA C    44.999996      315.0 .  65 . C  .  66 . N  .  66 . CA  .  66 . C   1 1 
       394 . 1 1  65 SER C  1 1  66 ALA N  1 1  66 ALA CA  1 1  66 ALA C       -185.0       75.0 .  65 . C  .  66 . N  .  66 . CA  .  66 . C   1 1 
       395 . 1 1  66 ALA N  1 1  66 ALA CA 1 1  66 ALA C   1 1  67 GLY N        -85.0      205.0 .  66 . N  .  66 . CA .  66 . C   .  67 . N   1 1 
       396 . 1 1  66 ALA C  1 1  67 GLY N  1 1  67 GLY CA  1 1  67 GLY C    44.999996      315.0 .  66 . C  .  67 . N  .  67 . CA  .  67 . C   1 1 
       397 . 1 1  67 GLY N  1 1  67 GLY CA 1 1  67 GLY C   1 1  68 THR N       -145.0      145.0 .  67 . N  .  67 . CA .  67 . C   .  68 . N   1 1 
       398 . 1 1  68 THR N  1 1  68 THR CA 1 1  68 THR CB  1 1  68 THR OG1     -215.0       85.0 .  68 . N  .  68 . CA .  68 . CB  .  68 . OG1 1 1 
       399 . 1 1  68 THR N  1 1  68 THR CA 1 1  68 THR CB  1 1  68 THR OG1      -75.0      205.0 .  68 . N  .  68 . CA .  68 . CB  .  68 . OG1 1 1 
       400 . 1 1  69 PHE N  1 1  69 PHE CA 1 1  69 PHE CB  1 1  69 PHE CG        25.0      335.0 .  69 . N  .  69 . CA .  69 . CB  .  69 . CG  1 1 
       401 . 1 1  69 PHE N  1 1  69 PHE CA 1 1  69 PHE CB  1 1  69 PHE CG      -205.0       95.0 .  69 . N  .  69 . CA .  69 . CB  .  69 . CG  1 1 
       402 . 1 1  69 PHE CA 1 1  69 PHE CB 1 1  69 PHE CG  1 1  69 PHE CD1       25.0      335.0 .  69 . CA .  69 . CB .  69 . CG  .  69 . CD1 1 1 
       403 . 1 1  69 PHE CA 1 1  69 PHE CB 1 1  69 PHE CG  1 1  69 PHE CD1     -155.0      155.0 .  69 . CA .  69 . CB .  69 . CG  .  69 . CD1 1 1 
       404 . 1 1  70 GLU N  1 1  70 GLU CA 1 1  70 GLU CB  1 1  70 GLU CG        25.0      335.0 .  70 . N  .  70 . CA .  70 . CB  .  70 . CG  1 1 
       405 . 1 1  70 GLU N  1 1  70 GLU CA 1 1  70 GLU CB  1 1  70 GLU CG      -205.0       95.0 .  70 . N  .  70 . CA .  70 . CB  .  70 . CG  1 1 
       406 . 1 1  70 GLU CA 1 1  70 GLU CB 1 1  70 GLU CG  1 1  70 GLU CD        15.0      345.0 .  70 . CA .  70 . CB .  70 . CG  .  70 . CD  1 1 
       407 . 1 1  71 VAL N  1 1  71 VAL CA 1 1  71 VAL CB  1 1  71 VAL CG1 -174.99998 -44.999996 .  71 . N  .  71 . CA .  71 . CB  .  71 . CG1 1 1 
       408 . 1 1  71 VAL N  1 1  71 VAL CA 1 1  71 VAL CB  1 1  71 VAL CG1      -95.0      205.0 .  71 . N  .  71 . CA .  71 . CB  .  71 . CG1 1 1 
       409 . 1 1  71 VAL C  1 1  72 GLU N  1 1  72 GLU CA  1 1  72 GLU C    44.999996      315.0 .  71 . C  .  72 . N  .  72 . CA  .  72 . C   1 1 
       410 . 1 1  71 VAL C  1 1  72 GLU N  1 1  72 GLU CA  1 1  72 GLU C       -185.0       75.0 .  71 . C  .  72 . N  .  72 . CA  .  72 . C   1 1 
       411 . 1 1  72 GLU N  1 1  72 GLU CA 1 1  72 GLU CB  1 1  72 GLU CG        25.0      335.0 .  72 . N  .  72 . CA .  72 . CB  .  72 . CG  1 1 
       412 . 1 1  72 GLU N  1 1  72 GLU CA 1 1  72 GLU CB  1 1  72 GLU CG      -205.0       95.0 .  72 . N  .  72 . CA .  72 . CB  .  72 . CG  1 1 
       413 . 1 1  72 GLU CA 1 1  72 GLU CB 1 1  72 GLU CG  1 1  72 GLU CD        15.0      345.0 .  72 . CA .  72 . CB .  72 . CG  .  72 . CD  1 1 
       414 . 1 1  72 GLU N  1 1  72 GLU CA 1 1  72 GLU C   1 1  73 PHE N        -85.0      195.0 .  72 . N  .  72 . CA .  72 . C   .  73 . N   1 1 
       415 . 1 1  73 PHE N  1 1  73 PHE CA 1 1  73 PHE CB  1 1  73 PHE CG        35.0      325.0 .  73 . N  .  73 . CA .  73 . CB  .  73 . CG  1 1 
       416 . 1 1  73 PHE N  1 1  73 PHE CA 1 1  73 PHE CB  1 1  73 PHE CG      -205.0       95.0 .  73 . N  .  73 . CA .  73 . CB  .  73 . CG  1 1 
       417 . 1 1  73 PHE CA 1 1  73 PHE CB 1 1  73 PHE CG  1 1  73 PHE CD1       25.0      335.0 .  73 . CA .  73 . CB .  73 . CG  .  73 . CD1 1 1 
       418 . 1 1  73 PHE CA 1 1  73 PHE CB 1 1  73 PHE CG  1 1  73 PHE CD1     -155.0      155.0 .  73 . CA .  73 . CB .  73 . CG  .  73 . CD1 1 1 
       419 . 1 1  73 PHE C  1 1  74 GLY N  1 1  74 GLY CA  1 1  74 GLY C    44.999996      315.0 .  73 . C  .  74 . N  .  74 . CA  .  74 . C   1 1 
       420 . 1 1  75 PHE N  1 1  75 PHE CA 1 1  75 PHE CB  1 1  75 PHE CG        25.0      325.0 .  75 . N  .  75 . CA .  75 . CB  .  75 . CG  1 1 
       421 . 1 1  75 PHE N  1 1  75 PHE CA 1 1  75 PHE CB  1 1  75 PHE CG  -115.00001       75.0 .  75 . N  .  75 . CA .  75 . CB  .  75 . CG  1 1 
       422 . 1 1  75 PHE CA 1 1  75 PHE CB 1 1  75 PHE CG  1 1  75 PHE CD1       25.0      325.0 .  75 . CA .  75 . CB .  75 . CG  .  75 . CD1 1 1 
       423 . 1 1  75 PHE CA 1 1  75 PHE CB 1 1  75 PHE CG  1 1  75 PHE CD1     -155.0      145.0 .  75 . CA .  75 . CB .  75 . CG  .  75 . CD1 1 1 
       424 . 1 1  76 PRO N  1 1  76 PRO CA 1 1  76 PRO C   1 1  77 VAL N         65.0      195.0 .  76 . N  .  76 . CA .  76 . C   .  77 . N   1 1 
       425 . 1 1  77 VAL N  1 1  77 VAL CA 1 1  77 VAL CB  1 1  77 VAL CG1     -165.0 -44.999996 .  77 . N  .  77 . CA .  77 . CB  .  77 . CG1 1 1 
       426 . 1 1  77 VAL N  1 1  77 VAL CA 1 1  77 VAL CB  1 1  77 VAL CG1      -95.0      205.0 .  77 . N  .  77 . CA .  77 . CB  .  77 . CG1 1 1 
       427 . 1 1  77 VAL C  1 1  78 GLU N  1 1  78 GLU CA  1 1  78 GLU C    44.999996      315.0 .  77 . C  .  78 . N  .  78 . CA  .  78 . C   1 1 
       428 . 1 1  77 VAL C  1 1  78 GLU N  1 1  78 GLU CA  1 1  78 GLU C       -185.0       75.0 .  77 . C  .  78 . N  .  78 . CA  .  78 . C   1 1 
       429 . 1 1  78 GLU N  1 1  78 GLU CA 1 1  78 GLU CB  1 1  78 GLU CG        25.0      335.0 .  78 . N  .  78 . CA .  78 . CB  .  78 . CG  1 1 
       430 . 1 1  78 GLU N  1 1  78 GLU CA 1 1  78 GLU CB  1 1  78 GLU CG      -205.0       95.0 .  78 . N  .  78 . CA .  78 . CB  .  78 . CG  1 1 
       431 . 1 1  78 GLU CA 1 1  78 GLU CB 1 1  78 GLU CG  1 1  78 GLU CD        15.0      345.0 .  78 . CA .  78 . CB .  78 . CG  .  78 . CD  1 1 
       432 . 1 1  78 GLU N  1 1  78 GLU CA 1 1  78 GLU C   1 1  79 GLY N       -285.0  44.999996 .  78 . N  .  78 . CA .  78 . C   .  79 . N   1 1 
       433 . 1 1  78 GLU N  1 1  78 GLU CA 1 1  78 GLU C   1 1  79 GLY N        -85.0      125.0 .  78 . N  .  78 . CA .  78 . C   .  79 . N   1 1 
       434 . 1 1  78 GLU C  1 1  79 GLY N  1 1  79 GLY CA  1 1  79 GLY C    44.999996      315.0 .  78 . C  .  79 . N  .  79 . CA  .  79 . C   1 1 
       435 . 1 1  79 GLY C  1 1  80 GLY N  1 1  80 GLY CA  1 1  80 GLY C    44.999996      315.0 .  79 . C  .  80 . N  .  80 . CA  .  80 . C   1 1 
       436 . 1 1  80 GLY N  1 1  80 GLY CA 1 1  80 GLY C   1 1  81 VAL N       -135.0      135.0 .  80 . N  .  80 . CA .  80 . C   .  81 . N   1 1 
       437 . 1 1  80 GLY C  1 1  81 VAL N  1 1  81 VAL CA  1 1  81 VAL C       -155.0 -44.999996 .  80 . C  .  81 . N  .  81 . CA  .  81 . C   1 1 
       438 . 1 1  81 VAL N  1 1  81 VAL CA 1 1  81 VAL CB  1 1  81 VAL CG1 -174.99998     -155.0 .  81 . N  .  81 . CA .  81 . CB  .  81 . CG1 1 1 
       439 . 1 1  81 VAL N  1 1  81 VAL CA 1 1  81 VAL C   1 1  82 GLU N        145.0      165.0 .  81 . N  .  81 . CA .  81 . C   .  82 . N   1 1 
       440 . 1 1  81 VAL C  1 1  82 GLU N  1 1  82 GLU CA  1 1  82 GLU C    44.999996      315.0 .  81 . C  .  82 . N  .  82 . CA  .  82 . C   1 1 
       441 . 1 1  81 VAL C  1 1  82 GLU N  1 1  82 GLU CA  1 1  82 GLU C       -185.0       75.0 .  81 . C  .  82 . N  .  82 . CA  .  82 . C   1 1 
       442 . 1 1  82 GLU N  1 1  82 GLU CA 1 1  82 GLU CB  1 1  82 GLU CG        25.0      335.0 .  82 . N  .  82 . CA .  82 . CB  .  82 . CG  1 1 
       443 . 1 1  82 GLU N  1 1  82 GLU CA 1 1  82 GLU CB  1 1  82 GLU CG      -205.0       95.0 .  82 . N  .  82 . CA .  82 . CB  .  82 . CG  1 1 
       444 . 1 1  82 GLU CA 1 1  82 GLU CB 1 1  82 GLU CG  1 1  82 GLU CD        15.0      345.0 .  82 . CA .  82 . CB .  82 . CG  .  82 . CD  1 1 
       445 . 1 1  82 GLU N  1 1  82 GLU CA 1 1  82 GLU C   1 1  83 GLY N         15.0      205.0 .  82 . N  .  82 . CA .  82 . C   .  83 . N   1 1 
       446 . 1 1  82 GLU N  1 1  82 GLU CA 1 1  82 GLU C   1 1  83 GLY N       -285.0  44.999996 .  82 . N  .  82 . CA .  82 . C   .  83 . N   1 1 
       447 . 1 1  82 GLU C  1 1  83 GLY N  1 1  83 GLY CA  1 1  83 GLY C    44.999996      315.0 .  82 . C  .  83 . N  .  83 . CA  .  83 . C   1 1 
       448 . 1 1  83 GLY C  1 1  84 SER N  1 1  84 SER CA  1 1  84 SER C    44.999996      315.0 .  83 . C  .  84 . N  .  84 . CA  .  84 . C   1 1 
       449 . 1 1  83 GLY C  1 1  84 SER N  1 1  84 SER CA  1 1  84 SER C       -185.0       75.0 .  83 . C  .  84 . N  .  84 . CA  .  84 . C   1 1 
       450 . 1 1  84 SER N  1 1  84 SER CA 1 1  84 SER C   1 1  85 GLY N        -85.0      205.0 .  84 . N  .  84 . CA .  84 . C   .  85 . N   1 1 
       451 . 1 1  84 SER C  1 1  85 GLY N  1 1  85 GLY CA  1 1  85 GLY C    44.999996      315.0 .  84 . C  .  85 . N  .  85 . CA  .  85 . C   1 1 
       452 . 1 1  85 GLY C  1 1  86 ARG N  1 1  86 ARG CA  1 1  86 ARG C    44.999996      315.0 .  85 . C  .  86 . N  .  86 . CA  .  86 . C   1 1 
       453 . 1 1  85 GLY C  1 1  86 ARG N  1 1  86 ARG CA  1 1  86 ARG C       -185.0       75.0 .  85 . C  .  86 . N  .  86 . CA  .  86 . C   1 1 
       454 . 1 1  86 ARG N  1 1  86 ARG CA 1 1  86 ARG CB  1 1  86 ARG CG        25.0      335.0 .  86 . N  .  86 . CA .  86 . CB  .  86 . CG  1 1 
       455 . 1 1  86 ARG N  1 1  86 ARG CA 1 1  86 ARG CB  1 1  86 ARG CG      -205.0       95.0 .  86 . N  .  86 . CA .  86 . CB  .  86 . CG  1 1 
       456 . 1 1  86 ARG CA 1 1  86 ARG CB 1 1  86 ARG CG  1 1  86 ARG CD        35.0      325.0 .  86 . CA .  86 . CB .  86 . CG  .  86 . CD  1 1 
       457 . 1 1  86 ARG N  1 1  86 ARG CA 1 1  86 ARG C   1 1  87 VAL N        -85.0      155.0 .  86 . N  .  86 . CA .  86 . C   .  87 . N   1 1 
       458 . 1 1  86 ARG C  1 1  87 VAL N  1 1  87 VAL CA  1 1  87 VAL C    44.999996      315.0 .  86 . C  .  87 . N  .  87 . CA  .  87 . C   1 1 
       459 . 1 1  86 ARG C  1 1  87 VAL N  1 1  87 VAL CA  1 1  87 VAL C   -174.99998       65.0 .  86 . C  .  87 . N  .  87 . CA  .  87 . C   1 1 
       460 . 1 1  87 VAL N  1 1  87 VAL CA 1 1  87 VAL CB  1 1  87 VAL CG1  44.999996      205.0 .  87 . N  .  87 . CA .  87 . CB  .  87 . CG1 1 1 
       461 . 1 1  87 VAL N  1 1  87 VAL CA 1 1  87 VAL CB  1 1  87 VAL CG1     -195.0       85.0 .  87 . N  .  87 . CA .  87 . CB  .  87 . CG1 1 1 
       462 . 1 1  87 VAL N  1 1  87 VAL CA 1 1  87 VAL C   1 1  88 VAL N        -85.0      165.0 .  87 . N  .  87 . CA .  87 . C   .  88 . N   1 1 
       463 . 1 1  88 VAL N  1 1  88 VAL CA 1 1  88 VAL CB  1 1  88 VAL CG1      -95.0 -44.999996 .  88 . N  .  88 . CA .  88 . CB  .  88 . CG1 1 1 
       464 . 1 1  89 THR N  1 1  89 THR CA 1 1  89 THR CB  1 1  89 THR OG1     -205.0       95.0 .  89 . N  .  89 . CA .  89 . CB  .  89 . OG1 1 1 
       465 . 1 1  89 THR N  1 1  89 THR CA 1 1  89 THR CB  1 1  89 THR OG1 -174.99998      165.0 .  89 . N  .  89 . CA .  89 . CB  .  89 . OG1 1 1 
       466 . 1 1  89 THR N  1 1  89 THR CA 1 1  89 THR CB  1 1  89 THR OG1 -44.999996      195.0 .  89 . N  .  89 . CA .  89 . CB  .  89 . OG1 1 1 
       467 . 1 1  89 THR C  1 1  90 GLY N  1 1  90 GLY CA  1 1  90 GLY C    44.999996      315.0 .  89 . C  .  90 . N  .  90 . CA  .  90 . C   1 1 
       468 . 1 1  90 GLY N  1 1  90 GLY CA 1 1  90 GLY C   1 1  91 LEU N       -275.0       25.0 .  90 . N  .  90 . CA .  90 . C   .  91 . N   1 1 
       469 . 1 1  90 GLY N  1 1  90 GLY CA 1 1  90 GLY C   1 1  91 LEU N        -25.0      275.0 .  90 . N  .  90 . CA .  90 . C   .  91 . N   1 1 
       470 . 1 1  91 LEU N  1 1  91 LEU CA 1 1  91 LEU CB  1 1  91 LEU CG         5.0  354.99997 .  91 . N  .  91 . CA .  91 . CB  .  91 . CG  1 1 
       471 . 1 1  91 LEU N  1 1  91 LEU CA 1 1  91 LEU CB  1 1  91 LEU CG      -215.0      105.0 .  91 . N  .  91 . CA .  91 . CB  .  91 . CG  1 1 
       472 . 1 1  91 LEU CA 1 1  91 LEU CB 1 1  91 LEU CG  1 1  91 LEU CD1       35.0      325.0 .  91 . CA .  91 . CB .  91 . CG  .  91 . CD1 1 1 
       473 . 1 1  91 LEU CA 1 1  91 LEU CB 1 1  91 LEU CG  1 1  91 LEU CD1      -95.0      205.0 .  91 . CA .  91 . CB .  91 . CG  .  91 . CD1 1 1 
       474 . 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR CB  1 1  92 THR OG1        5.0      335.0 .  92 . N  .  92 . CA .  92 . CB  .  92 . OG1 1 1 
       475 . 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR CB  1 1  92 THR OG1     -195.0       75.0 .  92 . N  .  92 . CA .  92 . CB  .  92 . OG1 1 1 
       476 . 1 1  92 THR N  1 1  92 THR CA 1 1  92 THR CB  1 1  92 THR OG1      -65.0  174.99998 .  92 . N  .  92 . CA .  92 . CB  .  92 . OG1 1 1 
       477 . 1 1  93 PRO N  1 1  93 PRO CA 1 1  93 PRO C   1 1  94 SER N    115.00001      195.0 .  93 . N  .  93 . CA .  93 . C   .  94 . N   1 1 
       478 . 1 1  94 SER C  1 1  95 GLY N  1 1  95 GLY CA  1 1  95 GLY C    44.999996      315.0 .  94 . C  .  95 . N  .  95 . CA  .  95 . C   1 1 
       479 . 1 1  95 GLY C  1 1  96 LYS N  1 1  96 LYS CA  1 1  96 LYS C    44.999996      315.0 .  95 . C  .  96 . N  .  96 . CA  .  96 . C   1 1 
       480 . 1 1  95 GLY C  1 1  96 LYS N  1 1  96 LYS CA  1 1  96 LYS C       -185.0       75.0 .  95 . C  .  96 . N  .  96 . CA  .  96 . C   1 1 
       481 . 1 1  96 LYS N  1 1  96 LYS CA 1 1  96 LYS CB  1 1  96 LYS CG        25.0      335.0 .  96 . N  .  96 . CA .  96 . CB  .  96 . CG  1 1 
       482 . 1 1  96 LYS N  1 1  96 LYS CA 1 1  96 LYS CB  1 1  96 LYS CG      -205.0       95.0 .  96 . N  .  96 . CA .  96 . CB  .  96 . CG  1 1 
       483 . 1 1  96 LYS CA 1 1  96 LYS CB 1 1  96 LYS CG  1 1  96 LYS CD        35.0      325.0 .  96 . CA .  96 . CB .  96 . CG  .  96 . CD  1 1 
       484 . 1 1  96 LYS N  1 1  96 LYS CA 1 1  96 LYS C   1 1  97 ALA N       -265.0       25.0 .  96 . N  .  96 . CA .  96 . C   .  97 . N   1 1 
       485 . 1 1  96 LYS N  1 1  96 LYS CA 1 1  96 LYS C   1 1  97 ALA N        -25.0      195.0 .  96 . N  .  96 . CA .  96 . C   .  97 . N   1 1 
       486 . 1 1 101 LEU N  1 1 101 LEU CA 1 1 101 LEU CB  1 1 101 LEU CG         5.0  354.99997 . 101 . N  . 101 . CA . 101 . CB  . 101 . CG  1 1 
       487 . 1 1 101 LEU N  1 1 101 LEU CA 1 1 101 LEU CB  1 1 101 LEU CG      -215.0      105.0 . 101 . N  . 101 . CA . 101 . CB  . 101 . CG  1 1 
       488 . 1 1 101 LEU CA 1 1 101 LEU CB 1 1 101 LEU CG  1 1 101 LEU CD1       35.0      325.0 . 101 . CA . 101 . CB . 101 . CG  . 101 . CD1 1 1 
       489 . 1 1 101 LEU CA 1 1 101 LEU CB 1 1 101 LEU CG  1 1 101 LEU CD1      -95.0      205.0 . 101 . CA . 101 . CB . 101 . CG  . 101 . CD1 1 1 
       490 . 1 1 102 TYR N  1 1 102 TYR CA 1 1 102 TYR CB  1 1 102 TYR CG        25.0      335.0 . 102 . N  . 102 . CA . 102 . CB  . 102 . CG  1 1 
       491 . 1 1 102 TYR N  1 1 102 TYR CA 1 1 102 TYR CB  1 1 102 TYR CG      -205.0       95.0 . 102 . N  . 102 . CA . 102 . CB  . 102 . CG  1 1 
       492 . 1 1 102 TYR CA 1 1 102 TYR CB 1 1 102 TYR CG  1 1 102 TYR CD1       25.0      335.0 . 102 . CA . 102 . CB . 102 . CG  . 102 . CD1 1 1 
       493 . 1 1 102 TYR CA 1 1 102 TYR CB 1 1 102 TYR CG  1 1 102 TYR CD1     -155.0      155.0 . 102 . CA . 102 . CB . 102 . CG  . 102 . CD1 1 1 
       494 . 1 1 103 ILE N  1 1 103 ILE CA 1 1 103 ILE CB  1 1 103 ILE CG1       25.0      335.0 . 103 . N  . 103 . CA . 103 . CB  . 103 . CG1 1 1 
       495 . 1 1 103 ILE N  1 1 103 ILE CA 1 1 103 ILE CB  1 1 103 ILE CG1     -195.0       75.0 . 103 . N  . 103 . CA . 103 . CB  . 103 . CG1 1 1 
       496 . 1 1 103 ILE N  1 1 103 ILE CA 1 1 103 ILE CB  1 1 103 ILE CG1      -75.0      205.0 . 103 . N  . 103 . CA . 103 . CB  . 103 . CG1 1 1 
       497 . 1 1 103 ILE CA 1 1 103 ILE CB 1 1 103 ILE CG1 1 1 103 ILE CD1  44.999996      315.0 . 103 . CA . 103 . CB . 103 . CG1 . 103 . CD1 1 1 
       498 . 1 1 103 ILE CA 1 1 103 ILE CB 1 1 103 ILE CG1 1 1 103 ILE CD1      -85.0      195.0 . 103 . CA . 103 . CB . 103 . CG1 . 103 . CD1 1 1 
       499 . 1 1 103 ILE C  1 1 104 GLY N  1 1 104 GLY CA  1 1 104 GLY C    44.999996      315.0 . 103 . C  . 104 . N  . 104 . CA  . 104 . C   1 1 
       500 . 1 1 104 GLY N  1 1 104 GLY CA 1 1 104 GLY C   1 1 105 PRO N         55.0      295.0 . 104 . N  . 104 . CA . 104 . C   . 105 . N   1 1 
       501 . 1 1 104 GLY N  1 1 104 GLY CA 1 1 104 GLY C   1 1 105 PRO N       -205.0       85.0 . 104 . N  . 104 . CA . 104 . C   . 105 . N   1 1 
       502 . 1 1 104 GLY N  1 1 104 GLY CA 1 1 104 GLY C   1 1 105 PRO N        -95.0      205.0 . 104 . N  . 104 . CA . 104 . C   . 105 . N   1 1 
       503 . 1 1 105 PRO N  1 1 105 PRO CA 1 1 105 PRO C   1 1 106 TYR N       -295.0        5.0 . 105 . N  . 105 . CA . 105 . C   . 106 . N   1 1 
       504 . 1 1 105 PRO N  1 1 105 PRO CA 1 1 105 PRO C   1 1 106 TYR N        -55.0      195.0 . 105 . N  . 105 . CA . 105 . C   . 106 . N   1 1 
       505 . 1 1 106 TYR N  1 1 106 TYR CA 1 1 106 TYR CB  1 1 106 TYR CG        25.0      335.0 . 106 . N  . 106 . CA . 106 . CB  . 106 . CG  1 1 
       506 . 1 1 106 TYR N  1 1 106 TYR CA 1 1 106 TYR CB  1 1 106 TYR CG      -205.0       95.0 . 106 . N  . 106 . CA . 106 . CB  . 106 . CG  1 1 
       507 . 1 1 106 TYR CA 1 1 106 TYR CB 1 1 106 TYR CG  1 1 106 TYR CD1       25.0      335.0 . 106 . CA . 106 . CB . 106 . CG  . 106 . CD1 1 1 
       508 . 1 1 106 TYR CA 1 1 106 TYR CB 1 1 106 TYR CG  1 1 106 TYR CD1     -155.0      155.0 . 106 . CA . 106 . CB . 106 . CG  . 106 . CD1 1 1 
       509 . 1 1 106 TYR C  1 1 107 GLY N  1 1 107 GLY CA  1 1 107 GLY C    44.999996      315.0 . 106 . C  . 107 . N  . 107 . CA  . 107 . C   1 1 
       510 . 1 1 107 GLY C  1 1 108 GLU N  1 1 108 GLU CA  1 1 108 GLU C    44.999996      315.0 . 107 . C  . 108 . N  . 108 . CA  . 108 . C   1 1 
       511 . 1 1 107 GLY C  1 1 108 GLU N  1 1 108 GLU CA  1 1 108 GLU C       -185.0       75.0 . 107 . C  . 108 . N  . 108 . CA  . 108 . C   1 1 
       512 . 1 1 108 GLU N  1 1 108 GLU CA 1 1 108 GLU CB  1 1 108 GLU CG        25.0      335.0 . 108 . N  . 108 . CA . 108 . CB  . 108 . CG  1 1 
       513 . 1 1 108 GLU N  1 1 108 GLU CA 1 1 108 GLU CB  1 1 108 GLU CG      -205.0       95.0 . 108 . N  . 108 . CA . 108 . CB  . 108 . CG  1 1 
       514 . 1 1 108 GLU CA 1 1 108 GLU CB 1 1 108 GLU CG  1 1 108 GLU CD        15.0      345.0 . 108 . CA . 108 . CB . 108 . CG  . 108 . CD  1 1 
       515 . 1 1 108 GLU N  1 1 108 GLU CA 1 1 108 GLU C   1 1 109 ILE N        -85.0      195.0 . 108 . N  . 108 . CA . 108 . C   . 109 . N   1 1 
       516 . 1 1 109 ILE N  1 1 109 ILE CA 1 1 109 ILE CB  1 1 109 ILE CG1     -195.0      -35.0 . 109 . N  . 109 . CA . 109 . CB  . 109 . CG1 1 1 
       517 . 1 1 109 ILE N  1 1 109 ILE CA 1 1 109 ILE CB  1 1 109 ILE CG1      -75.0      205.0 . 109 . N  . 109 . CA . 109 . CB  . 109 . CG1 1 1 
       518 . 1 1 109 ILE CA 1 1 109 ILE CB 1 1 109 ILE CG1 1 1 109 ILE CD1  44.999996      315.0 . 109 . CA . 109 . CB . 109 . CG1 . 109 . CD1 1 1 
       519 . 1 1 109 ILE CA 1 1 109 ILE CB 1 1 109 ILE CG1 1 1 109 ILE CD1      -85.0      195.0 . 109 . CA . 109 . CB . 109 . CG1 . 109 . CD1 1 1 
       520 . 1 1 110 GLU N  1 1 110 GLU CA 1 1 110 GLU CB  1 1 110 GLU CG        35.0      325.0 . 110 . N  . 110 . CA . 110 . CB  . 110 . CG  1 1 
       521 . 1 1 110 GLU N  1 1 110 GLU CA 1 1 110 GLU CB  1 1 110 GLU CG      -205.0       95.0 . 110 . N  . 110 . CA . 110 . CB  . 110 . CG  1 1 
       522 . 1 1 110 GLU CA 1 1 110 GLU CB 1 1 110 GLU CG  1 1 110 GLU CD        15.0      345.0 . 110 . CA . 110 . CB . 110 . CG  . 110 . CD  1 1 
       523 . 1 1 112 VAL N  1 1 112 VAL CA 1 1 112 VAL CB  1 1 112 VAL CG1  44.999996      315.0 . 112 . N  . 112 . CA . 112 . CB  . 112 . CG1 1 1 
       524 . 1 1 112 VAL N  1 1 112 VAL CA 1 1 112 VAL CB  1 1 112 VAL CG1     -195.0       85.0 . 112 . N  . 112 . CA . 112 . CB  . 112 . CG1 1 1 
       525 . 1 1 112 VAL N  1 1 112 VAL CA 1 1 112 VAL CB  1 1 112 VAL CG1      -75.0      205.0 . 112 . N  . 112 . CA . 112 . CB  . 112 . CG1 1 1 
       526 . 1 1 113 TYR N  1 1 113 TYR CA 1 1 113 TYR CB  1 1 113 TYR CG        35.0      325.0 . 113 . N  . 113 . CA . 113 . CB  . 113 . CG  1 1 
       527 . 1 1 113 TYR N  1 1 113 TYR CA 1 1 113 TYR CB  1 1 113 TYR CG      -205.0       95.0 . 113 . N  . 113 . CA . 113 . CB  . 113 . CG  1 1 
       528 . 1 1 113 TYR CA 1 1 113 TYR CB 1 1 113 TYR CG  1 1 113 TYR CD1       25.0      335.0 . 113 . CA . 113 . CB . 113 . CG  . 113 . CD1 1 1 
       529 . 1 1 113 TYR CA 1 1 113 TYR CB 1 1 113 TYR CG  1 1 113 TYR CD1     -155.0      155.0 . 113 . CA . 113 . CB . 113 . CG  . 113 . CD1 1 1 
       530 . 1 1 114 ASP N  1 1 114 ASP CA 1 1 114 ASP CB  1 1 114 ASP CG        25.0      335.0 . 114 . N  . 114 . CA . 114 . CB  . 114 . CG  1 1 
       531 . 1 1 114 ASP N  1 1 114 ASP CA 1 1 114 ASP CB  1 1 114 ASP CG      -225.0      105.0 . 114 . N  . 114 . CA . 114 . CB  . 114 . CG  1 1 
       532 . 1 1 116 LEU N  1 1 116 LEU CA 1 1 116 LEU CB  1 1 116 LEU CG      -325.0      -25.0 . 116 . N  . 116 . CA . 116 . CB  . 116 . CG  1 1 
       533 . 1 1 116 LEU N  1 1 116 LEU CA 1 1 116 LEU CB  1 1 116 LEU CG      -215.0       95.0 . 116 . N  . 116 . CA . 116 . CB  . 116 . CG  1 1 
       534 . 1 1 116 LEU CA 1 1 116 LEU CB 1 1 116 LEU CG  1 1 116 LEU CD1       35.0      325.0 . 116 . CA . 116 . CB . 116 . CG  . 116 . CD1 1 1 
       535 . 1 1 116 LEU CA 1 1 116 LEU CB 1 1 116 LEU CG  1 1 116 LEU CD1      -95.0      205.0 . 116 . CA . 116 . CB . 116 . CG  . 116 . CD1 1 1 
       536 . 1 1 117 MET N  1 1 117 MET CA 1 1 117 MET CB  1 1 117 MET CG        35.0      325.0 . 117 . N  . 117 . CA . 117 . CB  . 117 . CG  1 1 
       537 . 1 1 117 MET N  1 1 117 MET CA 1 1 117 MET CB  1 1 117 MET CG      -205.0       95.0 . 117 . N  . 117 . CA . 117 . CB  . 117 . CG  1 1 
       538 . 1 1 117 MET CA 1 1 117 MET CB 1 1 117 MET CG  1 1 117 MET SD   44.999996      315.0 . 117 . CA . 117 . CB . 117 . CG  . 117 . SD  1 1 
       539 . 1 1 118 LYS N  1 1 118 LYS CA 1 1 118 LYS CB  1 1 118 LYS CG        35.0      325.0 . 118 . N  . 118 . CA . 118 . CB  . 118 . CG  1 1 
       540 . 1 1 118 LYS N  1 1 118 LYS CA 1 1 118 LYS CB  1 1 118 LYS CG      -205.0       95.0 . 118 . N  . 118 . CA . 118 . CB  . 118 . CG  1 1 
       541 . 1 1 118 LYS CA 1 1 118 LYS CB 1 1 118 LYS CG  1 1 118 LYS CD        35.0      325.0 . 118 . CA . 118 . CB . 118 . CG  . 118 . CD  1 1 
       542 . 1 1 119 TRP N  1 1 119 TRP CA 1 1 119 TRP CB  1 1 119 TRP CG        35.0      325.0 . 119 . N  . 119 . CA . 119 . CB  . 119 . CG  1 1 
       543 . 1 1 119 TRP N  1 1 119 TRP CA 1 1 119 TRP CB  1 1 119 TRP CG      -205.0       95.0 . 119 . N  . 119 . CA . 119 . CB  . 119 . CG  1 1 
       544 . 1 1 119 TRP CA 1 1 119 TRP CB 1 1 119 TRP CG  1 1 119 TRP CD1     -145.0      145.0 . 119 . CA . 119 . CB . 119 . CG  . 119 . CD1 1 1 
       545 . 1 1 120 VAL N  1 1 120 VAL CA 1 1 120 VAL CB  1 1 120 VAL CG1       55.0      205.0 . 120 . N  . 120 . CA . 120 . CB  . 120 . CG1 1 1 
       546 . 1 1 120 VAL N  1 1 120 VAL CA 1 1 120 VAL CB  1 1 120 VAL CG1     -195.0       65.0 . 120 . N  . 120 . CA . 120 . CB  . 120 . CG1 1 1 
       547 . 1 1 121 ASP N  1 1 121 ASP CA 1 1 121 ASP CB  1 1 121 ASP CG      -325.0      -25.0 . 121 . N  . 121 . CA . 121 . CB  . 121 . CG  1 1 
       548 . 1 1 121 ASP N  1 1 121 ASP CA 1 1 121 ASP CB  1 1 121 ASP CG      -285.0       65.0 . 121 . N  . 121 . CA . 121 . CB  . 121 . CG  1 1 
       549 . 1 1 121 ASP N  1 1 121 ASP CA 1 1 121 ASP CB  1 1 121 ASP CG      -225.0  115.00001 . 121 . N  . 121 . CA . 121 . CB  . 121 . CG  1 1 
       550 . 1 1 122 ASP N  1 1 122 ASP CA 1 1 122 ASP CB  1 1 122 ASP CG        25.0      335.0 . 122 . N  . 122 . CA . 122 . CB  . 122 . CG  1 1 
       551 . 1 1 122 ASP N  1 1 122 ASP CA 1 1 122 ASP CB  1 1 122 ASP CG      -225.0  115.00001 . 122 . N  . 122 . CA . 122 . CB  . 122 . CG  1 1 
       552 . 1 1 123 ASN N  1 1 123 ASN CA 1 1 123 ASN CB  1 1 123 ASN CG      -225.0  115.00001 . 123 . N  . 123 . CA . 123 . CB  . 123 . CG  1 1 
       553 . 1 1 123 ASN CA 1 1 123 ASN CB 1 1 123 ASN CG  1 1 123 ASN OD1     -145.0      145.0 . 123 . CA . 123 . CB . 123 . CG  . 123 . OD1 1 1 
       554 . 1 1 125 PHE N  1 1 125 PHE CA 1 1 125 PHE CB  1 1 125 PHE CG        25.0      325.0 . 125 . N  . 125 . CA . 125 . CB  . 125 . CG  1 1 
       555 . 1 1 125 PHE N  1 1 125 PHE CA 1 1 125 PHE CB  1 1 125 PHE CG      -205.0       95.0 . 125 . N  . 125 . CA . 125 . CB  . 125 . CG  1 1 
       556 . 1 1 125 PHE CA 1 1 125 PHE CB 1 1 125 PHE CG  1 1 125 PHE CD1       25.0      325.0 . 125 . CA . 125 . CB . 125 . CG  . 125 . CD1 1 1 
       557 . 1 1 125 PHE CA 1 1 125 PHE CB 1 1 125 PHE CG  1 1 125 PHE CD1     -155.0      145.0 . 125 . CA . 125 . CB . 125 . CG  . 125 . CD1 1 1 
       558 . 1 1 126 ASP N  1 1 126 ASP CA 1 1 126 ASP CB  1 1 126 ASP CG      -225.0  115.00001 . 126 . N  . 126 . CA . 126 . CB  . 126 . CG  1 1 
       559 . 1 1 127 LEU N  1 1 127 LEU CA 1 1 127 LEU CB  1 1 127 LEU CG      -275.0       -5.0 . 127 . N  . 127 . CA . 127 . CB  . 127 . CG  1 1 
       560 . 1 1 127 LEU N  1 1 127 LEU CA 1 1 127 LEU CB  1 1 127 LEU CG      -215.0       95.0 . 127 . N  . 127 . CA . 127 . CB  . 127 . CG  1 1 
       561 . 1 1 127 LEU CA 1 1 127 LEU CB 1 1 127 LEU CG  1 1 127 LEU CD1       35.0      325.0 . 127 . CA . 127 . CB . 127 . CG  . 127 . CD1 1 1 
       562 . 1 1 127 LEU CA 1 1 127 LEU CB 1 1 127 LEU CG  1 1 127 LEU CD1      -95.0      205.0 . 127 . CA . 127 . CB . 127 . CG  . 127 . CD1 1 1 
       563 . 1 1 127 LEU C  1 1 128 SER N  1 1 128 SER CA  1 1 128 SER C    44.999996      315.0 . 127 . C  . 128 . N  . 128 . CA  . 128 . C   1 1 
       564 . 1 1 127 LEU C  1 1 128 SER N  1 1 128 SER CA  1 1 128 SER C       -185.0       75.0 . 127 . C  . 128 . N  . 128 . CA  . 128 . C   1 1 
       565 . 1 1 128 SER N  1 1 128 SER CA 1 1 128 SER C   1 1 129 GLY N        -85.0      165.0 . 128 . N  . 128 . CA . 128 . C   . 129 . N   1 1 
       566 . 1 1 128 SER C  1 1 129 GLY N  1 1 129 GLY CA  1 1 129 GLY C    44.999996      315.0 . 128 . C  . 129 . N  . 129 . CA  . 129 . C   1 1 
       567 . 1 1 129 GLY N  1 1 129 GLY CA 1 1 129 GLY C   1 1 130 GLU N       -135.0      135.0 . 129 . N  . 129 . CA . 129 . C   . 130 . N   1 1 
       568 . 1 1 130 GLU N  1 1 130 GLU CA 1 1 130 GLU CB  1 1 130 GLU CG        25.0      335.0 . 130 . N  . 130 . CA . 130 . CB  . 130 . CG  1 1 
       569 . 1 1 130 GLU N  1 1 130 GLU CA 1 1 130 GLU CB  1 1 130 GLU CG      -205.0       95.0 . 130 . N  . 130 . CA . 130 . CB  . 130 . CG  1 1 
       570 . 1 1 130 GLU CA 1 1 130 GLU CB 1 1 130 GLU CG  1 1 130 GLU CD        15.0      345.0 . 130 . CA . 130 . CB . 130 . CG  . 130 . CD  1 1 
       571 . 1 1 132 TYR N  1 1 132 TYR CA 1 1 132 TYR CB  1 1 132 TYR CG        25.0      335.0 . 132 . N  . 132 . CA . 132 . CB  . 132 . CG  1 1 
       572 . 1 1 132 TYR N  1 1 132 TYR CA 1 1 132 TYR CB  1 1 132 TYR CG      -205.0       95.0 . 132 . N  . 132 . CA . 132 . CB  . 132 . CG  1 1 
       573 . 1 1 132 TYR CA 1 1 132 TYR CB 1 1 132 TYR CG  1 1 132 TYR CD1       25.0      335.0 . 132 . CA . 132 . CB . 132 . CG  . 132 . CD1 1 1 
       574 . 1 1 132 TYR CA 1 1 132 TYR CB 1 1 132 TYR CG  1 1 132 TYR CD1     -155.0      155.0 . 132 . CA . 132 . CB . 132 . CG  . 132 . CD1 1 1 
       575 . 1 1 133 GLU N  1 1 133 GLU CA 1 1 133 GLU CB  1 1 133 GLU CG        25.0      335.0 . 133 . N  . 133 . CA . 133 . CB  . 133 . CG  1 1 
       576 . 1 1 133 GLU N  1 1 133 GLU CA 1 1 133 GLU CB  1 1 133 GLU CG      -205.0       95.0 . 133 . N  . 133 . CA . 133 . CB  . 133 . CG  1 1 
       577 . 1 1 133 GLU CA 1 1 133 GLU CB 1 1 133 GLU CG  1 1 133 GLU CD        15.0      345.0 . 133 . CA . 133 . CB . 133 . CG  . 133 . CD  1 1 
       578 . 1 1 134 ILE N  1 1 134 ILE CA 1 1 134 ILE CB  1 1 134 ILE CG1       25.0      335.0 . 134 . N  . 134 . CA . 134 . CB  . 134 . CG1 1 1 
       579 . 1 1 134 ILE N  1 1 134 ILE CA 1 1 134 ILE CB  1 1 134 ILE CG1     -195.0       85.0 . 134 . N  . 134 . CA . 134 . CB  . 134 . CG1 1 1 
       580 . 1 1 134 ILE N  1 1 134 ILE CA 1 1 134 ILE CB  1 1 134 ILE CG1      -75.0      205.0 . 134 . N  . 134 . CA . 134 . CB  . 134 . CG1 1 1 
       581 . 1 1 134 ILE CA 1 1 134 ILE CB 1 1 134 ILE CG1 1 1 134 ILE CD1  44.999996      315.0 . 134 . CA . 134 . CB . 134 . CG1 . 134 . CD1 1 1 
       582 . 1 1 134 ILE CA 1 1 134 ILE CB 1 1 134 ILE CG1 1 1 134 ILE CD1      -85.0      195.0 . 134 . CA . 134 . CB . 134 . CG1 . 134 . CD1 1 1 
       583 . 1 1 134 ILE C  1 1 135 TYR N  1 1 135 TYR CA  1 1 135 TYR C    44.999996      315.0 . 134 . C  . 135 . N  . 135 . CA  . 135 . C   1 1 
       584 . 1 1 134 ILE C  1 1 135 TYR N  1 1 135 TYR CA  1 1 135 TYR C       -185.0       75.0 . 134 . C  . 135 . N  . 135 . CA  . 135 . C   1 1 
       585 . 1 1 135 TYR N  1 1 135 TYR CA 1 1 135 TYR CB  1 1 135 TYR CG        25.0      335.0 . 135 . N  . 135 . CA . 135 . CB  . 135 . CG  1 1 
       586 . 1 1 135 TYR N  1 1 135 TYR CA 1 1 135 TYR CB  1 1 135 TYR CG      -205.0       95.0 . 135 . N  . 135 . CA . 135 . CB  . 135 . CG  1 1 
       587 . 1 1 135 TYR CA 1 1 135 TYR CB 1 1 135 TYR CG  1 1 135 TYR CD1       25.0      335.0 . 135 . CA . 135 . CB . 135 . CG  . 135 . CD1 1 1 
       588 . 1 1 135 TYR CA 1 1 135 TYR CB 1 1 135 TYR CG  1 1 135 TYR CD1     -155.0      155.0 . 135 . CA . 135 . CB . 135 . CG  . 135 . CD1 1 1 
       589 . 1 1 135 TYR N  1 1 135 TYR CA 1 1 135 TYR C   1 1 136 LEU N        -85.0      195.0 . 135 . N  . 135 . CA . 135 . C   . 136 . N   1 1 
       590 . 1 1 135 TYR C  1 1 136 LEU N  1 1 136 LEU CA  1 1 136 LEU C    44.999996      315.0 . 135 . C  . 136 . N  . 136 . CA  . 136 . C   1 1 
       591 . 1 1 135 TYR C  1 1 136 LEU N  1 1 136 LEU CA  1 1 136 LEU C       -185.0       75.0 . 135 . C  . 136 . N  . 136 . CA  . 136 . C   1 1 
       592 . 1 1 136 LEU N  1 1 136 LEU CA 1 1 136 LEU CB  1 1 136 LEU CG         5.0  354.99997 . 136 . N  . 136 . CA . 136 . CB  . 136 . CG  1 1 
       593 . 1 1 136 LEU N  1 1 136 LEU CA 1 1 136 LEU CB  1 1 136 LEU CG      -215.0      105.0 . 136 . N  . 136 . CA . 136 . CB  . 136 . CG  1 1 
       594 . 1 1 136 LEU CA 1 1 136 LEU CB 1 1 136 LEU CG  1 1 136 LEU CD1       35.0      325.0 . 136 . CA . 136 . CB . 136 . CG  . 136 . CD1 1 1 
       595 . 1 1 136 LEU CA 1 1 136 LEU CB 1 1 136 LEU CG  1 1 136 LEU CD1      -95.0      205.0 . 136 . CA . 136 . CB . 136 . CG  . 136 . CD1 1 1 
       596 . 1 1 136 LEU N  1 1 136 LEU CA 1 1 136 LEU C   1 1 137 ASP N        -85.0      205.0 . 136 . N  . 136 . CA . 136 . C   . 137 . N   1 1 
       597 . 1 1 136 LEU C  1 1 137 ASP N  1 1 137 ASP CA  1 1 137 ASP C    44.999996      315.0 . 136 . C  . 137 . N  . 137 . CA  . 137 . C   1 1 
       598 . 1 1 136 LEU C  1 1 137 ASP N  1 1 137 ASP CA  1 1 137 ASP C       -185.0       75.0 . 136 . C  . 137 . N  . 137 . CA  . 137 . C   1 1 
       599 . 1 1 137 ASP N  1 1 137 ASP CA 1 1 137 ASP CB  1 1 137 ASP CG      -225.0  115.00001 . 137 . N  . 137 . CA . 137 . CB  . 137 . CG  1 1 
       600 . 1 1 137 ASP N  1 1 137 ASP CA 1 1 137 ASP C   1 1 138 ASN N        -85.0      205.0 . 137 . N  . 137 . CA . 137 . C   . 138 . N   1 1 
       601 . 1 1 137 ASP C  1 1 138 ASN N  1 1 138 ASN CA  1 1 138 ASN C    44.999996      315.0 . 137 . C  . 138 . N  . 138 . CA  . 138 . C   1 1 
       602 . 1 1 137 ASP C  1 1 138 ASN N  1 1 138 ASN CA  1 1 138 ASN C       -185.0       75.0 . 137 . C  . 138 . N  . 138 . CA  . 138 . C   1 1 
       603 . 1 1 138 ASN N  1 1 138 ASN CA 1 1 138 ASN CB  1 1 138 ASN CG      -195.0      105.0 . 138 . N  . 138 . CA . 138 . CB  . 138 . CG  1 1 
       604 . 1 1 138 ASN CA 1 1 138 ASN CB 1 1 138 ASN CG  1 1 138 ASN OD1     -145.0      145.0 . 138 . CA . 138 . CB . 138 . CG  . 138 . OD1 1 1 
       605 . 1 1 138 ASN N  1 1 138 ASN CA 1 1 138 ASN C   1 1 139 PRO N         55.0      165.0 . 138 . N  . 138 . CA . 138 . C   . 139 . N   1 1 
       606 . 1 1 138 ASN N  1 1 138 ASN CA 1 1 138 ASN C   1 1 139 PRO N       -215.0       85.0 . 138 . N  . 138 . CA . 138 . C   . 139 . N   1 1 
       607 . 1 1 139 PRO N  1 1 139 PRO CA 1 1 139 PRO C   1 1 140 ALA N        155.0      195.0 . 139 . N  . 139 . CA . 139 . C   . 140 . N   1 1 
       608 . 1 1 139 PRO C  1 1 140 ALA N  1 1 140 ALA CA  1 1 140 ALA C    44.999996      315.0 . 139 . C  . 140 . N  . 140 . CA  . 140 . C   1 1 
       609 . 1 1 139 PRO C  1 1 140 ALA N  1 1 140 ALA CA  1 1 140 ALA C       -185.0       75.0 . 139 . C  . 140 . N  . 140 . CA  . 140 . C   1 1 
       610 . 1 1 140 ALA N  1 1 140 ALA CA 1 1 140 ALA C   1 1 141 GLU N        -85.0       95.0 . 140 . N  . 140 . CA . 140 . C   . 141 . N   1 1 
       611 . 1 1 140 ALA C  1 1 141 GLU N  1 1 141 GLU CA  1 1 141 GLU C       -305.0 -44.999996 . 140 . C  . 141 . N  . 141 . CA  . 141 . C   1 1 
       612 . 1 1 140 ALA C  1 1 141 GLU N  1 1 141 GLU CA  1 1 141 GLU C       -185.0       75.0 . 140 . C  . 141 . N  . 141 . CA  . 141 . C   1 1 
       613 . 1 1 141 GLU N  1 1 141 GLU CA 1 1 141 GLU CB  1 1 141 GLU CG        25.0      335.0 . 141 . N  . 141 . CA . 141 . CB  . 141 . CG  1 1 
       614 . 1 1 141 GLU N  1 1 141 GLU CA 1 1 141 GLU CB  1 1 141 GLU CG      -205.0       95.0 . 141 . N  . 141 . CA . 141 . CB  . 141 . CG  1 1 
       615 . 1 1 141 GLU CA 1 1 141 GLU CB 1 1 141 GLU CG  1 1 141 GLU CD        15.0      345.0 . 141 . CA . 141 . CB . 141 . CG  . 141 . CD  1 1 
       616 . 1 1 141 GLU N  1 1 141 GLU CA 1 1 141 GLU C   1 1 142 THR N        -85.0  44.999996 . 141 . N  . 141 . CA . 141 . C   . 142 . N   1 1 
       617 . 1 1 141 GLU C  1 1 142 THR N  1 1 142 THR CA  1 1 142 THR C    44.999996      315.0 . 141 . C  . 142 . N  . 142 . CA  . 142 . C   1 1 
       618 . 1 1 141 GLU C  1 1 142 THR N  1 1 142 THR CA  1 1 142 THR C   -174.99998       55.0 . 141 . C  . 142 . N  . 142 . CA  . 142 . C   1 1 
       619 . 1 1 142 THR N  1 1 142 THR CA 1 1 142 THR CB  1 1 142 THR OG1     -205.0       35.0 . 142 . N  . 142 . CA . 142 . CB  . 142 . OG1 1 1 
       620 . 1 1 142 THR N  1 1 142 THR CA 1 1 142 THR CB  1 1 142 THR OG1      -75.0      205.0 . 142 . N  . 142 . CA . 142 . CB  . 142 . OG1 1 1 
       621 . 1 1 142 THR N  1 1 142 THR CA 1 1 142 THR C   1 1 143 ALA N        -85.0      195.0 . 142 . N  . 142 . CA . 142 . C   . 143 . N   1 1 
       622 . 1 1 142 THR C  1 1 143 ALA N  1 1 143 ALA CA  1 1 143 ALA C    44.999996      315.0 . 142 . C  . 143 . N  . 143 . CA  . 143 . C   1 1 
       623 . 1 1 142 THR C  1 1 143 ALA N  1 1 143 ALA CA  1 1 143 ALA C       -185.0       75.0 . 142 . C  . 143 . N  . 143 . CA  . 143 . C   1 1 
       624 . 1 1 143 ALA N  1 1 143 ALA CA 1 1 143 ALA C   1 1 144 PRO N         55.0      165.0 . 143 . N  . 143 . CA . 143 . C   . 144 . N   1 1 
       625 . 1 1 143 ALA N  1 1 143 ALA CA 1 1 143 ALA C   1 1 144 PRO N       -215.0       85.0 . 143 . N  . 143 . CA . 143 . C   . 144 . N   1 1 
       626 . 1 1 144 PRO N  1 1 144 PRO CA 1 1 144 PRO C   1 1 145 ASP N   -235.00002      -15.0 . 144 . N  . 144 . CA . 144 . C   . 145 . N   1 1 
       627 . 1 1 144 PRO N  1 1 144 PRO CA 1 1 144 PRO C   1 1 145 ASP N        -55.0      195.0 . 144 . N  . 144 . CA . 144 . C   . 145 . N   1 1 
       628 . 1 1 144 PRO C  1 1 145 ASP N  1 1 145 ASP CA  1 1 145 ASP C    44.999996      315.0 . 144 . C  . 145 . N  . 145 . CA  . 145 . C   1 1 
       629 . 1 1 144 PRO C  1 1 145 ASP N  1 1 145 ASP CA  1 1 145 ASP C       -185.0       75.0 . 144 . C  . 145 . N  . 145 . CA  . 145 . C   1 1 
       630 . 1 1 145 ASP N  1 1 145 ASP CA 1 1 145 ASP CB  1 1 145 ASP CG      -225.0  115.00001 . 145 . N  . 145 . CA . 145 . CB  . 145 . CG  1 1 
       631 . 1 1 145 ASP N  1 1 145 ASP CA 1 1 145 ASP C   1 1 146 GLN N        -85.0       95.0 . 145 . N  . 145 . CA . 145 . C   . 146 . N   1 1 
       632 . 1 1 145 ASP C  1 1 146 GLN N  1 1 146 GLN CA  1 1 146 GLN C    44.999996      315.0 . 145 . C  . 146 . N  . 146 . CA  . 146 . C   1 1 
       633 . 1 1 145 ASP C  1 1 146 GLN N  1 1 146 GLN CA  1 1 146 GLN C       -185.0       75.0 . 145 . C  . 146 . N  . 146 . CA  . 146 . C   1 1 
       634 . 1 1 146 GLN N  1 1 146 GLN CA 1 1 146 GLN CB  1 1 146 GLN CG        25.0      335.0 . 146 . N  . 146 . CA . 146 . CB  . 146 . CG  1 1 
       635 . 1 1 146 GLN N  1 1 146 GLN CA 1 1 146 GLN CB  1 1 146 GLN CG      -205.0       95.0 . 146 . N  . 146 . CA . 146 . CB  . 146 . CG  1 1 
       636 . 1 1 146 GLN CA 1 1 146 GLN CB 1 1 146 GLN CG  1 1 146 GLN CD        15.0      345.0 . 146 . CA . 146 . CB . 146 . CG  . 146 . CD  1 1 
       637 . 1 1 146 GLN N  1 1 146 GLN CA 1 1 146 GLN C   1 1 147 LEU N        -85.0       85.0 . 146 . N  . 146 . CA . 146 . C   . 147 . N   1 1 
       638 . 1 1 146 GLN C  1 1 147 LEU N  1 1 147 LEU CA  1 1 147 LEU C    44.999996      315.0 . 146 . C  . 147 . N  . 147 . CA  . 147 . C   1 1 
       639 . 1 1 146 GLN C  1 1 147 LEU N  1 1 147 LEU CA  1 1 147 LEU C       -185.0       75.0 . 146 . C  . 147 . N  . 147 . CA  . 147 . C   1 1 
       640 . 1 1 147 LEU N  1 1 147 LEU CA 1 1 147 LEU CB  1 1 147 LEU CG         5.0  354.99997 . 147 . N  . 147 . CA . 147 . CB  . 147 . CG  1 1 
       641 . 1 1 147 LEU N  1 1 147 LEU CA 1 1 147 LEU CB  1 1 147 LEU CG      -215.0      105.0 . 147 . N  . 147 . CA . 147 . CB  . 147 . CG  1 1 
       642 . 1 1 147 LEU CA 1 1 147 LEU CB 1 1 147 LEU CG  1 1 147 LEU CD1       35.0      325.0 . 147 . CA . 147 . CB . 147 . CG  . 147 . CD1 1 1 
       643 . 1 1 147 LEU CA 1 1 147 LEU CB 1 1 147 LEU CG  1 1 147 LEU CD1      -95.0      205.0 . 147 . CA . 147 . CB . 147 . CG  . 147 . CD1 1 1 
       644 . 1 1 147 LEU N  1 1 147 LEU CA 1 1 147 LEU C   1 1 148 ARG N        -85.0      205.0 . 147 . N  . 147 . CA . 147 . C   . 148 . N   1 1 
       645 . 1 1 148 ARG N  1 1 148 ARG CA 1 1 148 ARG CB  1 1 148 ARG CG        25.0      335.0 . 148 . N  . 148 . CA . 148 . CB  . 148 . CG  1 1 
       646 . 1 1 148 ARG N  1 1 148 ARG CA 1 1 148 ARG CB  1 1 148 ARG CG      -205.0       95.0 . 148 . N  . 148 . CA . 148 . CB  . 148 . CG  1 1 
       647 . 1 1 148 ARG CA 1 1 148 ARG CB 1 1 148 ARG CG  1 1 148 ARG CD        35.0      325.0 . 148 . CA . 148 . CB . 148 . CG  . 148 . CD  1 1 
       648 . 1 1 149 THR N  1 1 149 THR CA 1 1 149 THR CB  1 1 149 THR OG1     -215.0       95.0 . 149 . N  . 149 . CA . 149 . CB  . 149 . OG1 1 1 
       649 . 1 1 149 THR N  1 1 149 THR CA 1 1 149 THR CB  1 1 149 THR OG1      -75.0      205.0 . 149 . N  . 149 . CA . 149 . CB  . 149 . OG1 1 1 
       650 . 1 1 150 ARG N  1 1 150 ARG CA 1 1 150 ARG CB  1 1 150 ARG CG        25.0      335.0 . 150 . N  . 150 . CA . 150 . CB  . 150 . CG  1 1 
       651 . 1 1 150 ARG N  1 1 150 ARG CA 1 1 150 ARG CB  1 1 150 ARG CG      -205.0       95.0 . 150 . N  . 150 . CA . 150 . CB  . 150 . CG  1 1 
       652 . 1 1 150 ARG CA 1 1 150 ARG CB 1 1 150 ARG CG  1 1 150 ARG CD        35.0      325.0 . 150 . CA . 150 . CB . 150 . CG  . 150 . CD  1 1 
       653 . 1 1 151 VAL N  1 1 151 VAL CA 1 1 151 VAL CB  1 1 151 VAL CG1  44.999996      315.0 . 151 . N  . 151 . CA . 151 . CB  . 151 . CG1 1 1 
       654 . 1 1 151 VAL N  1 1 151 VAL CA 1 1 151 VAL CB  1 1 151 VAL CG1     -195.0       85.0 . 151 . N  . 151 . CA . 151 . CB  . 151 . CG1 1 1 
       655 . 1 1 151 VAL N  1 1 151 VAL CA 1 1 151 VAL CB  1 1 151 VAL CG1      -95.0      205.0 . 151 . N  . 151 . CA . 151 . CB  . 151 . CG1 1 1 
       656 . 1 1 153 LEU N  1 1 153 LEU CA 1 1 153 LEU CB  1 1 153 LEU CG         5.0  354.99997 . 153 . N  . 153 . CA . 153 . CB  . 153 . CG  1 1 
       657 . 1 1 153 LEU N  1 1 153 LEU CA 1 1 153 LEU CB  1 1 153 LEU CG      -215.0      105.0 . 153 . N  . 153 . CA . 153 . CB  . 153 . CG  1 1 
       658 . 1 1 153 LEU CA 1 1 153 LEU CB 1 1 153 LEU CG  1 1 153 LEU CD1       35.0      325.0 . 153 . CA . 153 . CB . 153 . CG  . 153 . CD1 1 1 
       659 . 1 1 153 LEU CA 1 1 153 LEU CB 1 1 153 LEU CG  1 1 153 LEU CD1      -95.0      205.0 . 153 . CA . 153 . CB . 153 . CG  . 153 . CD1 1 1 
       660 . 1 1 153 LEU C  1 1 154 MET N  1 1 154 MET CA  1 1 154 MET C    44.999996      315.0 . 153 . C  . 154 . N  . 154 . CA  . 154 . C   1 1 
       661 . 1 1 153 LEU C  1 1 154 MET N  1 1 154 MET CA  1 1 154 MET C       -185.0       75.0 . 153 . C  . 154 . N  . 154 . CA  . 154 . C   1 1 
       662 . 1 1 154 MET N  1 1 154 MET CA 1 1 154 MET CB  1 1 154 MET CG        25.0      335.0 . 154 . N  . 154 . CA . 154 . CB  . 154 . CG  1 1 
       663 . 1 1 154 MET N  1 1 154 MET CA 1 1 154 MET CB  1 1 154 MET CG      -205.0       95.0 . 154 . N  . 154 . CA . 154 . CB  . 154 . CG  1 1 
       664 . 1 1 154 MET CA 1 1 154 MET CB 1 1 154 MET CG  1 1 154 MET SD   44.999996      315.0 . 154 . CA . 154 . CB . 154 . CG  . 154 . SD  1 1 
       665 . 1 1 154 MET N  1 1 154 MET CA 1 1 154 MET C   1 1 155 LEU N        -85.0      205.0 . 154 . N  . 154 . CA . 154 . C   . 155 . N   1 1 
       666 . 1 1 154 MET C  1 1 155 LEU N  1 1 155 LEU CA  1 1 155 LEU C    44.999996      315.0 . 154 . C  . 155 . N  . 155 . CA  . 155 . C   1 1 
       667 . 1 1 154 MET C  1 1 155 LEU N  1 1 155 LEU CA  1 1 155 LEU C       -185.0       75.0 . 154 . C  . 155 . N  . 155 . CA  . 155 . C   1 1 
       668 . 1 1 155 LEU N  1 1 155 LEU CA 1 1 155 LEU CB  1 1 155 LEU CG         5.0  354.99997 . 155 . N  . 155 . CA . 155 . CB  . 155 . CG  1 1 
       669 . 1 1 155 LEU N  1 1 155 LEU CA 1 1 155 LEU CB  1 1 155 LEU CG      -215.0      105.0 . 155 . N  . 155 . CA . 155 . CB  . 155 . CG  1 1 
       670 . 1 1 155 LEU CA 1 1 155 LEU CB 1 1 155 LEU CG  1 1 155 LEU CD1       35.0      325.0 . 155 . CA . 155 . CB . 155 . CG  . 155 . CD1 1 1 
       671 . 1 1 155 LEU CA 1 1 155 LEU CB 1 1 155 LEU CG  1 1 155 LEU CD1      -95.0      205.0 . 155 . CA . 155 . CB . 155 . CG  . 155 . CD1 1 1 
       672 . 1 1 155 LEU N  1 1 155 LEU CA 1 1 155 LEU C   1 1 156 HIS N       -285.0  44.999996 . 155 . N  . 155 . CA . 155 . C   . 156 . N   1 1 
       673 . 1 1 155 LEU N  1 1 155 LEU CA 1 1 155 LEU C   1 1 156 HIS N        -85.0      205.0 . 155 . N  . 155 . CA . 155 . C   . 156 . N   1 1 
       674 . 1 1 155 LEU C  1 1 156 HIS N  1 1 156 HIS CA  1 1 156 HIS C    44.999996      315.0 . 155 . C  . 156 . N  . 156 . CA  . 156 . C   1 1 
       675 . 1 1 155 LEU C  1 1 156 HIS N  1 1 156 HIS CA  1 1 156 HIS C       -185.0       75.0 . 155 . C  . 156 . N  . 156 . CA  . 156 . C   1 1 
       676 . 1 1 156 HIS N  1 1 156 HIS CA 1 1 156 HIS CB  1 1 156 HIS CG        25.0      335.0 . 156 . N  . 156 . CA . 156 . CB  . 156 . CG  1 1 
       677 . 1 1 156 HIS N  1 1 156 HIS CA 1 1 156 HIS CB  1 1 156 HIS CG      -205.0       95.0 . 156 . N  . 156 . CA . 156 . CB  . 156 . CG  1 1 
       678 . 1 1 156 HIS N  1 1 156 HIS CA 1 1 156 HIS C   1 1 157 GLU N        -85.0      195.0 . 156 . N  . 156 . CA . 156 . C   . 157 . N   1 1 
       679 . 1 1 156 HIS C  1 1 157 GLU N  1 1 157 GLU CA  1 1 157 GLU C    44.999996      315.0 . 156 . C  . 157 . N  . 157 . CA  . 157 . C   1 1 
       680 . 1 1 156 HIS C  1 1 157 GLU N  1 1 157 GLU CA  1 1 157 GLU C       -185.0       75.0 . 156 . C  . 157 . N  . 157 . CA  . 157 . C   1 1 
       681 . 1 1 157 GLU N  1 1 157 GLU CA 1 1 157 GLU CB  1 1 157 GLU CG        25.0      335.0 . 157 . N  . 157 . CA . 157 . CB  . 157 . CG  1 1 
       682 . 1 1 157 GLU N  1 1 157 GLU CA 1 1 157 GLU CB  1 1 157 GLU CG      -205.0       95.0 . 157 . N  . 157 . CA . 157 . CB  . 157 . CG  1 1 
       683 . 1 1 157 GLU CA 1 1 157 GLU CB 1 1 157 GLU CG  1 1 157 GLU CD        15.0      345.0 . 157 . CA . 157 . CB . 157 . CG  . 157 . CD  1 1 
       684 . 1 1 157 GLU N  1 1 157 GLU CA 1 1 157 GLU C   1 1 158 SER N        -85.0      195.0 . 157 . N  . 157 . CA . 157 . C   . 158 . N   1 1 
       685 . 1 1 157 GLU C  1 1 158 SER N  1 1 158 SER CA  1 1 158 SER C    44.999996      315.0 . 157 . C  . 158 . N  . 158 . CA  . 158 . C   1 1 
       686 . 1 1 157 GLU C  1 1 158 SER N  1 1 158 SER CA  1 1 158 SER C       -185.0       75.0 . 157 . C  . 158 . N  . 158 . CA  . 158 . C   1 1 
       687 . 1 1 158 SER N  1 1 158 SER CA 1 1 158 SER C   1 1 159 LEU N        -85.0      205.0 . 158 . N  . 158 . CA . 158 . C   . 159 . N   1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C  12.257  11.931  23.064 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C  11.599  12.089  24.434 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C  10.382  13.018  24.343 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C   9.083  15.583  25.755 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C  10.700  14.413  23.832 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H  12.849  13.587  25.190 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H  13.416  12.011  25.458 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H  12.135  12.611  26.381 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H  11.269  11.116  24.769 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H   9.655  12.575  23.678 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H   9.944  13.111  25.325 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H   8.887  14.587  26.122 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H   8.253  16.229  26.002 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H   9.984  15.964  26.213 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H  11.521  14.815  24.407 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H  10.987  14.346  22.794 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N  12.565  12.612  25.432 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O  11.581  11.880  22.036 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S   9.292  15.534  23.975 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 ASP C    C  14.655  10.089  21.754 1.00 . A A .   2 ASP C    1 1 
        1    21 1 1   2 ASP CA   C  14.330  11.573  21.841 1.00 . A A .   2 ASP CA   1 1 
        1    22 1 1   2 ASP CB   C  15.616  12.413  21.788 1.00 . A A .   2 ASP CB   1 1 
        1    23 1 1   2 ASP CG   C  16.301  12.537  23.135 1.00 . A A .   2 ASP CG   1 1 
        1    24 1 1   2 ASP H    H  14.071  11.942  23.905 1.00 . A A .   2 ASP H    1 1 
        1    25 1 1   2 ASP HA   H  13.701  11.839  21.003 1.00 . A A .   2 ASP HA   1 1 
        1    26 1 1   2 ASP HB2  H  16.308  11.954  21.099 1.00 . A A .   2 ASP HB2  1 1 
        1    27 1 1   2 ASP HB3  H  15.375  13.400  21.438 1.00 . A A .   2 ASP HB3  1 1 
        1    28 1 1   2 ASP N    N  13.580  11.840  23.061 1.00 . A A .   2 ASP N    1 1 
        1    29 1 1   2 ASP O    O  14.116   9.375  20.907 1.00 . A A .   2 ASP O    1 1 
        1    30 1 1   2 ASP OD1  O  15.893  13.406  23.933 1.00 . A A .   2 ASP OD1  1 1 
        1    31 1 1   2 ASP OD2  O  17.237  11.766  23.412 1.00 . A A .   2 ASP OD2  1 1 
        1    32 1 1   3 PHE C    C  14.787   7.516  23.613 1.00 . A A .   3 PHE C    1 1 
        1    33 1 1   3 PHE CA   C  15.827   8.212  22.742 1.00 . A A .   3 PHE CA   1 1 
        1    34 1 1   3 PHE CB   C  17.228   7.985  23.322 1.00 . A A .   3 PHE CB   1 1 
        1    35 1 1   3 PHE CD1  C  18.560   8.006  21.194 1.00 . A A .   3 PHE CD1  1 1 
        1    36 1 1   3 PHE CD2  C  19.193   9.502  22.940 1.00 . A A .   3 PHE CD2  1 1 
        1    37 1 1   3 PHE CE1  C  19.591   8.484  20.408 1.00 . A A .   3 PHE CE1  1 1 
        1    38 1 1   3 PHE CE2  C  20.226   9.983  22.159 1.00 . A A .   3 PHE CE2  1 1 
        1    39 1 1   3 PHE CG   C  18.348   8.509  22.467 1.00 . A A .   3 PHE CG   1 1 
        1    40 1 1   3 PHE CZ   C  20.425   9.474  20.892 1.00 . A A .   3 PHE CZ   1 1 
        1    41 1 1   3 PHE H    H  15.993  10.261  23.227 1.00 . A A .   3 PHE H    1 1 
        1    42 1 1   3 PHE HA   H  15.784   7.791  21.750 1.00 . A A .   3 PHE HA   1 1 
        1    43 1 1   3 PHE HB2  H  17.293   8.472  24.283 1.00 . A A .   3 PHE HB2  1 1 
        1    44 1 1   3 PHE HB3  H  17.379   6.929  23.453 1.00 . A A .   3 PHE HB3  1 1 
        1    45 1 1   3 PHE HD1  H  17.910   7.233  20.815 1.00 . A A .   3 PHE HD1  1 1 
        1    46 1 1   3 PHE HD2  H  19.039   9.901  23.932 1.00 . A A .   3 PHE HD2  1 1 
        1    47 1 1   3 PHE HE1  H  19.746   8.086  19.416 1.00 . A A .   3 PHE HE1  1 1 
        1    48 1 1   3 PHE HE2  H  20.877  10.756  22.539 1.00 . A A .   3 PHE HE2  1 1 
        1    49 1 1   3 PHE HZ   H  21.233   9.849  20.280 1.00 . A A .   3 PHE HZ   1 1 
        1    50 1 1   3 PHE N    N  15.527   9.628  22.638 1.00 . A A .   3 PHE N    1 1 
        1    51 1 1   3 PHE O    O  14.966   7.374  24.823 1.00 . A A .   3 PHE O    1 1 
        1    52 1 1   4 GLU C    C  12.745   4.917  23.412 1.00 . A A .   4 GLU C    1 1 
        1    53 1 1   4 GLU CA   C  12.629   6.405  23.697 1.00 . A A .   4 GLU CA   1 1 
        1    54 1 1   4 GLU CB   C  11.254   6.916  23.271 1.00 . A A .   4 GLU CB   1 1 
        1    55 1 1   4 GLU CD   C   9.686   8.882  23.085 1.00 . A A .   4 GLU CD   1 1 
        1    56 1 1   4 GLU CG   C  11.024   8.383  23.588 1.00 . A A .   4 GLU CG   1 1 
        1    57 1 1   4 GLU H    H  13.571   7.320  22.040 1.00 . A A .   4 GLU H    1 1 
        1    58 1 1   4 GLU HA   H  12.759   6.570  24.755 1.00 . A A .   4 GLU HA   1 1 
        1    59 1 1   4 GLU HB2  H  11.148   6.779  22.205 1.00 . A A .   4 GLU HB2  1 1 
        1    60 1 1   4 GLU HB3  H  10.496   6.337  23.777 1.00 . A A .   4 GLU HB3  1 1 
        1    61 1 1   4 GLU HG2  H  11.061   8.516  24.659 1.00 . A A .   4 GLU HG2  1 1 
        1    62 1 1   4 GLU HG3  H  11.809   8.967  23.127 1.00 . A A .   4 GLU HG3  1 1 
        1    63 1 1   4 GLU N    N  13.682   7.124  22.996 1.00 . A A .   4 GLU N    1 1 
        1    64 1 1   4 GLU O    O  12.417   4.086  24.260 1.00 . A A .   4 GLU O    1 1 
        1    65 1 1   4 GLU OE1  O   8.993   8.133  22.362 1.00 . A A .   4 GLU OE1  1 1 
        1    66 1 1   4 GLU OE2  O   9.324  10.034  23.391 1.00 . A A .   4 GLU OE2  1 1 
        1    67 1 1   5 CYS C    C  12.158   2.423  21.732 1.00 . A A .   5 CYS C    1 1 
        1    68 1 1   5 CYS CA   C  13.453   3.231  21.774 1.00 . A A .   5 CYS CA   1 1 
        1    69 1 1   5 CYS CB   C  14.483   2.557  22.685 1.00 . A A .   5 CYS CB   1 1 
        1    70 1 1   5 CYS H    H  13.408   5.336  21.575 1.00 . A A .   5 CYS H    1 1 
        1    71 1 1   5 CYS HA   H  13.858   3.274  20.774 1.00 . A A .   5 CYS HA   1 1 
        1    72 1 1   5 CYS HB2  H  14.090   2.514  23.691 1.00 . A A .   5 CYS HB2  1 1 
        1    73 1 1   5 CYS HB3  H  14.667   1.554  22.331 1.00 . A A .   5 CYS HB3  1 1 
        1    74 1 1   5 CYS HG   H  16.827   2.832  23.661 1.00 . A A .   5 CYS HG   1 1 
        1    75 1 1   5 CYS N    N  13.216   4.606  22.204 1.00 . A A .   5 CYS N    1 1 
        1    76 1 1   5 CYS O    O  11.685   1.918  22.750 1.00 . A A .   5 CYS O    1 1 
        1    77 1 1   5 CYS SG   S  16.069   3.426  22.745 1.00 . A A .   5 CYS SG   1 1 
        1    78 1 1   6 GLN C    C  10.328   0.965  18.943 1.00 . A A .   6 GLN C    1 1 
        1    79 1 1   6 GLN CA   C  10.359   1.560  20.349 1.00 . A A .   6 GLN CA   1 1 
        1    80 1 1   6 GLN CB   C   9.131   2.451  20.607 1.00 . A A .   6 GLN CB   1 1 
        1    81 1 1   6 GLN CD   C   8.083   4.733  20.306 1.00 . A A .   6 GLN CD   1 1 
        1    82 1 1   6 GLN CG   C   9.116   3.744  19.803 1.00 . A A .   6 GLN CG   1 1 
        1    83 1 1   6 GLN H    H  11.997   2.758  19.773 1.00 . A A .   6 GLN H    1 1 
        1    84 1 1   6 GLN HA   H  10.359   0.750  21.064 1.00 . A A .   6 GLN HA   1 1 
        1    85 1 1   6 GLN HB2  H   8.240   1.893  20.362 1.00 . A A .   6 GLN HB2  1 1 
        1    86 1 1   6 GLN HB3  H   9.104   2.708  21.656 1.00 . A A .   6 GLN HB3  1 1 
        1    87 1 1   6 GLN HE21 H   9.431   5.551  21.507 1.00 . A A .   6 GLN HE21 1 1 
        1    88 1 1   6 GLN HE22 H   7.859   6.259  21.557 1.00 . A A .   6 GLN HE22 1 1 
        1    89 1 1   6 GLN HG2  H  10.090   4.203  19.867 1.00 . A A .   6 GLN HG2  1 1 
        1    90 1 1   6 GLN HG3  H   8.896   3.508  18.772 1.00 . A A .   6 GLN HG3  1 1 
        1    91 1 1   6 GLN N    N  11.585   2.317  20.544 1.00 . A A .   6 GLN N    1 1 
        1    92 1 1   6 GLN NE2  N   8.498   5.598  21.215 1.00 . A A .   6 GLN NE2  1 1 
        1    93 1 1   6 GLN O    O  10.277   1.695  17.952 1.00 . A A .   6 GLN O    1 1 
        1    94 1 1   6 GLN OE1  O   6.929   4.723  19.880 1.00 . A A .   6 GLN OE1  1 1 
        1    95 1 1   7 PHE C    C  11.675  -0.804  16.805 1.00 . A A .   7 PHE C    1 1 
        1    96 1 1   7 PHE CA   C  10.410  -1.102  17.612 1.00 . A A .   7 PHE CA   1 1 
        1    97 1 1   7 PHE CB   C   9.168  -0.786  16.775 1.00 . A A .   7 PHE CB   1 1 
        1    98 1 1   7 PHE CD1  C   7.453  -2.562  17.215 1.00 . A A .   7 PHE CD1  1 1 
        1    99 1 1   7 PHE CD2  C   7.086  -0.388  18.125 1.00 . A A .   7 PHE CD2  1 1 
        1   100 1 1   7 PHE CE1  C   6.262  -2.996  17.766 1.00 . A A .   7 PHE CE1  1 1 
        1   101 1 1   7 PHE CE2  C   5.895  -0.817  18.679 1.00 . A A .   7 PHE CE2  1 1 
        1   102 1 1   7 PHE CG   C   7.878  -1.254  17.387 1.00 . A A .   7 PHE CG   1 1 
        1   103 1 1   7 PHE CZ   C   5.483  -2.123  18.500 1.00 . A A .   7 PHE CZ   1 1 
        1   104 1 1   7 PHE H    H  10.427  -0.875  19.705 1.00 . A A .   7 PHE H    1 1 
        1   105 1 1   7 PHE HA   H  10.402  -2.155  17.853 1.00 . A A .   7 PHE HA   1 1 
        1   106 1 1   7 PHE HB2  H   9.099   0.282  16.635 1.00 . A A .   7 PHE HB2  1 1 
        1   107 1 1   7 PHE HB3  H   9.272  -1.261  15.816 1.00 . A A .   7 PHE HB3  1 1 
        1   108 1 1   7 PHE HD1  H   8.062  -3.245  16.644 1.00 . A A .   7 PHE HD1  1 1 
        1   109 1 1   7 PHE HD2  H   7.407   0.634  18.267 1.00 . A A .   7 PHE HD2  1 1 
        1   110 1 1   7 PHE HE1  H   5.942  -4.018  17.624 1.00 . A A .   7 PHE HE1  1 1 
        1   111 1 1   7 PHE HE2  H   5.287  -0.132  19.252 1.00 . A A .   7 PHE HE2  1 1 
        1   112 1 1   7 PHE HZ   H   4.551  -2.460  18.931 1.00 . A A .   7 PHE HZ   1 1 
        1   113 1 1   7 PHE N    N  10.391  -0.367  18.876 1.00 . A A .   7 PHE N    1 1 
        1   114 1 1   7 PHE O    O  12.563  -0.071  17.253 1.00 . A A .   7 PHE O    1 1 
        1   115 1 1   8 VAL C    C  12.332  -0.625  13.391 1.00 . A A .   8 VAL C    1 1 
        1   116 1 1   8 VAL CA   C  12.871  -1.150  14.717 1.00 . A A .   8 VAL CA   1 1 
        1   117 1 1   8 VAL CB   C  13.719  -2.417  14.462 1.00 . A A .   8 VAL CB   1 1 
        1   118 1 1   8 VAL CG1  C  14.867  -2.117  13.510 1.00 . A A .   8 VAL CG1  1 1 
        1   119 1 1   8 VAL CG2  C  14.249  -2.986  15.771 1.00 . A A .   8 VAL CG2  1 1 
        1   120 1 1   8 VAL H    H  11.071  -2.052  15.365 1.00 . A A .   8 VAL H    1 1 
        1   121 1 1   8 VAL HA   H  13.505  -0.397  15.163 1.00 . A A .   8 VAL HA   1 1 
        1   122 1 1   8 VAL HB   H  13.086  -3.161  14.002 1.00 . A A .   8 VAL HB   1 1 
        1   123 1 1   8 VAL HG11 H  15.457  -3.011  13.363 1.00 . A A .   8 VAL HG11 1 1 
        1   124 1 1   8 VAL HG12 H  15.488  -1.339  13.929 1.00 . A A .   8 VAL HG12 1 1 
        1   125 1 1   8 VAL HG13 H  14.469  -1.788  12.561 1.00 . A A .   8 VAL HG13 1 1 
        1   126 1 1   8 VAL HG21 H  14.839  -3.867  15.568 1.00 . A A .   8 VAL HG21 1 1 
        1   127 1 1   8 VAL HG22 H  13.420  -3.247  16.411 1.00 . A A .   8 VAL HG22 1 1 
        1   128 1 1   8 VAL HG23 H  14.864  -2.246  16.261 1.00 . A A .   8 VAL HG23 1 1 
        1   129 1 1   8 VAL N    N  11.767  -1.408  15.629 1.00 . A A .   8 VAL N    1 1 
        1   130 1 1   8 VAL O    O  11.735  -1.368  12.611 1.00 . A A .   8 VAL O    1 1 
        1   131 1 1   9 CYS C    C  13.122   1.448  10.912 1.00 . A A .   9 CYS C    1 1 
        1   132 1 1   9 CYS CA   C  12.020   1.299  11.954 1.00 . A A .   9 CYS CA   1 1 
        1   133 1 1   9 CYS CB   C  11.439   2.665  12.309 1.00 . A A .   9 CYS CB   1 1 
        1   134 1 1   9 CYS H    H  13.025   1.196  13.805 1.00 . A A .   9 CYS H    1 1 
        1   135 1 1   9 CYS HA   H  11.237   0.676  11.551 1.00 . A A .   9 CYS HA   1 1 
        1   136 1 1   9 CYS HB2  H  12.241   3.322  12.613 1.00 . A A .   9 CYS HB2  1 1 
        1   137 1 1   9 CYS HB3  H  10.952   3.079  11.439 1.00 . A A .   9 CYS HB3  1 1 
        1   138 1 1   9 CYS HG   H   9.388   1.621  13.404 1.00 . A A .   9 CYS HG   1 1 
        1   139 1 1   9 CYS N    N  12.528   0.660  13.155 1.00 . A A .   9 CYS N    1 1 
        1   140 1 1   9 CYS O    O  14.267   1.771  11.243 1.00 . A A .   9 CYS O    1 1 
        1   141 1 1   9 CYS SG   S  10.228   2.618  13.651 1.00 . A A .   9 CYS SG   1 1 
        1   142 1 1  10 GLU C    C  13.338   2.371   7.564 1.00 . A A .  10 GLU C    1 1 
        1   143 1 1  10 GLU CA   C  13.749   1.309   8.577 1.00 . A A .  10 GLU CA   1 1 
        1   144 1 1  10 GLU CB   C  13.914  -0.045   7.876 1.00 . A A .  10 GLU CB   1 1 
        1   145 1 1  10 GLU CD   C  12.796  -1.882   6.541 1.00 . A A .  10 GLU CD   1 1 
        1   146 1 1  10 GLU CG   C  12.603  -0.646   7.392 1.00 . A A .  10 GLU CG   1 1 
        1   147 1 1  10 GLU H    H  11.851   0.971   9.443 1.00 . A A .  10 GLU H    1 1 
        1   148 1 1  10 GLU HA   H  14.696   1.593   9.011 1.00 . A A .  10 GLU HA   1 1 
        1   149 1 1  10 GLU HB2  H  14.563   0.081   7.023 1.00 . A A .  10 GLU HB2  1 1 
        1   150 1 1  10 GLU HB3  H  14.370  -0.740   8.565 1.00 . A A .  10 GLU HB3  1 1 
        1   151 1 1  10 GLU HG2  H  12.006  -0.912   8.252 1.00 . A A .  10 GLU HG2  1 1 
        1   152 1 1  10 GLU HG3  H  12.077   0.097   6.809 1.00 . A A .  10 GLU HG3  1 1 
        1   153 1 1  10 GLU N    N  12.780   1.212   9.655 1.00 . A A .  10 GLU N    1 1 
        1   154 1 1  10 GLU O    O  12.149   2.570   7.294 1.00 . A A .  10 GLU O    1 1 
        1   155 1 1  10 GLU OE1  O  13.882  -2.492   6.599 1.00 . A A .  10 GLU OE1  1 1 
        1   156 1 1  10 GLU OE2  O  11.863  -2.246   5.794 1.00 . A A .  10 GLU OE2  1 1 
        1   157 1 1  11 LEU C    C  14.124   3.202   4.633 1.00 . A A .  11 LEU C    1 1 
        1   158 1 1  11 LEU CA   C  14.091   3.987   5.929 1.00 . A A .  11 LEU CA   1 1 
        1   159 1 1  11 LEU CB   C  15.146   5.094   5.912 1.00 . A A .  11 LEU CB   1 1 
        1   160 1 1  11 LEU CD1  C  13.703   6.931   4.988 1.00 . A A .  11 LEU CD1  1 1 
        1   161 1 1  11 LEU CD2  C  16.188   7.072   4.779 1.00 . A A .  11 LEU CD2  1 1 
        1   162 1 1  11 LEU CG   C  14.988   6.139   4.803 1.00 . A A .  11 LEU CG   1 1 
        1   163 1 1  11 LEU H    H  15.237   2.952   7.366 1.00 . A A .  11 LEU H    1 1 
        1   164 1 1  11 LEU HA   H  13.110   4.423   6.056 1.00 . A A .  11 LEU HA   1 1 
        1   165 1 1  11 LEU HB2  H  15.108   5.602   6.860 1.00 . A A .  11 LEU HB2  1 1 
        1   166 1 1  11 LEU HB3  H  16.117   4.634   5.806 1.00 . A A .  11 LEU HB3  1 1 
        1   167 1 1  11 LEU HD11 H  13.717   7.416   5.954 1.00 . A A .  11 LEU HD11 1 1 
        1   168 1 1  11 LEU HD12 H  12.857   6.263   4.931 1.00 . A A .  11 LEU HD12 1 1 
        1   169 1 1  11 LEU HD13 H  13.627   7.679   4.212 1.00 . A A .  11 LEU HD13 1 1 
        1   170 1 1  11 LEU HD21 H  16.079   7.778   3.968 1.00 . A A .  11 LEU HD21 1 1 
        1   171 1 1  11 LEU HD22 H  17.090   6.496   4.636 1.00 . A A .  11 LEU HD22 1 1 
        1   172 1 1  11 LEU HD23 H  16.246   7.607   5.715 1.00 . A A .  11 LEU HD23 1 1 
        1   173 1 1  11 LEU HG   H  14.935   5.636   3.849 1.00 . A A .  11 LEU HG   1 1 
        1   174 1 1  11 LEU N    N  14.325   3.067   7.025 1.00 . A A .  11 LEU N    1 1 
        1   175 1 1  11 LEU O    O  15.191   2.818   4.151 1.00 . A A .  11 LEU O    1 1 
        1   176 1 1  12 LYS C    C  12.242   2.841   1.766 1.00 . A A .  12 LYS C    1 1 
        1   177 1 1  12 LYS CA   C  12.855   2.081   2.924 1.00 . A A .  12 LYS CA   1 1 
        1   178 1 1  12 LYS CB   C  12.019   0.836   3.230 1.00 . A A .  12 LYS CB   1 1 
        1   179 1 1  12 LYS CD   C  11.614  -1.608   2.755 1.00 . A A .  12 LYS CD   1 1 
        1   180 1 1  12 LYS CE   C  12.272  -2.891   2.274 1.00 . A A .  12 LYS CE   1 1 
        1   181 1 1  12 LYS CG   C  12.506  -0.405   2.498 1.00 . A A .  12 LYS CG   1 1 
        1   182 1 1  12 LYS H    H  12.146   3.343   4.466 1.00 . A A .  12 LYS H    1 1 
        1   183 1 1  12 LYS HA   H  13.854   1.774   2.651 1.00 . A A .  12 LYS HA   1 1 
        1   184 1 1  12 LYS HB2  H  12.049   0.643   4.291 1.00 . A A .  12 LYS HB2  1 1 
        1   185 1 1  12 LYS HB3  H  10.997   1.023   2.934 1.00 . A A .  12 LYS HB3  1 1 
        1   186 1 1  12 LYS HD2  H  11.426  -1.685   3.815 1.00 . A A .  12 LYS HD2  1 1 
        1   187 1 1  12 LYS HD3  H  10.680  -1.473   2.228 1.00 . A A .  12 LYS HD3  1 1 
        1   188 1 1  12 LYS HE2  H  11.545  -3.688   2.309 1.00 . A A .  12 LYS HE2  1 1 
        1   189 1 1  12 LYS HE3  H  12.603  -2.750   1.255 1.00 . A A .  12 LYS HE3  1 1 
        1   190 1 1  12 LYS HG2  H  12.516  -0.201   1.437 1.00 . A A .  12 LYS HG2  1 1 
        1   191 1 1  12 LYS HG3  H  13.508  -0.634   2.830 1.00 . A A .  12 LYS HG3  1 1 
        1   192 1 1  12 LYS HZ1  H  13.989  -2.416   3.370 1.00 . A A .  12 LYS HZ1  1 1 
        1   193 1 1  12 LYS HZ2  H  14.064  -3.915   2.595 1.00 . A A .  12 LYS HZ2  1 1 
        1   194 1 1  12 LYS HZ3  H  13.120  -3.733   3.989 1.00 . A A .  12 LYS HZ3  1 1 
        1   195 1 1  12 LYS N    N  12.957   2.934   4.090 1.00 . A A .  12 LYS N    1 1 
        1   196 1 1  12 LYS NZ   N  13.441  -3.264   3.115 1.00 . A A .  12 LYS NZ   1 1 
        1   197 1 1  12 LYS O    O  11.369   3.690   1.954 1.00 . A A .  12 LYS O    1 1 
        1   198 1 1  13 GLU C    C  11.008   2.404  -1.173 1.00 . A A .  13 GLU C    1 1 
        1   199 1 1  13 GLU CA   C  12.193   3.179  -0.617 1.00 . A A .  13 GLU CA   1 1 
        1   200 1 1  13 GLU CB   C  13.291   3.307  -1.671 1.00 . A A .  13 GLU CB   1 1 
        1   201 1 1  13 GLU CD   C  15.088   2.175  -3.009 1.00 . A A .  13 GLU CD   1 1 
        1   202 1 1  13 GLU CG   C  13.958   1.991  -2.026 1.00 . A A .  13 GLU CG   1 1 
        1   203 1 1  13 GLU H    H  13.427   1.879   0.491 1.00 . A A .  13 GLU H    1 1 
        1   204 1 1  13 GLU HA   H  11.858   4.168  -0.342 1.00 . A A .  13 GLU HA   1 1 
        1   205 1 1  13 GLU HB2  H  12.862   3.722  -2.572 1.00 . A A .  13 GLU HB2  1 1 
        1   206 1 1  13 GLU HB3  H  14.050   3.982  -1.303 1.00 . A A .  13 GLU HB3  1 1 
        1   207 1 1  13 GLU HG2  H  14.351   1.543  -1.124 1.00 . A A .  13 GLU HG2  1 1 
        1   208 1 1  13 GLU HG3  H  13.221   1.334  -2.463 1.00 . A A .  13 GLU HG3  1 1 
        1   209 1 1  13 GLU N    N  12.711   2.544   0.574 1.00 . A A .  13 GLU N    1 1 
        1   210 1 1  13 GLU O    O  10.838   1.211  -0.905 1.00 . A A .  13 GLU O    1 1 
        1   211 1 1  13 GLU OE1  O  16.124   2.752  -2.621 1.00 . A A .  13 GLU OE1  1 1 
        1   212 1 1  13 GLU OE2  O  14.946   1.755  -4.176 1.00 . A A .  13 GLU OE2  1 1 
        1   213 1 1  14 LEU C    C   9.490   2.045  -3.974 1.00 . A A .  14 LEU C    1 1 
        1   214 1 1  14 LEU CA   C   9.046   2.504  -2.593 1.00 . A A .  14 LEU CA   1 1 
        1   215 1 1  14 LEU CB   C   7.903   3.512  -2.704 1.00 . A A .  14 LEU CB   1 1 
        1   216 1 1  14 LEU CD1  C   6.461   5.239  -1.603 1.00 . A A .  14 LEU CD1  1 1 
        1   217 1 1  14 LEU CD2  C   6.866   3.053  -0.468 1.00 . A A .  14 LEU CD2  1 1 
        1   218 1 1  14 LEU CG   C   7.461   4.122  -1.373 1.00 . A A .  14 LEU CG   1 1 
        1   219 1 1  14 LEU H    H  10.306   4.079  -1.976 1.00 . A A .  14 LEU H    1 1 
        1   220 1 1  14 LEU HA   H   8.718   1.649  -2.021 1.00 . A A .  14 LEU HA   1 1 
        1   221 1 1  14 LEU HB2  H   8.216   4.311  -3.360 1.00 . A A .  14 LEU HB2  1 1 
        1   222 1 1  14 LEU HB3  H   7.052   3.016  -3.147 1.00 . A A .  14 LEU HB3  1 1 
        1   223 1 1  14 LEU HD11 H   6.909   6.001  -2.221 1.00 . A A .  14 LEU HD11 1 1 
        1   224 1 1  14 LEU HD12 H   6.174   5.666  -0.654 1.00 . A A .  14 LEU HD12 1 1 
        1   225 1 1  14 LEU HD13 H   5.588   4.842  -2.098 1.00 . A A .  14 LEU HD13 1 1 
        1   226 1 1  14 LEU HD21 H   7.604   2.286  -0.281 1.00 . A A .  14 LEU HD21 1 1 
        1   227 1 1  14 LEU HD22 H   6.005   2.614  -0.950 1.00 . A A .  14 LEU HD22 1 1 
        1   228 1 1  14 LEU HD23 H   6.566   3.500   0.468 1.00 . A A .  14 LEU HD23 1 1 
        1   229 1 1  14 LEU HG   H   8.322   4.544  -0.875 1.00 . A A .  14 LEU HG   1 1 
        1   230 1 1  14 LEU N    N  10.169   3.110  -1.905 1.00 . A A .  14 LEU N    1 1 
        1   231 1 1  14 LEU O    O  10.308   2.707  -4.615 1.00 . A A .  14 LEU O    1 1 
        1   232 1 1  15 ALA C    C   8.382   0.716  -6.802 1.00 . A A .  15 ALA C    1 1 
        1   233 1 1  15 ALA CA   C   9.368   0.347  -5.698 1.00 . A A .  15 ALA CA   1 1 
        1   234 1 1  15 ALA CB   C   9.489  -1.163  -5.583 1.00 . A A .  15 ALA CB   1 1 
        1   235 1 1  15 ALA H    H   8.297   0.452  -3.881 1.00 . A A .  15 ALA H    1 1 
        1   236 1 1  15 ALA HA   H  10.340   0.743  -5.949 1.00 . A A .  15 ALA HA   1 1 
        1   237 1 1  15 ALA HB1  H   8.522  -1.586  -5.350 1.00 . A A .  15 ALA HB1  1 1 
        1   238 1 1  15 ALA HB2  H  10.188  -1.409  -4.798 1.00 . A A .  15 ALA HB2  1 1 
        1   239 1 1  15 ALA HB3  H   9.843  -1.567  -6.521 1.00 . A A .  15 ALA HB3  1 1 
        1   240 1 1  15 ALA N    N   8.968   0.916  -4.420 1.00 . A A .  15 ALA N    1 1 
        1   241 1 1  15 ALA O    O   7.182   0.858  -6.553 1.00 . A A .  15 ALA O    1 1 
        1   242 1 1  16 PRO C    C   7.385  -0.087  -9.732 1.00 . A A .  16 PRO C    1 1 
        1   243 1 1  16 PRO CA   C   8.053   1.175  -9.202 1.00 . A A .  16 PRO CA   1 1 
        1   244 1 1  16 PRO CB   C   9.042   1.739 -10.238 1.00 . A A .  16 PRO CB   1 1 
        1   245 1 1  16 PRO CD   C  10.304   0.867  -8.390 1.00 . A A .  16 PRO CD   1 1 
        1   246 1 1  16 PRO CG   C  10.364   1.829  -9.542 1.00 . A A .  16 PRO CG   1 1 
        1   247 1 1  16 PRO HA   H   7.293   1.911  -8.982 1.00 . A A .  16 PRO HA   1 1 
        1   248 1 1  16 PRO HB2  H   9.091   1.072 -11.086 1.00 . A A .  16 PRO HB2  1 1 
        1   249 1 1  16 PRO HB3  H   8.703   2.712 -10.564 1.00 . A A .  16 PRO HB3  1 1 
        1   250 1 1  16 PRO HD2  H  10.607  -0.122  -8.703 1.00 . A A .  16 PRO HD2  1 1 
        1   251 1 1  16 PRO HD3  H  10.917   1.215  -7.572 1.00 . A A .  16 PRO HD3  1 1 
        1   252 1 1  16 PRO HG2  H  11.154   1.547 -10.221 1.00 . A A .  16 PRO HG2  1 1 
        1   253 1 1  16 PRO HG3  H  10.521   2.835  -9.181 1.00 . A A .  16 PRO HG3  1 1 
        1   254 1 1  16 PRO N    N   8.884   0.898  -8.033 1.00 . A A .  16 PRO N    1 1 
        1   255 1 1  16 PRO O    O   8.025  -0.922 -10.373 1.00 . A A .  16 PRO O    1 1 
        1   256 1 1  17 VAL C    C   4.159  -1.051 -10.677 1.00 . A A .  17 VAL C    1 1 
        1   257 1 1  17 VAL CA   C   5.369  -1.429  -9.826 1.00 . A A .  17 VAL CA   1 1 
        1   258 1 1  17 VAL CB   C   4.890  -2.193  -8.565 1.00 . A A .  17 VAL CB   1 1 
        1   259 1 1  17 VAL CG1  C   4.159  -3.472  -8.931 1.00 . A A .  17 VAL CG1  1 1 
        1   260 1 1  17 VAL CG2  C   6.058  -2.497  -7.637 1.00 . A A .  17 VAL CG2  1 1 
        1   261 1 1  17 VAL H    H   5.634   0.477  -8.950 1.00 . A A .  17 VAL H    1 1 
        1   262 1 1  17 VAL HA   H   6.027  -2.071 -10.395 1.00 . A A .  17 VAL HA   1 1 
        1   263 1 1  17 VAL HB   H   4.199  -1.558  -8.031 1.00 . A A .  17 VAL HB   1 1 
        1   264 1 1  17 VAL HG11 H   4.816  -4.110  -9.502 1.00 . A A .  17 VAL HG11 1 1 
        1   265 1 1  17 VAL HG12 H   3.289  -3.230  -9.522 1.00 . A A .  17 VAL HG12 1 1 
        1   266 1 1  17 VAL HG13 H   3.853  -3.982  -8.030 1.00 . A A .  17 VAL HG13 1 1 
        1   267 1 1  17 VAL HG21 H   5.701  -3.041  -6.776 1.00 . A A .  17 VAL HG21 1 1 
        1   268 1 1  17 VAL HG22 H   6.512  -1.571  -7.316 1.00 . A A .  17 VAL HG22 1 1 
        1   269 1 1  17 VAL HG23 H   6.790  -3.094  -8.162 1.00 . A A .  17 VAL HG23 1 1 
        1   270 1 1  17 VAL N    N   6.105  -0.237  -9.439 1.00 . A A .  17 VAL N    1 1 
        1   271 1 1  17 VAL O    O   3.519  -0.025 -10.427 1.00 . A A .  17 VAL O    1 1 
        1   272 1 1  18 PRO C    C   1.403  -2.095 -11.633 1.00 . A A .  18 PRO C    1 1 
        1   273 1 1  18 PRO CA   C   2.606  -1.693 -12.475 1.00 . A A .  18 PRO CA   1 1 
        1   274 1 1  18 PRO CB   C   2.774  -2.648 -13.667 1.00 . A A .  18 PRO CB   1 1 
        1   275 1 1  18 PRO CD   C   4.661  -2.954 -12.231 1.00 . A A .  18 PRO CD   1 1 
        1   276 1 1  18 PRO CG   C   4.211  -3.050 -13.659 1.00 . A A .  18 PRO CG   1 1 
        1   277 1 1  18 PRO HA   H   2.482  -0.678 -12.828 1.00 . A A .  18 PRO HA   1 1 
        1   278 1 1  18 PRO HB2  H   2.126  -3.502 -13.536 1.00 . A A .  18 PRO HB2  1 1 
        1   279 1 1  18 PRO HB3  H   2.515  -2.133 -14.581 1.00 . A A .  18 PRO HB3  1 1 
        1   280 1 1  18 PRO HD2  H   4.454  -3.874 -11.706 1.00 . A A .  18 PRO HD2  1 1 
        1   281 1 1  18 PRO HD3  H   5.713  -2.713 -12.179 1.00 . A A .  18 PRO HD3  1 1 
        1   282 1 1  18 PRO HG2  H   4.309  -4.065 -14.016 1.00 . A A .  18 PRO HG2  1 1 
        1   283 1 1  18 PRO HG3  H   4.784  -2.377 -14.279 1.00 . A A .  18 PRO HG3  1 1 
        1   284 1 1  18 PRO N    N   3.840  -1.853 -11.708 1.00 . A A .  18 PRO N    1 1 
        1   285 1 1  18 PRO O    O   1.229  -3.270 -11.305 1.00 . A A .  18 PRO O    1 1 
        1   286 1 1  19 ALA C    C  -1.768  -0.666 -10.761 1.00 . A A .  19 ALA C    1 1 
        1   287 1 1  19 ALA CA   C  -0.501  -1.385 -10.342 1.00 . A A .  19 ALA CA   1 1 
        1   288 1 1  19 ALA CB   C  -0.095  -0.958  -8.938 1.00 . A A .  19 ALA CB   1 1 
        1   289 1 1  19 ALA H    H   0.712  -0.220 -11.625 1.00 . A A .  19 ALA H    1 1 
        1   290 1 1  19 ALA HA   H  -0.687  -2.449 -10.330 1.00 . A A .  19 ALA HA   1 1 
        1   291 1 1  19 ALA HB1  H   0.823  -1.455  -8.664 1.00 . A A .  19 ALA HB1  1 1 
        1   292 1 1  19 ALA HB2  H  -0.874  -1.227  -8.240 1.00 . A A .  19 ALA HB2  1 1 
        1   293 1 1  19 ALA HB3  H   0.055   0.112  -8.917 1.00 . A A .  19 ALA HB3  1 1 
        1   294 1 1  19 ALA N    N   0.586  -1.128 -11.265 1.00 . A A .  19 ALA N    1 1 
        1   295 1 1  19 ALA O    O  -1.743   0.523 -11.061 1.00 . A A .  19 ALA O    1 1 
        1   296 1 1  20 LEU C    C  -4.790  -0.418  -9.691 1.00 . A A .  20 LEU C    1 1 
        1   297 1 1  20 LEU CA   C  -4.165  -0.767 -11.030 1.00 . A A .  20 LEU CA   1 1 
        1   298 1 1  20 LEU CB   C  -5.091  -1.673 -11.872 1.00 . A A .  20 LEU CB   1 1 
        1   299 1 1  20 LEU CD1  C  -6.837  -2.673 -10.351 1.00 . A A .  20 LEU CD1  1 1 
        1   300 1 1  20 LEU CD2  C  -5.946  -3.996 -12.266 1.00 . A A .  20 LEU CD2  1 1 
        1   301 1 1  20 LEU CG   C  -5.610  -2.957 -11.208 1.00 . A A .  20 LEU CG   1 1 
        1   302 1 1  20 LEU H    H  -2.828  -2.355 -10.619 1.00 . A A .  20 LEU H    1 1 
        1   303 1 1  20 LEU HA   H  -3.984   0.152 -11.572 1.00 . A A .  20 LEU HA   1 1 
        1   304 1 1  20 LEU HB2  H  -5.947  -1.086 -12.169 1.00 . A A .  20 LEU HB2  1 1 
        1   305 1 1  20 LEU HB3  H  -4.553  -1.956 -12.766 1.00 . A A .  20 LEU HB3  1 1 
        1   306 1 1  20 LEU HD11 H  -7.608  -2.227 -10.965 1.00 . A A .  20 LEU HD11 1 1 
        1   307 1 1  20 LEU HD12 H  -6.572  -1.990  -9.557 1.00 . A A .  20 LEU HD12 1 1 
        1   308 1 1  20 LEU HD13 H  -7.204  -3.595  -9.926 1.00 . A A .  20 LEU HD13 1 1 
        1   309 1 1  20 LEU HD21 H  -6.278  -4.904 -11.787 1.00 . A A .  20 LEU HD21 1 1 
        1   310 1 1  20 LEU HD22 H  -5.069  -4.201 -12.860 1.00 . A A .  20 LEU HD22 1 1 
        1   311 1 1  20 LEU HD23 H  -6.732  -3.617 -12.903 1.00 . A A .  20 LEU HD23 1 1 
        1   312 1 1  20 LEU HG   H  -4.841  -3.364 -10.568 1.00 . A A .  20 LEU HG   1 1 
        1   313 1 1  20 LEU N    N  -2.877  -1.389 -10.788 1.00 . A A .  20 LEU N    1 1 
        1   314 1 1  20 LEU O    O  -4.600  -1.133  -8.702 1.00 . A A .  20 LEU O    1 1 
        1   315 1 1  21 LEU C    C  -7.235   2.104  -8.651 1.00 . A A .  21 LEU C    1 1 
        1   316 1 1  21 LEU CA   C  -6.081   1.153  -8.404 1.00 . A A .  21 LEU CA   1 1 
        1   317 1 1  21 LEU CB   C  -4.997   1.825  -7.543 1.00 . A A .  21 LEU CB   1 1 
        1   318 1 1  21 LEU CD1  C  -4.626   4.032  -8.722 1.00 . A A .  21 LEU CD1  1 1 
        1   319 1 1  21 LEU CD2  C  -2.763   2.965  -7.439 1.00 . A A .  21 LEU CD2  1 1 
        1   320 1 1  21 LEU CG   C  -3.994   2.714  -8.296 1.00 . A A .  21 LEU CG   1 1 
        1   321 1 1  21 LEU H    H  -5.656   1.201 -10.474 1.00 . A A .  21 LEU H    1 1 
        1   322 1 1  21 LEU HA   H  -6.457   0.291  -7.874 1.00 . A A .  21 LEU HA   1 1 
        1   323 1 1  21 LEU HB2  H  -5.489   2.431  -6.797 1.00 . A A .  21 LEU HB2  1 1 
        1   324 1 1  21 LEU HB3  H  -4.443   1.048  -7.038 1.00 . A A .  21 LEU HB3  1 1 
        1   325 1 1  21 LEU HD11 H  -3.900   4.620  -9.264 1.00 . A A .  21 LEU HD11 1 1 
        1   326 1 1  21 LEU HD12 H  -4.949   4.575  -7.847 1.00 . A A .  21 LEU HD12 1 1 
        1   327 1 1  21 LEU HD13 H  -5.476   3.834  -9.358 1.00 . A A .  21 LEU HD13 1 1 
        1   328 1 1  21 LEU HD21 H  -3.054   3.475  -6.532 1.00 . A A .  21 LEU HD21 1 1 
        1   329 1 1  21 LEU HD22 H  -2.062   3.578  -7.986 1.00 . A A .  21 LEU HD22 1 1 
        1   330 1 1  21 LEU HD23 H  -2.299   2.022  -7.189 1.00 . A A .  21 LEU HD23 1 1 
        1   331 1 1  21 LEU HG   H  -3.675   2.197  -9.190 1.00 . A A .  21 LEU HG   1 1 
        1   332 1 1  21 LEU N    N  -5.508   0.684  -9.647 1.00 . A A .  21 LEU N    1 1 
        1   333 1 1  21 LEU O    O  -7.335   2.721  -9.711 1.00 . A A .  21 LEU O    1 1 
        1   334 1 1  22 ILE C    C  -8.814   4.280  -6.703 1.00 . A A .  22 ILE C    1 1 
        1   335 1 1  22 ILE CA   C  -9.168   3.180  -7.694 1.00 . A A .  22 ILE CA   1 1 
        1   336 1 1  22 ILE CB   C -10.558   2.576  -7.360 1.00 . A A .  22 ILE CB   1 1 
        1   337 1 1  22 ILE CD1  C -13.021   3.159  -7.036 1.00 . A A .  22 ILE CD1  1 1 
        1   338 1 1  22 ILE CG1  C -11.625   3.673  -7.319 1.00 . A A .  22 ILE CG1  1 1 
        1   339 1 1  22 ILE CG2  C -10.529   1.810  -6.046 1.00 . A A .  22 ILE CG2  1 1 
        1   340 1 1  22 ILE H    H  -8.070   1.555  -6.934 1.00 . A A .  22 ILE H    1 1 
        1   341 1 1  22 ILE HA   H  -9.208   3.604  -8.688 1.00 . A A .  22 ILE HA   1 1 
        1   342 1 1  22 ILE HB   H -10.811   1.876  -8.142 1.00 . A A .  22 ILE HB   1 1 
        1   343 1 1  22 ILE HD11 H -13.028   2.633  -6.092 1.00 . A A .  22 ILE HD11 1 1 
        1   344 1 1  22 ILE HD12 H -13.323   2.486  -7.824 1.00 . A A .  22 ILE HD12 1 1 
        1   345 1 1  22 ILE HD13 H -13.709   3.991  -6.989 1.00 . A A .  22 ILE HD13 1 1 
        1   346 1 1  22 ILE HG12 H -11.371   4.383  -6.547 1.00 . A A .  22 ILE HG12 1 1 
        1   347 1 1  22 ILE HG13 H -11.645   4.178  -8.274 1.00 . A A .  22 ILE HG13 1 1 
        1   348 1 1  22 ILE HG21 H  -9.834   0.989  -6.123 1.00 . A A .  22 ILE HG21 1 1 
        1   349 1 1  22 ILE HG22 H -11.516   1.430  -5.829 1.00 . A A .  22 ILE HG22 1 1 
        1   350 1 1  22 ILE HG23 H -10.217   2.473  -5.252 1.00 . A A .  22 ILE HG23 1 1 
        1   351 1 1  22 ILE N    N  -8.122   2.183  -7.681 1.00 . A A .  22 ILE N    1 1 
        1   352 1 1  22 ILE O    O  -8.777   4.053  -5.493 1.00 . A A .  22 ILE O    1 1 
        1   353 1 1  23 ARG C    C  -9.445   7.229  -5.857 1.00 . A A .  23 ARG C    1 1 
        1   354 1 1  23 ARG CA   C  -8.166   6.567  -6.350 1.00 . A A .  23 ARG CA   1 1 
        1   355 1 1  23 ARG CB   C  -7.277   7.572  -7.084 1.00 . A A .  23 ARG CB   1 1 
        1   356 1 1  23 ARG CD   C  -6.023   9.750  -6.979 1.00 . A A .  23 ARG CD   1 1 
        1   357 1 1  23 ARG CG   C  -6.892   8.760  -6.227 1.00 . A A .  23 ARG CG   1 1 
        1   358 1 1  23 ARG CZ   C  -3.576  10.026  -6.925 1.00 . A A .  23 ARG CZ   1 1 
        1   359 1 1  23 ARG H    H  -8.501   5.582  -8.189 1.00 . A A .  23 ARG H    1 1 
        1   360 1 1  23 ARG HA   H  -7.626   6.174  -5.499 1.00 . A A .  23 ARG HA   1 1 
        1   361 1 1  23 ARG HB2  H  -6.374   7.072  -7.401 1.00 . A A .  23 ARG HB2  1 1 
        1   362 1 1  23 ARG HB3  H  -7.804   7.935  -7.954 1.00 . A A .  23 ARG HB3  1 1 
        1   363 1 1  23 ARG HD2  H  -6.462   9.928  -7.949 1.00 . A A .  23 ARG HD2  1 1 
        1   364 1 1  23 ARG HD3  H  -6.000  10.675  -6.424 1.00 . A A .  23 ARG HD3  1 1 
        1   365 1 1  23 ARG HE   H  -4.527   8.360  -7.517 1.00 . A A .  23 ARG HE   1 1 
        1   366 1 1  23 ARG HG2  H  -7.792   9.262  -5.907 1.00 . A A .  23 ARG HG2  1 1 
        1   367 1 1  23 ARG HG3  H  -6.351   8.404  -5.363 1.00 . A A .  23 ARG HG3  1 1 
        1   368 1 1  23 ARG HH11 H  -4.607  11.509  -5.986 1.00 . A A .  23 ARG HH11 1 1 
        1   369 1 1  23 ARG HH12 H  -2.892  11.760  -6.131 1.00 . A A .  23 ARG HH12 1 1 
        1   370 1 1  23 ARG HH21 H  -2.261   8.669  -7.667 1.00 . A A .  23 ARG HH21 1 1 
        1   371 1 1  23 ARG HH22 H  -1.558  10.153  -7.081 1.00 . A A .  23 ARG HH22 1 1 
        1   372 1 1  23 ARG N    N  -8.502   5.456  -7.213 1.00 . A A .  23 ARG N    1 1 
        1   373 1 1  23 ARG NE   N  -4.652   9.276  -7.163 1.00 . A A .  23 ARG NE   1 1 
        1   374 1 1  23 ARG NH1  N  -3.699  11.192  -6.298 1.00 . A A .  23 ARG NH1  1 1 
        1   375 1 1  23 ARG NH2  N  -2.370   9.580  -7.246 1.00 . A A .  23 ARG NH2  1 1 
        1   376 1 1  23 ARG O    O -10.078   8.008  -6.571 1.00 . A A .  23 ARG O    1 1 
        1   377 1 1  24 THR C    C -10.845   8.019  -2.719 1.00 . A A .  24 THR C    1 1 
        1   378 1 1  24 THR CA   C -11.077   7.380  -4.088 1.00 . A A .  24 THR CA   1 1 
        1   379 1 1  24 THR CB   C -12.117   6.235  -3.991 1.00 . A A .  24 THR CB   1 1 
        1   380 1 1  24 THR CG2  C -11.641   5.121  -3.068 1.00 . A A .  24 THR CG2  1 1 
        1   381 1 1  24 THR H    H  -9.253   6.319  -4.091 1.00 . A A .  24 THR H    1 1 
        1   382 1 1  24 THR HA   H -11.465   8.126  -4.761 1.00 . A A .  24 THR HA   1 1 
        1   383 1 1  24 THR HB   H -12.254   5.821  -4.979 1.00 . A A .  24 THR HB   1 1 
        1   384 1 1  24 THR HG1  H -14.066   6.498  -4.165 1.00 . A A .  24 THR HG1  1 1 
        1   385 1 1  24 THR HG21 H -11.439   5.527  -2.087 1.00 . A A .  24 THR HG21 1 1 
        1   386 1 1  24 THR HG22 H -10.740   4.683  -3.468 1.00 . A A .  24 THR HG22 1 1 
        1   387 1 1  24 THR HG23 H -12.407   4.363  -2.995 1.00 . A A .  24 THR HG23 1 1 
        1   388 1 1  24 THR N    N  -9.831   6.900  -4.639 1.00 . A A .  24 THR N    1 1 
        1   389 1 1  24 THR O    O -10.083   7.502  -1.902 1.00 . A A .  24 THR O    1 1 
        1   390 1 1  24 THR OG1  O -13.374   6.737  -3.532 1.00 . A A .  24 THR OG1  1 1 
        1   391 1 1  25 GLN C    C -12.394   9.368  -0.239 1.00 . A A .  25 GLN C    1 1 
        1   392 1 1  25 GLN CA   C -11.319   9.845  -1.207 1.00 . A A .  25 GLN CA   1 1 
        1   393 1 1  25 GLN CB   C -11.353  11.377  -1.375 1.00 . A A .  25 GLN CB   1 1 
        1   394 1 1  25 GLN CD   C -13.162  11.555  -3.165 1.00 . A A .  25 GLN CD   1 1 
        1   395 1 1  25 GLN CG   C -12.703  11.966  -1.779 1.00 . A A .  25 GLN CG   1 1 
        1   396 1 1  25 GLN H    H -12.030   9.560  -3.179 1.00 . A A .  25 GLN H    1 1 
        1   397 1 1  25 GLN HA   H -10.357   9.564  -0.801 1.00 . A A .  25 GLN HA   1 1 
        1   398 1 1  25 GLN HB2  H -11.063  11.830  -0.440 1.00 . A A .  25 GLN HB2  1 1 
        1   399 1 1  25 GLN HB3  H -10.630  11.654  -2.130 1.00 . A A .  25 GLN HB3  1 1 
        1   400 1 1  25 GLN HE21 H -15.051  11.721  -2.594 1.00 . A A .  25 GLN HE21 1 1 
        1   401 1 1  25 GLN HE22 H -14.801  11.238  -4.236 1.00 . A A .  25 GLN HE22 1 1 
        1   402 1 1  25 GLN HG2  H -13.445  11.639  -1.067 1.00 . A A .  25 GLN HG2  1 1 
        1   403 1 1  25 GLN HG3  H -12.631  13.043  -1.746 1.00 . A A .  25 GLN HG3  1 1 
        1   404 1 1  25 GLN N    N -11.463   9.165  -2.484 1.00 . A A .  25 GLN N    1 1 
        1   405 1 1  25 GLN NE2  N -14.466  11.498  -3.350 1.00 . A A .  25 GLN NE2  1 1 
        1   406 1 1  25 GLN O    O -13.577   9.316  -0.582 1.00 . A A .  25 GLN O    1 1 
        1   407 1 1  25 GLN OE1  O -12.353  11.298  -4.060 1.00 . A A .  25 GLN OE1  1 1 
        1   408 1 1  26 THR C    C -12.452   8.826   3.363 1.00 . A A .  26 THR C    1 1 
        1   409 1 1  26 THR CA   C -12.861   8.414   1.950 1.00 . A A .  26 THR CA   1 1 
        1   410 1 1  26 THR CB   C -12.875   6.875   1.846 1.00 . A A .  26 THR CB   1 1 
        1   411 1 1  26 THR CG2  C -13.774   6.406   0.709 1.00 . A A .  26 THR CG2  1 1 
        1   412 1 1  26 THR H    H -11.018   9.109   1.188 1.00 . A A .  26 THR H    1 1 
        1   413 1 1  26 THR HA   H -13.859   8.778   1.754 1.00 . A A .  26 THR HA   1 1 
        1   414 1 1  26 THR HB   H -13.255   6.475   2.774 1.00 . A A .  26 THR HB   1 1 
        1   415 1 1  26 THR HG1  H -11.237   6.655   0.771 1.00 . A A .  26 THR HG1  1 1 
        1   416 1 1  26 THR HG21 H -13.417   6.815  -0.224 1.00 . A A .  26 THR HG21 1 1 
        1   417 1 1  26 THR HG22 H -14.785   6.745   0.887 1.00 . A A .  26 THR HG22 1 1 
        1   418 1 1  26 THR HG23 H -13.759   5.328   0.659 1.00 . A A .  26 THR HG23 1 1 
        1   419 1 1  26 THR N    N -11.967   8.989   0.957 1.00 . A A .  26 THR N    1 1 
        1   420 1 1  26 THR O    O -11.430   9.496   3.556 1.00 . A A .  26 THR O    1 1 
        1   421 1 1  26 THR OG1  O -11.542   6.389   1.642 1.00 . A A .  26 THR OG1  1 1 
        1   422 1 1  27 ALA C    C -12.454   7.558   6.498 1.00 . A A .  27 ALA C    1 1 
        1   423 1 1  27 ALA CA   C -12.989   8.766   5.735 1.00 . A A .  27 ALA CA   1 1 
        1   424 1 1  27 ALA CB   C -14.255   9.290   6.392 1.00 . A A .  27 ALA CB   1 1 
        1   425 1 1  27 ALA H    H -14.042   7.883   4.125 1.00 . A A .  27 ALA H    1 1 
        1   426 1 1  27 ALA HA   H -12.248   9.551   5.756 1.00 . A A .  27 ALA HA   1 1 
        1   427 1 1  27 ALA HB1  H -15.009   8.517   6.389 1.00 . A A .  27 ALA HB1  1 1 
        1   428 1 1  27 ALA HB2  H -14.617  10.149   5.844 1.00 . A A .  27 ALA HB2  1 1 
        1   429 1 1  27 ALA HB3  H -14.038   9.578   7.410 1.00 . A A .  27 ALA HB3  1 1 
        1   430 1 1  27 ALA N    N -13.252   8.428   4.344 1.00 . A A .  27 ALA N    1 1 
        1   431 1 1  27 ALA O    O -12.482   6.433   5.997 1.00 . A A .  27 ALA O    1 1 
        1   432 1 1  28 MET C    C -12.541   5.767   8.994 1.00 . A A .  28 MET C    1 1 
        1   433 1 1  28 MET CA   C -11.433   6.715   8.544 1.00 . A A .  28 MET CA   1 1 
        1   434 1 1  28 MET CB   C -10.676   7.274   9.754 1.00 . A A .  28 MET CB   1 1 
        1   435 1 1  28 MET CE   C  -9.421   9.891  11.302 1.00 . A A .  28 MET CE   1 1 
        1   436 1 1  28 MET CG   C  -9.330   7.885   9.390 1.00 . A A .  28 MET CG   1 1 
        1   437 1 1  28 MET H    H -11.987   8.712   8.073 1.00 . A A .  28 MET H    1 1 
        1   438 1 1  28 MET HA   H -10.739   6.158   7.931 1.00 . A A .  28 MET HA   1 1 
        1   439 1 1  28 MET HB2  H -11.280   8.037  10.224 1.00 . A A .  28 MET HB2  1 1 
        1   440 1 1  28 MET HB3  H -10.504   6.475  10.460 1.00 . A A .  28 MET HB3  1 1 
        1   441 1 1  28 MET HE1  H  -8.972  10.378  12.154 1.00 . A A .  28 MET HE1  1 1 
        1   442 1 1  28 MET HE2  H -10.411   9.549  11.564 1.00 . A A .  28 MET HE2  1 1 
        1   443 1 1  28 MET HE3  H  -9.486  10.590  10.480 1.00 . A A .  28 MET HE3  1 1 
        1   444 1 1  28 MET HG2  H  -8.732   7.133   8.896 1.00 . A A .  28 MET HG2  1 1 
        1   445 1 1  28 MET HG3  H  -9.498   8.709   8.711 1.00 . A A .  28 MET HG3  1 1 
        1   446 1 1  28 MET N    N -11.975   7.792   7.718 1.00 . A A .  28 MET N    1 1 
        1   447 1 1  28 MET O    O -12.327   4.561   9.120 1.00 . A A .  28 MET O    1 1 
        1   448 1 1  28 MET SD   S  -8.414   8.493  10.819 1.00 . A A .  28 MET SD   1 1 
        1   449 1 1  29 SER C    C -15.598   5.085   8.241 1.00 . A A .  29 SER C    1 1 
        1   450 1 1  29 SER CA   C -14.893   5.496   9.533 1.00 . A A .  29 SER CA   1 1 
        1   451 1 1  29 SER CB   C -15.844   6.268  10.443 1.00 . A A .  29 SER CB   1 1 
        1   452 1 1  29 SER H    H -13.824   7.285   9.175 1.00 . A A .  29 SER H    1 1 
        1   453 1 1  29 SER HA   H -14.553   4.608  10.044 1.00 . A A .  29 SER HA   1 1 
        1   454 1 1  29 SER HB2  H -16.225   7.130   9.915 1.00 . A A .  29 SER HB2  1 1 
        1   455 1 1  29 SER HB3  H -16.666   5.628  10.730 1.00 . A A .  29 SER HB3  1 1 
        1   456 1 1  29 SER HG   H -14.832   7.604  11.466 1.00 . A A .  29 SER HG   1 1 
        1   457 1 1  29 SER N    N -13.727   6.312   9.220 1.00 . A A .  29 SER N    1 1 
        1   458 1 1  29 SER O    O -16.779   5.376   8.036 1.00 . A A .  29 SER O    1 1 
        1   459 1 1  29 SER OG   O -15.175   6.710  11.614 1.00 . A A .  29 SER OG   1 1 
        1   460 1 1  30 GLU C    C -14.242   3.205   5.351 1.00 . A A .  30 GLU C    1 1 
        1   461 1 1  30 GLU CA   C -15.319   4.023   6.055 1.00 . A A .  30 GLU CA   1 1 
        1   462 1 1  30 GLU CB   C -15.654   5.277   5.237 1.00 . A A .  30 GLU CB   1 1 
        1   463 1 1  30 GLU CD   C -16.464   6.256   3.061 1.00 . A A .  30 GLU CD   1 1 
        1   464 1 1  30 GLU CG   C -16.036   5.001   3.793 1.00 . A A .  30 GLU CG   1 1 
        1   465 1 1  30 GLU H    H -13.948   4.136   7.656 1.00 . A A .  30 GLU H    1 1 
        1   466 1 1  30 GLU HA   H -16.208   3.419   6.169 1.00 . A A .  30 GLU HA   1 1 
        1   467 1 1  30 GLU HB2  H -16.477   5.790   5.711 1.00 . A A .  30 GLU HB2  1 1 
        1   468 1 1  30 GLU HB3  H -14.791   5.928   5.238 1.00 . A A .  30 GLU HB3  1 1 
        1   469 1 1  30 GLU HG2  H -15.183   4.578   3.282 1.00 . A A .  30 GLU HG2  1 1 
        1   470 1 1  30 GLU HG3  H -16.852   4.294   3.776 1.00 . A A .  30 GLU HG3  1 1 
        1   471 1 1  30 GLU N    N -14.850   4.405   7.381 1.00 . A A .  30 GLU N    1 1 
        1   472 1 1  30 GLU O    O -14.535   2.253   4.625 1.00 . A A .  30 GLU O    1 1 
        1   473 1 1  30 GLU OE1  O -15.866   7.329   3.300 1.00 . A A .  30 GLU OE1  1 1 
        1   474 1 1  30 GLU OE2  O -17.404   6.176   2.243 1.00 . A A .  30 GLU OE2  1 1 
        1   475 1 1  31 LEU C    C -11.847   1.415   5.237 1.00 . A A .  31 LEU C    1 1 
        1   476 1 1  31 LEU CA   C -11.822   2.933   5.026 1.00 . A A .  31 LEU CA   1 1 
        1   477 1 1  31 LEU CB   C -10.559   3.554   5.645 1.00 . A A .  31 LEU CB   1 1 
        1   478 1 1  31 LEU CD1  C  -8.118   3.879   5.183 1.00 . A A .  31 LEU CD1  1 1 
        1   479 1 1  31 LEU CD2  C  -8.876   1.876   6.450 1.00 . A A .  31 LEU CD2  1 1 
        1   480 1 1  31 LEU CG   C  -9.232   2.855   5.338 1.00 . A A .  31 LEU CG   1 1 
        1   481 1 1  31 LEU H    H -12.853   4.377   6.167 1.00 . A A .  31 LEU H    1 1 
        1   482 1 1  31 LEU HA   H -11.818   3.132   3.966 1.00 . A A .  31 LEU HA   1 1 
        1   483 1 1  31 LEU HB2  H -10.486   4.575   5.300 1.00 . A A .  31 LEU HB2  1 1 
        1   484 1 1  31 LEU HB3  H -10.688   3.569   6.717 1.00 . A A .  31 LEU HB3  1 1 
        1   485 1 1  31 LEU HD11 H  -7.184   3.368   5.006 1.00 . A A .  31 LEU HD11 1 1 
        1   486 1 1  31 LEU HD12 H  -8.042   4.468   6.085 1.00 . A A .  31 LEU HD12 1 1 
        1   487 1 1  31 LEU HD13 H  -8.338   4.526   4.346 1.00 . A A .  31 LEU HD13 1 1 
        1   488 1 1  31 LEU HD21 H  -9.638   1.115   6.516 1.00 . A A .  31 LEU HD21 1 1 
        1   489 1 1  31 LEU HD22 H  -8.814   2.406   7.389 1.00 . A A .  31 LEU HD22 1 1 
        1   490 1 1  31 LEU HD23 H  -7.924   1.416   6.233 1.00 . A A .  31 LEU HD23 1 1 
        1   491 1 1  31 LEU HG   H  -9.320   2.303   4.413 1.00 . A A .  31 LEU HG   1 1 
        1   492 1 1  31 LEU N    N -12.994   3.592   5.596 1.00 . A A .  31 LEU N    1 1 
        1   493 1 1  31 LEU O    O -11.481   0.653   4.339 1.00 . A A .  31 LEU O    1 1 
        1   494 1 1  32 GLY C    C -13.229  -1.225   5.836 1.00 . A A .  32 GLY C    1 1 
        1   495 1 1  32 GLY CA   C -12.296  -0.435   6.731 1.00 . A A .  32 GLY CA   1 1 
        1   496 1 1  32 GLY H    H -12.636   1.626   7.063 1.00 . A A .  32 GLY H    1 1 
        1   497 1 1  32 GLY HA2  H -11.294  -0.821   6.619 1.00 . A A .  32 GLY HA2  1 1 
        1   498 1 1  32 GLY HA3  H -12.606  -0.562   7.759 1.00 . A A .  32 GLY HA3  1 1 
        1   499 1 1  32 GLY N    N -12.292   0.981   6.412 1.00 . A A .  32 GLY N    1 1 
        1   500 1 1  32 GLY O    O -12.817  -2.199   5.204 1.00 . A A .  32 GLY O    1 1 
        1   501 1 1  33 SER C    C -15.139  -1.327   3.466 1.00 . A A .  33 SER C    1 1 
        1   502 1 1  33 SER CA   C -15.483  -1.461   4.949 1.00 . A A .  33 SER CA   1 1 
        1   503 1 1  33 SER CB   C -16.865  -0.870   5.235 1.00 . A A .  33 SER CB   1 1 
        1   504 1 1  33 SER H    H -14.744  -0.005   6.299 1.00 . A A .  33 SER H    1 1 
        1   505 1 1  33 SER HA   H -15.485  -2.508   5.213 1.00 . A A .  33 SER HA   1 1 
        1   506 1 1  33 SER HB2  H -16.880   0.169   4.937 1.00 . A A .  33 SER HB2  1 1 
        1   507 1 1  33 SER HB3  H -17.611  -1.417   4.677 1.00 . A A .  33 SER HB3  1 1 
        1   508 1 1  33 SER HG   H -16.541  -1.542   7.052 1.00 . A A .  33 SER HG   1 1 
        1   509 1 1  33 SER N    N -14.482  -0.794   5.772 1.00 . A A .  33 SER N    1 1 
        1   510 1 1  33 SER O    O -15.446  -2.207   2.659 1.00 . A A .  33 SER O    1 1 
        1   511 1 1  33 SER OG   O -17.176  -0.956   6.617 1.00 . A A .  33 SER OG   1 1 
        1   512 1 1  34 LEU C    C -13.090  -1.010   1.263 1.00 . A A .  34 LEU C    1 1 
        1   513 1 1  34 LEU CA   C -14.092   0.036   1.743 1.00 . A A .  34 LEU CA   1 1 
        1   514 1 1  34 LEU CB   C -13.485   1.434   1.621 1.00 . A A .  34 LEU CB   1 1 
        1   515 1 1  34 LEU CD1  C -14.388   2.019  -0.646 1.00 . A A .  34 LEU CD1  1 1 
        1   516 1 1  34 LEU CD2  C -12.335   3.160   0.218 1.00 . A A .  34 LEU CD2  1 1 
        1   517 1 1  34 LEU CG   C -13.130   1.865   0.197 1.00 . A A .  34 LEU CG   1 1 
        1   518 1 1  34 LEU H    H -14.273   0.445   3.810 1.00 . A A .  34 LEU H    1 1 
        1   519 1 1  34 LEU HA   H -14.977  -0.019   1.126 1.00 . A A .  34 LEU HA   1 1 
        1   520 1 1  34 LEU HB2  H -14.192   2.146   2.024 1.00 . A A .  34 LEU HB2  1 1 
        1   521 1 1  34 LEU HB3  H -12.587   1.467   2.219 1.00 . A A .  34 LEU HB3  1 1 
        1   522 1 1  34 LEU HD11 H -14.119   2.355  -1.638 1.00 . A A .  34 LEU HD11 1 1 
        1   523 1 1  34 LEU HD12 H -15.043   2.745  -0.186 1.00 . A A .  34 LEU HD12 1 1 
        1   524 1 1  34 LEU HD13 H -14.896   1.067  -0.713 1.00 . A A .  34 LEU HD13 1 1 
        1   525 1 1  34 LEU HD21 H -11.435   3.020   0.798 1.00 . A A .  34 LEU HD21 1 1 
        1   526 1 1  34 LEU HD22 H -12.933   3.941   0.664 1.00 . A A .  34 LEU HD22 1 1 
        1   527 1 1  34 LEU HD23 H -12.074   3.438  -0.792 1.00 . A A .  34 LEU HD23 1 1 
        1   528 1 1  34 LEU HG   H -12.515   1.103  -0.258 1.00 . A A .  34 LEU HG   1 1 
        1   529 1 1  34 LEU N    N -14.488  -0.222   3.119 1.00 . A A .  34 LEU N    1 1 
        1   530 1 1  34 LEU O    O -13.271  -1.609   0.204 1.00 . A A .  34 LEU O    1 1 
        1   531 1 1  35 PHE C    C -11.561  -3.602   1.546 1.00 . A A .  35 PHE C    1 1 
        1   532 1 1  35 PHE CA   C -11.002  -2.192   1.691 1.00 . A A .  35 PHE CA   1 1 
        1   533 1 1  35 PHE CB   C  -9.861  -2.184   2.713 1.00 . A A .  35 PHE CB   1 1 
        1   534 1 1  35 PHE CD1  C  -8.835  -0.302   1.399 1.00 . A A .  35 PHE CD1  1 1 
        1   535 1 1  35 PHE CD2  C  -8.218  -0.557   3.687 1.00 . A A .  35 PHE CD2  1 1 
        1   536 1 1  35 PHE CE1  C  -7.997   0.791   1.289 1.00 . A A .  35 PHE CE1  1 1 
        1   537 1 1  35 PHE CE2  C  -7.376   0.534   3.582 1.00 . A A .  35 PHE CE2  1 1 
        1   538 1 1  35 PHE CG   C  -8.952  -0.991   2.598 1.00 . A A .  35 PHE CG   1 1 
        1   539 1 1  35 PHE CZ   C  -7.269   1.211   2.384 1.00 . A A .  35 PHE CZ   1 1 
        1   540 1 1  35 PHE H    H -11.969  -0.748   2.907 1.00 . A A .  35 PHE H    1 1 
        1   541 1 1  35 PHE HA   H -10.605  -1.887   0.734 1.00 . A A .  35 PHE HA   1 1 
        1   542 1 1  35 PHE HB2  H -10.281  -2.186   3.708 1.00 . A A .  35 PHE HB2  1 1 
        1   543 1 1  35 PHE HB3  H  -9.261  -3.073   2.579 1.00 . A A .  35 PHE HB3  1 1 
        1   544 1 1  35 PHE HD1  H  -9.407  -0.629   0.543 1.00 . A A .  35 PHE HD1  1 1 
        1   545 1 1  35 PHE HD2  H  -8.301  -1.084   4.627 1.00 . A A .  35 PHE HD2  1 1 
        1   546 1 1  35 PHE HE1  H  -7.916   1.318   0.350 1.00 . A A .  35 PHE HE1  1 1 
        1   547 1 1  35 PHE HE2  H  -6.809   0.862   4.440 1.00 . A A .  35 PHE HE2  1 1 
        1   548 1 1  35 PHE HZ   H  -6.612   2.064   2.302 1.00 . A A .  35 PHE HZ   1 1 
        1   549 1 1  35 PHE N    N -12.044  -1.237   2.056 1.00 . A A .  35 PHE N    1 1 
        1   550 1 1  35 PHE O    O -11.237  -4.301   0.586 1.00 . A A .  35 PHE O    1 1 
        1   551 1 1  36 GLU C    C -13.670  -5.637   1.129 1.00 . A A .  36 GLU C    1 1 
        1   552 1 1  36 GLU CA   C -13.010  -5.339   2.473 1.00 . A A .  36 GLU CA   1 1 
        1   553 1 1  36 GLU CB   C -14.047  -5.472   3.590 1.00 . A A .  36 GLU CB   1 1 
        1   554 1 1  36 GLU CD   C -12.470  -6.558   5.231 1.00 . A A .  36 GLU CD   1 1 
        1   555 1 1  36 GLU CG   C -13.453  -5.434   4.987 1.00 . A A .  36 GLU CG   1 1 
        1   556 1 1  36 GLU H    H -12.626  -3.391   3.226 1.00 . A A .  36 GLU H    1 1 
        1   557 1 1  36 GLU HA   H -12.224  -6.059   2.641 1.00 . A A .  36 GLU HA   1 1 
        1   558 1 1  36 GLU HB2  H -14.759  -4.663   3.502 1.00 . A A .  36 GLU HB2  1 1 
        1   559 1 1  36 GLU HB3  H -14.569  -6.410   3.470 1.00 . A A .  36 GLU HB3  1 1 
        1   560 1 1  36 GLU HG2  H -12.939  -4.494   5.121 1.00 . A A .  36 GLU HG2  1 1 
        1   561 1 1  36 GLU HG3  H -14.254  -5.512   5.708 1.00 . A A .  36 GLU HG3  1 1 
        1   562 1 1  36 GLU N    N -12.407  -4.006   2.491 1.00 . A A .  36 GLU N    1 1 
        1   563 1 1  36 GLU O    O -13.352  -6.634   0.474 1.00 . A A .  36 GLU O    1 1 
        1   564 1 1  36 GLU OE1  O -12.821  -7.727   4.972 1.00 . A A .  36 GLU OE1  1 1 
        1   565 1 1  36 GLU OE2  O -11.350  -6.282   5.702 1.00 . A A .  36 GLU OE2  1 1 
        1   566 1 1  37 ALA C    C -14.414  -4.703  -1.742 1.00 . A A .  37 ALA C    1 1 
        1   567 1 1  37 ALA CA   C -15.306  -4.948  -0.529 1.00 . A A .  37 ALA CA   1 1 
        1   568 1 1  37 ALA CB   C -16.518  -4.031  -0.567 1.00 . A A .  37 ALA CB   1 1 
        1   569 1 1  37 ALA H    H -14.760  -3.969   1.267 1.00 . A A .  37 ALA H    1 1 
        1   570 1 1  37 ALA HA   H -15.659  -5.969  -0.556 1.00 . A A .  37 ALA HA   1 1 
        1   571 1 1  37 ALA HB1  H -17.081  -4.216  -1.469 1.00 . A A .  37 ALA HB1  1 1 
        1   572 1 1  37 ALA HB2  H -16.191  -3.002  -0.551 1.00 . A A .  37 ALA HB2  1 1 
        1   573 1 1  37 ALA HB3  H -17.143  -4.224   0.293 1.00 . A A .  37 ALA HB3  1 1 
        1   574 1 1  37 ALA N    N -14.575  -4.762   0.716 1.00 . A A .  37 ALA N    1 1 
        1   575 1 1  37 ALA O    O -14.621  -5.292  -2.803 1.00 . A A .  37 ALA O    1 1 
        1   576 1 1  38 GLY C    C -11.609  -4.638  -3.052 1.00 . A A .  38 GLY C    1 1 
        1   577 1 1  38 GLY CA   C -12.535  -3.501  -2.674 1.00 . A A .  38 GLY CA   1 1 
        1   578 1 1  38 GLY H    H -13.293  -3.415  -0.699 1.00 . A A .  38 GLY H    1 1 
        1   579 1 1  38 GLY HA2  H -13.132  -3.239  -3.535 1.00 . A A .  38 GLY HA2  1 1 
        1   580 1 1  38 GLY HA3  H -11.940  -2.644  -2.390 1.00 . A A .  38 GLY HA3  1 1 
        1   581 1 1  38 GLY N    N -13.422  -3.838  -1.577 1.00 . A A .  38 GLY N    1 1 
        1   582 1 1  38 GLY O    O -11.317  -4.837  -4.229 1.00 . A A .  38 GLY O    1 1 
        1   583 1 1  39 TYR C    C -11.066  -7.700  -2.850 1.00 . A A .  39 TYR C    1 1 
        1   584 1 1  39 TYR CA   C -10.262  -6.521  -2.314 1.00 . A A .  39 TYR CA   1 1 
        1   585 1 1  39 TYR CB   C  -9.515  -6.945  -1.044 1.00 . A A .  39 TYR CB   1 1 
        1   586 1 1  39 TYR CD1  C  -7.719  -5.202  -1.377 1.00 . A A .  39 TYR CD1  1 1 
        1   587 1 1  39 TYR CD2  C  -8.477  -5.625   0.842 1.00 . A A .  39 TYR CD2  1 1 
        1   588 1 1  39 TYR CE1  C  -6.838  -4.252  -0.901 1.00 . A A .  39 TYR CE1  1 1 
        1   589 1 1  39 TYR CE2  C  -7.598  -4.676   1.326 1.00 . A A .  39 TYR CE2  1 1 
        1   590 1 1  39 TYR CG   C  -8.552  -5.904  -0.517 1.00 . A A .  39 TYR CG   1 1 
        1   591 1 1  39 TYR CZ   C  -6.781  -3.992   0.452 1.00 . A A .  39 TYR CZ   1 1 
        1   592 1 1  39 TYR H    H -11.365  -5.146  -1.128 1.00 . A A .  39 TYR H    1 1 
        1   593 1 1  39 TYR HA   H  -9.541  -6.225  -3.063 1.00 . A A .  39 TYR HA   1 1 
        1   594 1 1  39 TYR HB2  H -10.234  -7.154  -0.265 1.00 . A A .  39 TYR HB2  1 1 
        1   595 1 1  39 TYR HB3  H  -8.950  -7.843  -1.254 1.00 . A A .  39 TYR HB3  1 1 
        1   596 1 1  39 TYR HD1  H  -7.767  -5.408  -2.436 1.00 . A A .  39 TYR HD1  1 1 
        1   597 1 1  39 TYR HD2  H  -9.116  -6.162   1.526 1.00 . A A .  39 TYR HD2  1 1 
        1   598 1 1  39 TYR HE1  H  -6.198  -3.716  -1.587 1.00 . A A .  39 TYR HE1  1 1 
        1   599 1 1  39 TYR HE2  H  -7.554  -4.473   2.386 1.00 . A A .  39 TYR HE2  1 1 
        1   600 1 1  39 TYR HH   H  -5.892  -2.289   0.342 1.00 . A A .  39 TYR HH   1 1 
        1   601 1 1  39 TYR N    N -11.133  -5.379  -2.056 1.00 . A A .  39 TYR N    1 1 
        1   602 1 1  39 TYR O    O -10.563  -8.504  -3.635 1.00 . A A .  39 TYR O    1 1 
        1   603 1 1  39 TYR OH   O  -5.904  -3.049   0.932 1.00 . A A .  39 TYR OH   1 1 
        1   604 1 1  40 HIS C    C -13.637  -8.722  -4.269 1.00 . A A .  40 HIS C    1 1 
        1   605 1 1  40 HIS CA   C -13.183  -8.895  -2.820 1.00 . A A .  40 HIS CA   1 1 
        1   606 1 1  40 HIS CB   C -14.398  -8.993  -1.894 1.00 . A A .  40 HIS CB   1 1 
        1   607 1 1  40 HIS CD2  C -15.095 -11.491  -1.854 1.00 . A A .  40 HIS CD2  1 1 
        1   608 1 1  40 HIS CE1  C -16.972 -11.315  -2.962 1.00 . A A .  40 HIS CE1  1 1 
        1   609 1 1  40 HIS CG   C -15.260 -10.186  -2.172 1.00 . A A .  40 HIS CG   1 1 
        1   610 1 1  40 HIS H    H -12.653  -7.130  -1.781 1.00 . A A .  40 HIS H    1 1 
        1   611 1 1  40 HIS HA   H -12.617  -9.812  -2.745 1.00 . A A .  40 HIS HA   1 1 
        1   612 1 1  40 HIS HB2  H -14.060  -9.058  -0.870 1.00 . A A .  40 HIS HB2  1 1 
        1   613 1 1  40 HIS HB3  H -15.006  -8.108  -2.013 1.00 . A A .  40 HIS HB3  1 1 
        1   614 1 1  40 HIS HD1  H -16.841  -9.285  -3.246 1.00 . A A .  40 HIS HD1  1 1 
        1   615 1 1  40 HIS HD2  H -14.264 -11.917  -1.307 1.00 . A A .  40 HIS HD2  1 1 
        1   616 1 1  40 HIS HE1  H -17.901 -11.559  -3.457 1.00 . A A .  40 HIS HE1  1 1 
        1   617 1 1  40 HIS HE2  H -16.215 -13.155  -2.479 1.00 . A A .  40 HIS HE2  1 1 
        1   618 1 1  40 HIS N    N -12.312  -7.804  -2.405 1.00 . A A .  40 HIS N    1 1 
        1   619 1 1  40 HIS ND1  N -16.444 -10.111  -2.864 1.00 . A A .  40 HIS ND1  1 1 
        1   620 1 1  40 HIS NE2  N -16.172 -12.173  -2.360 1.00 . A A .  40 HIS NE2  1 1 
        1   621 1 1  40 HIS O    O -13.530  -9.644  -5.074 1.00 . A A .  40 HIS O    1 1 
        1   622 1 1  41 ASP C    C -13.836  -6.194  -6.597 1.00 . A A .  41 ASP C    1 1 
        1   623 1 1  41 ASP CA   C -14.675  -7.271  -5.924 1.00 . A A .  41 ASP CA   1 1 
        1   624 1 1  41 ASP CB   C -16.139  -6.813  -5.852 1.00 . A A .  41 ASP CB   1 1 
        1   625 1 1  41 ASP CG   C -17.048  -7.821  -5.171 1.00 . A A .  41 ASP CG   1 1 
        1   626 1 1  41 ASP H    H -14.178  -6.828  -3.913 1.00 . A A .  41 ASP H    1 1 
        1   627 1 1  41 ASP HA   H -14.614  -8.181  -6.502 1.00 . A A .  41 ASP HA   1 1 
        1   628 1 1  41 ASP HB2  H -16.189  -5.886  -5.301 1.00 . A A .  41 ASP HB2  1 1 
        1   629 1 1  41 ASP HB3  H -16.505  -6.647  -6.855 1.00 . A A .  41 ASP HB3  1 1 
        1   630 1 1  41 ASP N    N -14.154  -7.543  -4.589 1.00 . A A .  41 ASP N    1 1 
        1   631 1 1  41 ASP O    O -14.035  -4.999  -6.354 1.00 . A A .  41 ASP O    1 1 
        1   632 1 1  41 ASP OD1  O -17.120  -7.819  -3.923 1.00 . A A .  41 ASP OD1  1 1 
        1   633 1 1  41 ASP OD2  O -17.702  -8.618  -5.875 1.00 . A A .  41 ASP OD2  1 1 
        1   634 1 1  42 ILE C    C -11.889  -5.835  -9.575 1.00 . A A .  42 ILE C    1 1 
        1   635 1 1  42 ILE CA   C -11.972  -5.664  -8.050 1.00 . A A .  42 ILE CA   1 1 
        1   636 1 1  42 ILE CB   C -10.559  -5.751  -7.411 1.00 . A A .  42 ILE CB   1 1 
        1   637 1 1  42 ILE CD1  C  -9.967  -3.333  -7.959 1.00 . A A .  42 ILE CD1  1 1 
        1   638 1 1  42 ILE CG1  C  -9.588  -4.792  -8.108 1.00 . A A .  42 ILE CG1  1 1 
        1   639 1 1  42 ILE CG2  C -10.024  -7.178  -7.433 1.00 . A A .  42 ILE CG2  1 1 
        1   640 1 1  42 ILE H    H -12.818  -7.561  -7.645 1.00 . A A .  42 ILE H    1 1 
        1   641 1 1  42 ILE HA   H -12.357  -4.674  -7.849 1.00 . A A .  42 ILE HA   1 1 
        1   642 1 1  42 ILE HB   H -10.650  -5.455  -6.377 1.00 . A A .  42 ILE HB   1 1 
        1   643 1 1  42 ILE HD11 H -10.943  -3.169  -8.389 1.00 . A A .  42 ILE HD11 1 1 
        1   644 1 1  42 ILE HD12 H  -9.240  -2.717  -8.470 1.00 . A A .  42 ILE HD12 1 1 
        1   645 1 1  42 ILE HD13 H  -9.987  -3.070  -6.911 1.00 . A A .  42 ILE HD13 1 1 
        1   646 1 1  42 ILE HG12 H  -8.601  -4.922  -7.690 1.00 . A A .  42 ILE HG12 1 1 
        1   647 1 1  42 ILE HG13 H  -9.559  -5.023  -9.164 1.00 . A A .  42 ILE HG13 1 1 
        1   648 1 1  42 ILE HG21 H  -9.952  -7.519  -8.456 1.00 . A A .  42 ILE HG21 1 1 
        1   649 1 1  42 ILE HG22 H -10.696  -7.824  -6.885 1.00 . A A .  42 ILE HG22 1 1 
        1   650 1 1  42 ILE HG23 H  -9.046  -7.204  -6.976 1.00 . A A .  42 ILE HG23 1 1 
        1   651 1 1  42 ILE N    N -12.893  -6.607  -7.435 1.00 . A A .  42 ILE N    1 1 
        1   652 1 1  42 ILE O    O -11.199  -6.719 -10.085 1.00 . A A .  42 ILE O    1 1 
        1   653 1 1  43 LEU C    C -12.969  -6.104 -12.506 1.00 . A A .  43 LEU C    1 1 
        1   654 1 1  43 LEU CA   C -12.564  -4.846 -11.740 1.00 . A A .  43 LEU CA   1 1 
        1   655 1 1  43 LEU CB   C -11.170  -4.410 -12.204 1.00 . A A .  43 LEU CB   1 1 
        1   656 1 1  43 LEU CD1  C  -9.534  -2.596 -12.727 1.00 . A A .  43 LEU CD1  1 1 
        1   657 1 1  43 LEU CD2  C -11.982  -2.112 -12.792 1.00 . A A .  43 LEU CD2  1 1 
        1   658 1 1  43 LEU CG   C -10.884  -2.913 -12.108 1.00 . A A .  43 LEU CG   1 1 
        1   659 1 1  43 LEU H    H -13.241  -4.382  -9.785 1.00 . A A .  43 LEU H    1 1 
        1   660 1 1  43 LEU HA   H -13.257  -4.065 -12.010 1.00 . A A .  43 LEU HA   1 1 
        1   661 1 1  43 LEU HB2  H -10.438  -4.934 -11.608 1.00 . A A .  43 LEU HB2  1 1 
        1   662 1 1  43 LEU HB3  H -11.048  -4.709 -13.235 1.00 . A A .  43 LEU HB3  1 1 
        1   663 1 1  43 LEU HD11 H  -8.765  -3.165 -12.227 1.00 . A A .  43 LEU HD11 1 1 
        1   664 1 1  43 LEU HD12 H  -9.328  -1.541 -12.620 1.00 . A A .  43 LEU HD12 1 1 
        1   665 1 1  43 LEU HD13 H  -9.549  -2.855 -13.774 1.00 . A A .  43 LEU HD13 1 1 
        1   666 1 1  43 LEU HD21 H -12.926  -2.302 -12.303 1.00 . A A .  43 LEU HD21 1 1 
        1   667 1 1  43 LEU HD22 H -12.048  -2.406 -13.830 1.00 . A A .  43 LEU HD22 1 1 
        1   668 1 1  43 LEU HD23 H -11.751  -1.059 -12.731 1.00 . A A .  43 LEU HD23 1 1 
        1   669 1 1  43 LEU HG   H -10.852  -2.623 -11.068 1.00 . A A .  43 LEU HG   1 1 
        1   670 1 1  43 LEU N    N -12.624  -4.971 -10.277 1.00 . A A .  43 LEU N    1 1 
        1   671 1 1  43 LEU O    O -12.299  -7.141 -12.455 1.00 . A A .  43 LEU O    1 1 
        1   672 1 1  44 GLN C    C -13.354  -7.071 -15.352 1.00 . A A .  44 GLN C    1 1 
        1   673 1 1  44 GLN CA   C -14.413  -6.991 -14.255 1.00 . A A .  44 GLN CA   1 1 
        1   674 1 1  44 GLN CB   C -15.774  -6.670 -14.877 1.00 . A A .  44 GLN CB   1 1 
        1   675 1 1  44 GLN CD   C -18.251  -6.364 -14.534 1.00 . A A .  44 GLN CD   1 1 
        1   676 1 1  44 GLN CG   C -16.938  -6.797 -13.912 1.00 . A A .  44 GLN CG   1 1 
        1   677 1 1  44 GLN H    H -14.604  -5.168 -13.189 1.00 . A A .  44 GLN H    1 1 
        1   678 1 1  44 GLN HA   H -14.468  -7.941 -13.744 1.00 . A A .  44 GLN HA   1 1 
        1   679 1 1  44 GLN HB2  H -15.755  -5.656 -15.248 1.00 . A A .  44 GLN HB2  1 1 
        1   680 1 1  44 GLN HB3  H -15.946  -7.342 -15.704 1.00 . A A .  44 GLN HB3  1 1 
        1   681 1 1  44 GLN HE21 H -18.951  -5.841 -12.752 1.00 . A A .  44 GLN HE21 1 1 
        1   682 1 1  44 GLN HE22 H -20.029  -5.600 -14.091 1.00 . A A .  44 GLN HE22 1 1 
        1   683 1 1  44 GLN HG2  H -17.024  -7.829 -13.604 1.00 . A A .  44 GLN HG2  1 1 
        1   684 1 1  44 GLN HG3  H -16.743  -6.178 -13.048 1.00 . A A .  44 GLN HG3  1 1 
        1   685 1 1  44 GLN N    N -14.040  -5.971 -13.282 1.00 . A A .  44 GLN N    1 1 
        1   686 1 1  44 GLN NE2  N -19.167  -5.887 -13.712 1.00 . A A .  44 GLN NE2  1 1 
        1   687 1 1  44 GLN O    O -13.334  -8.004 -16.147 1.00 . A A .  44 GLN O    1 1 
        1   688 1 1  44 GLN OE1  O -18.440  -6.463 -15.747 1.00 . A A .  44 GLN OE1  1 1 
        1   689 1 1  45 LEU C    C -10.326  -7.075 -15.908 1.00 . A A .  45 LEU C    1 1 
        1   690 1 1  45 LEU CA   C -11.367  -6.043 -16.321 1.00 . A A .  45 LEU CA   1 1 
        1   691 1 1  45 LEU CB   C -10.710  -4.655 -16.365 1.00 . A A .  45 LEU CB   1 1 
        1   692 1 1  45 LEU CD1  C -11.840  -3.936 -18.492 1.00 . A A .  45 LEU CD1  1 1 
        1   693 1 1  45 LEU CD2  C -12.748  -3.170 -16.288 1.00 . A A .  45 LEU CD2  1 1 
        1   694 1 1  45 LEU CG   C -11.496  -3.540 -17.067 1.00 . A A .  45 LEU CG   1 1 
        1   695 1 1  45 LEU H    H -12.609  -5.313 -14.777 1.00 . A A .  45 LEU H    1 1 
        1   696 1 1  45 LEU HA   H -11.741  -6.292 -17.302 1.00 . A A .  45 LEU HA   1 1 
        1   697 1 1  45 LEU HB2  H -10.525  -4.341 -15.349 1.00 . A A .  45 LEU HB2  1 1 
        1   698 1 1  45 LEU HB3  H  -9.757  -4.756 -16.866 1.00 . A A .  45 LEU HB3  1 1 
        1   699 1 1  45 LEU HD11 H -12.424  -4.843 -18.483 1.00 . A A .  45 LEU HD11 1 1 
        1   700 1 1  45 LEU HD12 H -10.929  -4.096 -19.049 1.00 . A A .  45 LEU HD12 1 1 
        1   701 1 1  45 LEU HD13 H -12.411  -3.145 -18.955 1.00 . A A .  45 LEU HD13 1 1 
        1   702 1 1  45 LEU HD21 H -13.294  -2.409 -16.826 1.00 . A A .  45 LEU HD21 1 1 
        1   703 1 1  45 LEU HD22 H -12.466  -2.792 -15.316 1.00 . A A .  45 LEU HD22 1 1 
        1   704 1 1  45 LEU HD23 H -13.370  -4.044 -16.168 1.00 . A A .  45 LEU HD23 1 1 
        1   705 1 1  45 LEU HG   H -10.870  -2.661 -17.119 1.00 . A A .  45 LEU HG   1 1 
        1   706 1 1  45 LEU N    N -12.487  -6.064 -15.392 1.00 . A A .  45 LEU N    1 1 
        1   707 1 1  45 LEU O    O  -9.890  -7.889 -16.712 1.00 . A A .  45 LEU O    1 1 
        1   708 1 1  46 LEU C    C  -9.505  -9.336 -13.950 1.00 . A A .  46 LEU C    1 1 
        1   709 1 1  46 LEU CA   C  -8.932  -7.941 -14.113 1.00 . A A .  46 LEU CA   1 1 
        1   710 1 1  46 LEU CB   C  -8.436  -7.438 -12.758 1.00 . A A .  46 LEU CB   1 1 
        1   711 1 1  46 LEU CD1  C  -6.030  -8.001 -13.186 1.00 . A A .  46 LEU CD1  1 1 
        1   712 1 1  46 LEU CD2  C  -6.813  -7.576 -10.853 1.00 . A A .  46 LEU CD2  1 1 
        1   713 1 1  46 LEU CG   C  -7.190  -8.141 -12.214 1.00 . A A .  46 LEU CG   1 1 
        1   714 1 1  46 LEU H    H -10.369  -6.395 -14.033 1.00 . A A .  46 LEU H    1 1 
        1   715 1 1  46 LEU HA   H  -8.108  -7.972 -14.810 1.00 . A A .  46 LEU HA   1 1 
        1   716 1 1  46 LEU HB2  H  -8.228  -6.388 -12.846 1.00 . A A .  46 LEU HB2  1 1 
        1   717 1 1  46 LEU HB3  H  -9.232  -7.567 -12.041 1.00 . A A .  46 LEU HB3  1 1 
        1   718 1 1  46 LEU HD11 H  -6.290  -8.464 -14.126 1.00 . A A .  46 LEU HD11 1 1 
        1   719 1 1  46 LEU HD12 H  -5.155  -8.484 -12.775 1.00 . A A .  46 LEU HD12 1 1 
        1   720 1 1  46 LEU HD13 H  -5.821  -6.953 -13.346 1.00 . A A .  46 LEU HD13 1 1 
        1   721 1 1  46 LEU HD21 H  -5.951  -8.103 -10.469 1.00 . A A .  46 LEU HD21 1 1 
        1   722 1 1  46 LEU HD22 H  -7.641  -7.695 -10.170 1.00 . A A .  46 LEU HD22 1 1 
        1   723 1 1  46 LEU HD23 H  -6.576  -6.527 -10.953 1.00 . A A .  46 LEU HD23 1 1 
        1   724 1 1  46 LEU HG   H  -7.400  -9.194 -12.094 1.00 . A A .  46 LEU HG   1 1 
        1   725 1 1  46 LEU N    N  -9.948  -7.040 -14.638 1.00 . A A .  46 LEU N    1 1 
        1   726 1 1  46 LEU O    O  -9.036 -10.300 -14.559 1.00 . A A .  46 LEU O    1 1 
        1   727 1 1  47 ALA C    C -11.988 -11.245 -14.004 1.00 . A A .  47 ALA C    1 1 
        1   728 1 1  47 ALA CA   C -11.177 -10.700 -12.828 1.00 . A A .  47 ALA CA   1 1 
        1   729 1 1  47 ALA CB   C -12.058 -10.561 -11.597 1.00 . A A .  47 ALA CB   1 1 
        1   730 1 1  47 ALA H    H -10.912  -8.592 -12.743 1.00 . A A .  47 ALA H    1 1 
        1   731 1 1  47 ALA HA   H -10.390 -11.403 -12.596 1.00 . A A .  47 ALA HA   1 1 
        1   732 1 1  47 ALA HB1  H -12.863  -9.873 -11.806 1.00 . A A .  47 ALA HB1  1 1 
        1   733 1 1  47 ALA HB2  H -11.470 -10.187 -10.771 1.00 . A A .  47 ALA HB2  1 1 
        1   734 1 1  47 ALA HB3  H -12.469 -11.526 -11.338 1.00 . A A .  47 ALA HB3  1 1 
        1   735 1 1  47 ALA N    N -10.551  -9.422 -13.145 1.00 . A A .  47 ALA N    1 1 
        1   736 1 1  47 ALA O    O -12.579 -12.323 -13.913 1.00 . A A .  47 ALA O    1 1 
        1   737 1 1  48 GLY C    C -11.833 -11.160 -17.476 1.00 . A A .  48 GLY C    1 1 
        1   738 1 1  48 GLY CA   C -12.740 -10.941 -16.279 1.00 . A A .  48 GLY CA   1 1 
        1   739 1 1  48 GLY H    H -11.546  -9.642 -15.113 1.00 . A A .  48 GLY H    1 1 
        1   740 1 1  48 GLY HA2  H -13.247 -11.868 -16.051 1.00 . A A .  48 GLY HA2  1 1 
        1   741 1 1  48 GLY HA3  H -13.478 -10.194 -16.532 1.00 . A A .  48 GLY HA3  1 1 
        1   742 1 1  48 GLY N    N -12.015 -10.502 -15.103 1.00 . A A .  48 GLY N    1 1 
        1   743 1 1  48 GLY O    O -12.287 -11.601 -18.531 1.00 . A A .  48 GLY O    1 1 
        1   744 1 1  49 GLN C    C  -8.887 -12.398 -18.210 1.00 . A A .  49 GLN C    1 1 
        1   745 1 1  49 GLN CA   C  -9.584 -11.054 -18.399 1.00 . A A .  49 GLN CA   1 1 
        1   746 1 1  49 GLN CB   C  -8.565  -9.907 -18.439 1.00 . A A .  49 GLN CB   1 1 
        1   747 1 1  49 GLN CD   C  -6.785  -8.691 -19.763 1.00 . A A .  49 GLN CD   1 1 
        1   748 1 1  49 GLN CG   C  -7.627  -9.947 -19.638 1.00 . A A .  49 GLN CG   1 1 
        1   749 1 1  49 GLN H    H -10.247 -10.452 -16.479 1.00 . A A .  49 GLN H    1 1 
        1   750 1 1  49 GLN HA   H -10.128 -11.074 -19.332 1.00 . A A .  49 GLN HA   1 1 
        1   751 1 1  49 GLN HB2  H  -9.102  -8.971 -18.464 1.00 . A A .  49 GLN HB2  1 1 
        1   752 1 1  49 GLN HB3  H  -7.967  -9.943 -17.541 1.00 . A A .  49 GLN HB3  1 1 
        1   753 1 1  49 GLN HE21 H  -8.149  -7.859 -20.947 1.00 . A A .  49 GLN HE21 1 1 
        1   754 1 1  49 GLN HE22 H  -6.751  -6.900 -20.612 1.00 . A A .  49 GLN HE22 1 1 
        1   755 1 1  49 GLN HG2  H  -6.965 -10.793 -19.532 1.00 . A A .  49 GLN HG2  1 1 
        1   756 1 1  49 GLN HG3  H  -8.215 -10.061 -20.536 1.00 . A A .  49 GLN HG3  1 1 
        1   757 1 1  49 GLN N    N -10.550 -10.844 -17.324 1.00 . A A .  49 GLN N    1 1 
        1   758 1 1  49 GLN NE2  N  -7.277  -7.719 -20.515 1.00 . A A .  49 GLN NE2  1 1 
        1   759 1 1  49 GLN O    O  -8.145 -12.860 -19.078 1.00 . A A .  49 GLN O    1 1 
        1   760 1 1  49 GLN OE1  O  -5.697  -8.598 -19.201 1.00 . A A .  49 GLN OE1  1 1 
        1   761 1 1  50 GLY C    C  -7.164 -14.282 -16.310 1.00 . A A .  50 GLY C    1 1 
        1   762 1 1  50 GLY CA   C  -8.597 -14.336 -16.795 1.00 . A A .  50 GLY CA   1 1 
        1   763 1 1  50 GLY H    H  -9.725 -12.590 -16.409 1.00 . A A .  50 GLY H    1 1 
        1   764 1 1  50 GLY HA2  H  -9.203 -14.817 -16.042 1.00 . A A .  50 GLY HA2  1 1 
        1   765 1 1  50 GLY HA3  H  -8.636 -14.923 -17.701 1.00 . A A .  50 GLY HA3  1 1 
        1   766 1 1  50 GLY N    N  -9.147 -13.024 -17.068 1.00 . A A .  50 GLY N    1 1 
        1   767 1 1  50 GLY O    O  -6.317 -15.047 -16.773 1.00 . A A .  50 GLY O    1 1 
        1   768 1 1  51 LYS C    C  -5.601 -12.822 -13.379 1.00 . A A .  51 LYS C    1 1 
        1   769 1 1  51 LYS CA   C  -5.543 -13.260 -14.831 1.00 . A A .  51 LYS CA   1 1 
        1   770 1 1  51 LYS CB   C  -4.712 -12.284 -15.660 1.00 . A A .  51 LYS CB   1 1 
        1   771 1 1  51 LYS CD   C  -4.698 -10.066 -16.811 1.00 . A A .  51 LYS CD   1 1 
        1   772 1 1  51 LYS CE   C  -3.183 -10.124 -16.899 1.00 . A A .  51 LYS CE   1 1 
        1   773 1 1  51 LYS CG   C  -5.233 -10.862 -15.638 1.00 . A A .  51 LYS CG   1 1 
        1   774 1 1  51 LYS H    H  -7.594 -12.793 -15.044 1.00 . A A .  51 LYS H    1 1 
        1   775 1 1  51 LYS HA   H  -5.080 -14.232 -14.878 1.00 . A A .  51 LYS HA   1 1 
        1   776 1 1  51 LYS HB2  H  -3.701 -12.280 -15.280 1.00 . A A .  51 LYS HB2  1 1 
        1   777 1 1  51 LYS HB3  H  -4.698 -12.624 -16.683 1.00 . A A .  51 LYS HB3  1 1 
        1   778 1 1  51 LYS HD2  H  -5.115 -10.466 -17.723 1.00 . A A .  51 LYS HD2  1 1 
        1   779 1 1  51 LYS HD3  H  -5.001  -9.038 -16.695 1.00 . A A .  51 LYS HD3  1 1 
        1   780 1 1  51 LYS HE2  H  -2.767  -9.671 -16.015 1.00 . A A .  51 LYS HE2  1 1 
        1   781 1 1  51 LYS HE3  H  -2.878 -11.160 -16.949 1.00 . A A .  51 LYS HE3  1 1 
        1   782 1 1  51 LYS HG2  H  -6.312 -10.880 -15.689 1.00 . A A .  51 LYS HG2  1 1 
        1   783 1 1  51 LYS HG3  H  -4.920 -10.387 -14.719 1.00 . A A .  51 LYS HG3  1 1 
        1   784 1 1  51 LYS HZ1  H  -1.638  -9.320 -18.064 1.00 . A A .  51 LYS HZ1  1 1 
        1   785 1 1  51 LYS HZ2  H  -3.094  -8.462 -18.171 1.00 . A A .  51 LYS HZ2  1 1 
        1   786 1 1  51 LYS HZ3  H  -2.929  -9.952 -18.966 1.00 . A A .  51 LYS HZ3  1 1 
        1   787 1 1  51 LYS N    N  -6.883 -13.382 -15.380 1.00 . A A .  51 LYS N    1 1 
        1   788 1 1  51 LYS NZ   N  -2.676  -9.414 -18.105 1.00 . A A .  51 LYS NZ   1 1 
        1   789 1 1  51 LYS O    O  -6.659 -12.433 -12.884 1.00 . A A .  51 LYS O    1 1 
        1   790 1 1  52 SER C    C  -3.293 -11.586 -10.996 1.00 . A A .  52 SER C    1 1 
        1   791 1 1  52 SER CA   C  -4.404 -12.587 -11.288 1.00 . A A .  52 SER CA   1 1 
        1   792 1 1  52 SER CB   C  -4.148 -13.879 -10.509 1.00 . A A .  52 SER CB   1 1 
        1   793 1 1  52 SER H    H  -3.641 -13.114 -13.185 1.00 . A A .  52 SER H    1 1 
        1   794 1 1  52 SER HA   H  -5.353 -12.167 -10.986 1.00 . A A .  52 SER HA   1 1 
        1   795 1 1  52 SER HB2  H  -3.149 -14.230 -10.718 1.00 . A A .  52 SER HB2  1 1 
        1   796 1 1  52 SER HB3  H  -4.247 -13.684  -9.452 1.00 . A A .  52 SER HB3  1 1 
        1   797 1 1  52 SER HG   H  -5.730 -14.997 -10.170 1.00 . A A .  52 SER HG   1 1 
        1   798 1 1  52 SER N    N  -4.465 -12.879 -12.709 1.00 . A A .  52 SER N    1 1 
        1   799 1 1  52 SER O    O  -2.340 -11.468 -11.770 1.00 . A A .  52 SER O    1 1 
        1   800 1 1  52 SER OG   O  -5.071 -14.892 -10.876 1.00 . A A .  52 SER OG   1 1 
        1   801 1 1  53 PRO C    C  -1.059 -10.697  -9.158 1.00 . A A .  53 PRO C    1 1 
        1   802 1 1  53 PRO CA   C  -2.351  -9.934  -9.435 1.00 . A A .  53 PRO CA   1 1 
        1   803 1 1  53 PRO CB   C  -2.908  -9.333  -8.141 1.00 . A A .  53 PRO CB   1 1 
        1   804 1 1  53 PRO CD   C  -4.590 -10.783  -9.010 1.00 . A A .  53 PRO CD   1 1 
        1   805 1 1  53 PRO CG   C  -4.383  -9.511  -8.240 1.00 . A A .  53 PRO CG   1 1 
        1   806 1 1  53 PRO HA   H  -2.160  -9.149 -10.152 1.00 . A A .  53 PRO HA   1 1 
        1   807 1 1  53 PRO HB2  H  -2.501  -9.862  -7.292 1.00 . A A .  53 PRO HB2  1 1 
        1   808 1 1  53 PRO HB3  H  -2.640  -8.288  -8.083 1.00 . A A .  53 PRO HB3  1 1 
        1   809 1 1  53 PRO HD2  H  -4.607 -11.632  -8.344 1.00 . A A .  53 PRO HD2  1 1 
        1   810 1 1  53 PRO HD3  H  -5.502 -10.733  -9.586 1.00 . A A .  53 PRO HD3  1 1 
        1   811 1 1  53 PRO HG2  H  -4.810  -9.595  -7.252 1.00 . A A .  53 PRO HG2  1 1 
        1   812 1 1  53 PRO HG3  H  -4.819  -8.677  -8.769 1.00 . A A .  53 PRO HG3  1 1 
        1   813 1 1  53 PRO N    N  -3.412 -10.832  -9.891 1.00 . A A .  53 PRO N    1 1 
        1   814 1 1  53 PRO O    O  -1.080 -11.795  -8.598 1.00 . A A .  53 PRO O    1 1 
        1   815 1 1  54 SER C    C   1.926 -10.655  -8.023 1.00 . A A .  54 SER C    1 1 
        1   816 1 1  54 SER CA   C   1.357 -10.762  -9.438 1.00 . A A .  54 SER CA   1 1 
        1   817 1 1  54 SER CB   C   2.330 -10.149 -10.454 1.00 . A A .  54 SER CB   1 1 
        1   818 1 1  54 SER H    H   0.017  -9.179  -9.874 1.00 . A A .  54 SER H    1 1 
        1   819 1 1  54 SER HA   H   1.213 -11.805  -9.677 1.00 . A A .  54 SER HA   1 1 
        1   820 1 1  54 SER HB2  H   1.872 -10.149 -11.431 1.00 . A A .  54 SER HB2  1 1 
        1   821 1 1  54 SER HB3  H   2.554  -9.133 -10.165 1.00 . A A .  54 SER HB3  1 1 
        1   822 1 1  54 SER HG   H   3.639 -11.425  -9.728 1.00 . A A .  54 SER HG   1 1 
        1   823 1 1  54 SER N    N   0.062 -10.100  -9.533 1.00 . A A .  54 SER N    1 1 
        1   824 1 1  54 SER O    O   3.042 -11.103  -7.755 1.00 . A A .  54 SER O    1 1 
        1   825 1 1  54 SER OG   O   3.544 -10.881 -10.523 1.00 . A A .  54 SER OG   1 1 
        1   826 1 1  55 GLY C    C   0.440  -9.535  -4.842 1.00 . A A .  55 GLY C    1 1 
        1   827 1 1  55 GLY CA   C   1.586  -9.920  -5.749 1.00 . A A .  55 GLY CA   1 1 
        1   828 1 1  55 GLY H    H   0.278  -9.721  -7.393 1.00 . A A .  55 GLY H    1 1 
        1   829 1 1  55 GLY HA2  H   2.001 -10.860  -5.412 1.00 . A A .  55 GLY HA2  1 1 
        1   830 1 1  55 GLY HA3  H   2.346  -9.157  -5.692 1.00 . A A .  55 GLY HA3  1 1 
        1   831 1 1  55 GLY N    N   1.156 -10.062  -7.123 1.00 . A A .  55 GLY N    1 1 
        1   832 1 1  55 GLY O    O  -0.696  -9.411  -5.305 1.00 . A A .  55 GLY O    1 1 
        1   833 1 1  56 PRO C    C  -0.716  -7.477  -2.769 1.00 . A A .  56 PRO C    1 1 
        1   834 1 1  56 PRO CA   C  -0.312  -8.937  -2.575 1.00 . A A .  56 PRO CA   1 1 
        1   835 1 1  56 PRO CB   C   0.380  -9.122  -1.216 1.00 . A A .  56 PRO CB   1 1 
        1   836 1 1  56 PRO CD   C   2.008  -9.561  -2.902 1.00 . A A .  56 PRO CD   1 1 
        1   837 1 1  56 PRO CG   C   1.621  -9.901  -1.496 1.00 . A A .  56 PRO CG   1 1 
        1   838 1 1  56 PRO HA   H  -1.190  -9.564  -2.627 1.00 . A A .  56 PRO HA   1 1 
        1   839 1 1  56 PRO HB2  H   0.611  -8.155  -0.796 1.00 . A A .  56 PRO HB2  1 1 
        1   840 1 1  56 PRO HB3  H  -0.278  -9.659  -0.549 1.00 . A A .  56 PRO HB3  1 1 
        1   841 1 1  56 PRO HD2  H   2.603  -8.660  -2.925 1.00 . A A .  56 PRO HD2  1 1 
        1   842 1 1  56 PRO HD3  H   2.539 -10.383  -3.359 1.00 . A A .  56 PRO HD3  1 1 
        1   843 1 1  56 PRO HG2  H   2.401  -9.607  -0.810 1.00 . A A .  56 PRO HG2  1 1 
        1   844 1 1  56 PRO HG3  H   1.419 -10.959  -1.408 1.00 . A A .  56 PRO HG3  1 1 
        1   845 1 1  56 PRO N    N   0.705  -9.355  -3.542 1.00 . A A .  56 PRO N    1 1 
        1   846 1 1  56 PRO O    O   0.074  -6.670  -3.262 1.00 . A A .  56 PRO O    1 1 
        1   847 1 1  57 PRO C    C  -1.857  -4.789  -1.518 1.00 . A A .  57 PRO C    1 1 
        1   848 1 1  57 PRO CA   C  -2.464  -5.758  -2.527 1.00 . A A .  57 PRO CA   1 1 
        1   849 1 1  57 PRO CB   C  -3.974  -5.905  -2.278 1.00 . A A .  57 PRO CB   1 1 
        1   850 1 1  57 PRO CD   C  -2.937  -8.001  -1.753 1.00 . A A .  57 PRO CD   1 1 
        1   851 1 1  57 PRO CG   C  -4.234  -7.375  -2.173 1.00 . A A .  57 PRO CG   1 1 
        1   852 1 1  57 PRO HA   H  -2.298  -5.383  -3.527 1.00 . A A .  57 PRO HA   1 1 
        1   853 1 1  57 PRO HB2  H  -4.239  -5.394  -1.363 1.00 . A A .  57 PRO HB2  1 1 
        1   854 1 1  57 PRO HB3  H  -4.517  -5.469  -3.103 1.00 . A A .  57 PRO HB3  1 1 
        1   855 1 1  57 PRO HD2  H  -2.844  -7.996  -0.676 1.00 . A A .  57 PRO HD2  1 1 
        1   856 1 1  57 PRO HD3  H  -2.857  -9.006  -2.140 1.00 . A A .  57 PRO HD3  1 1 
        1   857 1 1  57 PRO HG2  H  -4.996  -7.561  -1.431 1.00 . A A .  57 PRO HG2  1 1 
        1   858 1 1  57 PRO HG3  H  -4.542  -7.762  -3.133 1.00 . A A .  57 PRO HG3  1 1 
        1   859 1 1  57 PRO N    N  -1.946  -7.118  -2.374 1.00 . A A .  57 PRO N    1 1 
        1   860 1 1  57 PRO O    O  -1.750  -5.101  -0.323 1.00 . A A .  57 PRO O    1 1 
        1   861 1 1  58 PHE C    C  -1.710  -1.325  -1.173 1.00 . A A .  58 PHE C    1 1 
        1   862 1 1  58 PHE CA   C  -0.879  -2.602  -1.140 1.00 . A A .  58 PHE CA   1 1 
        1   863 1 1  58 PHE CB   C   0.583  -2.325  -1.534 1.00 . A A .  58 PHE CB   1 1 
        1   864 1 1  58 PHE CD1  C   0.926  -3.058  -3.915 1.00 . A A .  58 PHE CD1  1 1 
        1   865 1 1  58 PHE CD2  C   0.891  -0.720  -3.445 1.00 . A A .  58 PHE CD2  1 1 
        1   866 1 1  58 PHE CE1  C   1.132  -2.789  -5.255 1.00 . A A .  58 PHE CE1  1 1 
        1   867 1 1  58 PHE CE2  C   1.099  -0.445  -4.783 1.00 . A A .  58 PHE CE2  1 1 
        1   868 1 1  58 PHE CG   C   0.802  -2.028  -2.995 1.00 . A A .  58 PHE CG   1 1 
        1   869 1 1  58 PHE CZ   C   1.219  -1.481  -5.689 1.00 . A A .  58 PHE CZ   1 1 
        1   870 1 1  58 PHE H    H  -1.609  -3.413  -2.951 1.00 . A A .  58 PHE H    1 1 
        1   871 1 1  58 PHE HA   H  -0.897  -2.990  -0.133 1.00 . A A .  58 PHE HA   1 1 
        1   872 1 1  58 PHE HB2  H   0.939  -1.474  -0.973 1.00 . A A .  58 PHE HB2  1 1 
        1   873 1 1  58 PHE HB3  H   1.183  -3.188  -1.276 1.00 . A A .  58 PHE HB3  1 1 
        1   874 1 1  58 PHE HD1  H   0.858  -4.081  -3.577 1.00 . A A .  58 PHE HD1  1 1 
        1   875 1 1  58 PHE HD2  H   0.797   0.091  -2.738 1.00 . A A .  58 PHE HD2  1 1 
        1   876 1 1  58 PHE HE1  H   1.225  -3.602  -5.961 1.00 . A A .  58 PHE HE1  1 1 
        1   877 1 1  58 PHE HE2  H   1.165   0.578  -5.121 1.00 . A A .  58 PHE HE2  1 1 
        1   878 1 1  58 PHE HZ   H   1.381  -1.268  -6.735 1.00 . A A .  58 PHE HZ   1 1 
        1   879 1 1  58 PHE N    N  -1.471  -3.615  -1.997 1.00 . A A .  58 PHE N    1 1 
        1   880 1 1  58 PHE O    O  -1.854  -0.680  -2.212 1.00 . A A .  58 PHE O    1 1 
        1   881 1 1  59 ALA C    C  -2.386   1.440   0.418 1.00 . A A .  59 ALA C    1 1 
        1   882 1 1  59 ALA CA   C  -3.143   0.170   0.074 1.00 . A A .  59 ALA CA   1 1 
        1   883 1 1  59 ALA CB   C  -4.220  -0.104   1.111 1.00 . A A .  59 ALA CB   1 1 
        1   884 1 1  59 ALA H    H  -1.979  -1.432   0.796 1.00 . A A .  59 ALA H    1 1 
        1   885 1 1  59 ALA HA   H  -3.621   0.294  -0.887 1.00 . A A .  59 ALA HA   1 1 
        1   886 1 1  59 ALA HB1  H  -3.764  -0.199   2.086 1.00 . A A .  59 ALA HB1  1 1 
        1   887 1 1  59 ALA HB2  H  -4.735  -1.021   0.864 1.00 . A A .  59 ALA HB2  1 1 
        1   888 1 1  59 ALA HB3  H  -4.925   0.714   1.123 1.00 . A A .  59 ALA HB3  1 1 
        1   889 1 1  59 ALA N    N  -2.234  -0.953  -0.020 1.00 . A A .  59 ALA N    1 1 
        1   890 1 1  59 ALA O    O  -1.874   1.596   1.525 1.00 . A A .  59 ALA O    1 1 
        1   891 1 1  60 ARG C    C  -2.638   4.733  -0.271 1.00 . A A .  60 ARG C    1 1 
        1   892 1 1  60 ARG CA   C  -1.627   3.605  -0.354 1.00 . A A .  60 ARG CA   1 1 
        1   893 1 1  60 ARG CB   C  -0.646   3.857  -1.505 1.00 . A A .  60 ARG CB   1 1 
        1   894 1 1  60 ARG CD   C  -0.276   3.911  -3.998 1.00 . A A .  60 ARG CD   1 1 
        1   895 1 1  60 ARG CG   C  -1.186   3.449  -2.869 1.00 . A A .  60 ARG CG   1 1 
        1   896 1 1  60 ARG CZ   C   0.519   6.196  -4.516 1.00 . A A .  60 ARG CZ   1 1 
        1   897 1 1  60 ARG H    H  -2.755   2.156  -1.404 1.00 . A A .  60 ARG H    1 1 
        1   898 1 1  60 ARG HA   H  -1.078   3.554   0.578 1.00 . A A .  60 ARG HA   1 1 
        1   899 1 1  60 ARG HB2  H  -0.407   4.911  -1.538 1.00 . A A .  60 ARG HB2  1 1 
        1   900 1 1  60 ARG HB3  H   0.259   3.299  -1.321 1.00 . A A .  60 ARG HB3  1 1 
        1   901 1 1  60 ARG HD2  H   0.751   3.754  -3.702 1.00 . A A .  60 ARG HD2  1 1 
        1   902 1 1  60 ARG HD3  H  -0.490   3.324  -4.878 1.00 . A A .  60 ARG HD3  1 1 
        1   903 1 1  60 ARG HE   H  -1.402   5.653  -4.392 1.00 . A A .  60 ARG HE   1 1 
        1   904 1 1  60 ARG HG2  H  -1.266   2.372  -2.905 1.00 . A A .  60 ARG HG2  1 1 
        1   905 1 1  60 ARG HG3  H  -2.164   3.888  -3.003 1.00 . A A .  60 ARG HG3  1 1 
        1   906 1 1  60 ARG HH11 H   2.019   4.860  -4.226 1.00 . A A .  60 ARG HH11 1 1 
        1   907 1 1  60 ARG HH12 H   2.530   6.484  -4.595 1.00 . A A .  60 ARG HH12 1 1 
        1   908 1 1  60 ARG HH21 H  -0.744   7.732  -4.881 1.00 . A A .  60 ARG HH21 1 1 
        1   909 1 1  60 ARG HH22 H   0.949   8.128  -4.945 1.00 . A A .  60 ARG HH22 1 1 
        1   910 1 1  60 ARG N    N  -2.313   2.340  -0.541 1.00 . A A .  60 ARG N    1 1 
        1   911 1 1  60 ARG NE   N  -0.466   5.325  -4.313 1.00 . A A .  60 ARG NE   1 1 
        1   912 1 1  60 ARG NH1  N   1.788   5.815  -4.439 1.00 . A A .  60 ARG NH1  1 1 
        1   913 1 1  60 ARG NH2  N   0.222   7.452  -4.809 1.00 . A A .  60 ARG NH2  1 1 
        1   914 1 1  60 ARG O    O  -3.597   4.761  -1.035 1.00 . A A .  60 ARG O    1 1 
        1   915 1 1  61 TYR C    C  -2.552   8.092   0.805 1.00 . A A .  61 TYR C    1 1 
        1   916 1 1  61 TYR CA   C  -3.336   6.791   0.761 1.00 . A A .  61 TYR CA   1 1 
        1   917 1 1  61 TYR CB   C  -4.295   6.671   1.959 1.00 . A A .  61 TYR CB   1 1 
        1   918 1 1  61 TYR CD1  C  -3.371   7.724   4.067 1.00 . A A .  61 TYR CD1  1 1 
        1   919 1 1  61 TYR CD2  C  -3.364   5.345   3.901 1.00 . A A .  61 TYR CD2  1 1 
        1   920 1 1  61 TYR CE1  C  -2.816   7.642   5.331 1.00 . A A .  61 TYR CE1  1 1 
        1   921 1 1  61 TYR CE2  C  -2.805   5.254   5.162 1.00 . A A .  61 TYR CE2  1 1 
        1   922 1 1  61 TYR CG   C  -3.652   6.579   3.329 1.00 . A A .  61 TYR CG   1 1 
        1   923 1 1  61 TYR CZ   C  -2.535   6.404   5.873 1.00 . A A .  61 TYR CZ   1 1 
        1   924 1 1  61 TYR H    H  -1.688   5.564   1.279 1.00 . A A .  61 TYR H    1 1 
        1   925 1 1  61 TYR HA   H  -3.930   6.797  -0.143 1.00 . A A .  61 TYR HA   1 1 
        1   926 1 1  61 TYR HB2  H  -4.942   7.534   1.968 1.00 . A A .  61 TYR HB2  1 1 
        1   927 1 1  61 TYR HB3  H  -4.902   5.786   1.823 1.00 . A A .  61 TYR HB3  1 1 
        1   928 1 1  61 TYR HD1  H  -3.588   8.691   3.638 1.00 . A A .  61 TYR HD1  1 1 
        1   929 1 1  61 TYR HD2  H  -3.575   4.445   3.343 1.00 . A A .  61 TYR HD2  1 1 
        1   930 1 1  61 TYR HE1  H  -2.604   8.544   5.888 1.00 . A A .  61 TYR HE1  1 1 
        1   931 1 1  61 TYR HE2  H  -2.584   4.286   5.587 1.00 . A A .  61 TYR HE2  1 1 
        1   932 1 1  61 TYR HH   H  -1.436   5.533   7.190 1.00 . A A .  61 TYR HH   1 1 
        1   933 1 1  61 TYR N    N  -2.447   5.649   0.660 1.00 . A A .  61 TYR N    1 1 
        1   934 1 1  61 TYR O    O  -1.525   8.197   1.483 1.00 . A A .  61 TYR O    1 1 
        1   935 1 1  61 TYR OH   O  -1.988   6.317   7.133 1.00 . A A .  61 TYR OH   1 1 
        1   936 1 1  62 PHE C    C  -3.194  11.409   0.695 1.00 . A A .  62 PHE C    1 1 
        1   937 1 1  62 PHE CA   C  -2.386  10.355  -0.051 1.00 . A A .  62 PHE CA   1 1 
        1   938 1 1  62 PHE CB   C  -2.221  10.740  -1.526 1.00 . A A .  62 PHE CB   1 1 
        1   939 1 1  62 PHE CD1  C  -0.094  12.073  -1.475 1.00 . A A .  62 PHE CD1  1 1 
        1   940 1 1  62 PHE CD2  C  -2.082  13.145  -2.238 1.00 . A A .  62 PHE CD2  1 1 
        1   941 1 1  62 PHE CE1  C   0.618  13.239  -1.682 1.00 . A A .  62 PHE CE1  1 1 
        1   942 1 1  62 PHE CE2  C  -1.375  14.314  -2.447 1.00 . A A .  62 PHE CE2  1 1 
        1   943 1 1  62 PHE CG   C  -1.451  12.013  -1.749 1.00 . A A .  62 PHE CG   1 1 
        1   944 1 1  62 PHE CZ   C  -0.024  14.361  -2.169 1.00 . A A .  62 PHE CZ   1 1 
        1   945 1 1  62 PHE H    H  -3.871   8.913  -0.444 1.00 . A A .  62 PHE H    1 1 
        1   946 1 1  62 PHE HA   H  -1.411  10.275   0.406 1.00 . A A .  62 PHE HA   1 1 
        1   947 1 1  62 PHE HB2  H  -1.699   9.946  -2.039 1.00 . A A .  62 PHE HB2  1 1 
        1   948 1 1  62 PHE HB3  H  -3.199  10.862  -1.967 1.00 . A A .  62 PHE HB3  1 1 
        1   949 1 1  62 PHE HD1  H   0.409  11.196  -1.095 1.00 . A A .  62 PHE HD1  1 1 
        1   950 1 1  62 PHE HD2  H  -3.140  13.110  -2.458 1.00 . A A .  62 PHE HD2  1 1 
        1   951 1 1  62 PHE HE1  H   1.674  13.273  -1.465 1.00 . A A .  62 PHE HE1  1 1 
        1   952 1 1  62 PHE HE2  H  -1.880  15.190  -2.829 1.00 . A A .  62 PHE HE2  1 1 
        1   953 1 1  62 PHE HZ   H   0.529  15.274  -2.331 1.00 . A A .  62 PHE HZ   1 1 
        1   954 1 1  62 PHE N    N  -3.034   9.066   0.055 1.00 . A A .  62 PHE N    1 1 
        1   955 1 1  62 PHE O    O  -4.425  11.502   0.543 1.00 . A A .  62 PHE O    1 1 
        1   956 1 1  63 GLY C    C  -2.844  13.013   3.773 1.00 . A A .  63 GLY C    1 1 
        1   957 1 1  63 GLY CA   C  -3.135  13.205   2.303 1.00 . A A .  63 GLY CA   1 1 
        1   958 1 1  63 GLY H    H  -1.525  12.059   1.571 1.00 . A A .  63 GLY H    1 1 
        1   959 1 1  63 GLY HA2  H  -2.774  14.176   1.995 1.00 . A A .  63 GLY HA2  1 1 
        1   960 1 1  63 GLY HA3  H  -4.203  13.158   2.147 1.00 . A A .  63 GLY HA3  1 1 
        1   961 1 1  63 GLY N    N  -2.495  12.188   1.505 1.00 . A A .  63 GLY N    1 1 
        1   962 1 1  63 GLY O    O  -3.149  11.960   4.335 1.00 . A A .  63 GLY O    1 1 
        1   963 1 1  64 MET C    C  -3.200  13.897   6.635 1.00 . A A .  64 MET C    1 1 
        1   964 1 1  64 MET CA   C  -1.918  13.961   5.814 1.00 . A A .  64 MET CA   1 1 
        1   965 1 1  64 MET CB   C  -1.064  15.164   6.239 1.00 . A A .  64 MET CB   1 1 
        1   966 1 1  64 MET CE   C  -0.330  17.414   4.021 1.00 . A A .  64 MET CE   1 1 
        1   967 1 1  64 MET CG   C   0.313  15.210   5.581 1.00 . A A .  64 MET CG   1 1 
        1   968 1 1  64 MET H    H  -1.963  14.804   3.873 1.00 . A A .  64 MET H    1 1 
        1   969 1 1  64 MET HA   H  -1.355  13.056   5.990 1.00 . A A .  64 MET HA   1 1 
        1   970 1 1  64 MET HB2  H  -1.591  16.072   5.983 1.00 . A A .  64 MET HB2  1 1 
        1   971 1 1  64 MET HB3  H  -0.926  15.130   7.310 1.00 . A A .  64 MET HB3  1 1 
        1   972 1 1  64 MET HE1  H   0.362  17.977   4.632 1.00 . A A .  64 MET HE1  1 1 
        1   973 1 1  64 MET HE2  H  -1.302  17.409   4.488 1.00 . A A .  64 MET HE2  1 1 
        1   974 1 1  64 MET HE3  H  -0.402  17.873   3.045 1.00 . A A .  64 MET HE3  1 1 
        1   975 1 1  64 MET HG2  H   0.937  15.899   6.128 1.00 . A A .  64 MET HG2  1 1 
        1   976 1 1  64 MET HG3  H   0.750  14.221   5.628 1.00 . A A .  64 MET HG3  1 1 
        1   977 1 1  64 MET N    N  -2.228  14.015   4.390 1.00 . A A .  64 MET N    1 1 
        1   978 1 1  64 MET O    O  -4.288  14.147   6.110 1.00 . A A .  64 MET O    1 1 
        1   979 1 1  64 MET SD   S   0.259  15.732   3.852 1.00 . A A .  64 MET SD   1 1 
        1   980 1 1  65 SER C    C  -5.288  14.387   8.660 1.00 . A A .  65 SER C    1 1 
        1   981 1 1  65 SER CA   C  -4.196  13.326   8.806 1.00 . A A .  65 SER CA   1 1 
        1   982 1 1  65 SER CB   C  -3.722  13.244  10.259 1.00 . A A .  65 SER CB   1 1 
        1   983 1 1  65 SER H    H  -2.150  13.512   8.293 1.00 . A A .  65 SER H    1 1 
        1   984 1 1  65 SER HA   H  -4.614  12.371   8.528 1.00 . A A .  65 SER HA   1 1 
        1   985 1 1  65 SER HB2  H  -4.580  13.249  10.915 1.00 . A A .  65 SER HB2  1 1 
        1   986 1 1  65 SER HB3  H  -3.163  12.332  10.403 1.00 . A A .  65 SER HB3  1 1 
        1   987 1 1  65 SER HG   H  -3.256  15.148  10.192 1.00 . A A .  65 SER HG   1 1 
        1   988 1 1  65 SER N    N  -3.056  13.578   7.922 1.00 . A A .  65 SER N    1 1 
        1   989 1 1  65 SER O    O  -5.092  15.558   8.998 1.00 . A A .  65 SER O    1 1 
        1   990 1 1  65 SER OG   O  -2.892  14.345  10.588 1.00 . A A .  65 SER OG   1 1 
        1   991 1 1  66 ALA C    C  -8.859  14.040   8.022 1.00 . A A .  66 ALA C    1 1 
        1   992 1 1  66 ALA CA   C  -7.567  14.838   7.930 1.00 . A A .  66 ALA CA   1 1 
        1   993 1 1  66 ALA CB   C  -7.457  15.529   6.577 1.00 . A A .  66 ALA CB   1 1 
        1   994 1 1  66 ALA H    H  -6.516  13.014   7.894 1.00 . A A .  66 ALA H    1 1 
        1   995 1 1  66 ALA HA   H  -7.558  15.594   8.704 1.00 . A A .  66 ALA HA   1 1 
        1   996 1 1  66 ALA HB1  H  -8.290  16.205   6.449 1.00 . A A .  66 ALA HB1  1 1 
        1   997 1 1  66 ALA HB2  H  -7.471  14.788   5.791 1.00 . A A .  66 ALA HB2  1 1 
        1   998 1 1  66 ALA HB3  H  -6.532  16.084   6.531 1.00 . A A .  66 ALA HB3  1 1 
        1   999 1 1  66 ALA N    N  -6.432  13.959   8.142 1.00 . A A .  66 ALA N    1 1 
        1  1000 1 1  66 ALA O    O  -8.833  12.853   8.348 1.00 . A A .  66 ALA O    1 1 
        1  1001 1 1  67 GLY C    C -11.405  13.031   6.618 1.00 . A A .  67 GLY C    1 1 
        1  1002 1 1  67 GLY CA   C -11.257  14.001   7.773 1.00 . A A .  67 GLY CA   1 1 
        1  1003 1 1  67 GLY H    H  -9.942  15.641   7.502 1.00 . A A .  67 GLY H    1 1 
        1  1004 1 1  67 GLY HA2  H -11.338  13.457   8.702 1.00 . A A .  67 GLY HA2  1 1 
        1  1005 1 1  67 GLY HA3  H -12.050  14.732   7.721 1.00 . A A .  67 GLY HA3  1 1 
        1  1006 1 1  67 GLY N    N  -9.981  14.688   7.739 1.00 . A A .  67 GLY N    1 1 
        1  1007 1 1  67 GLY O    O -11.652  11.841   6.817 1.00 . A A .  67 GLY O    1 1 
        1  1008 1 1  68 THR C    C  -9.987  12.783   3.460 1.00 . A A .  68 THR C    1 1 
        1  1009 1 1  68 THR CA   C -11.314  12.724   4.215 1.00 . A A .  68 THR CA   1 1 
        1  1010 1 1  68 THR CB   C -12.461  13.192   3.299 1.00 . A A .  68 THR CB   1 1 
        1  1011 1 1  68 THR CG2  C -12.638  12.256   2.114 1.00 . A A .  68 THR CG2  1 1 
        1  1012 1 1  68 THR H    H -11.091  14.509   5.317 1.00 . A A .  68 THR H    1 1 
        1  1013 1 1  68 THR HA   H -11.507  11.704   4.515 1.00 . A A .  68 THR HA   1 1 
        1  1014 1 1  68 THR HB   H -12.224  14.178   2.929 1.00 . A A .  68 THR HB   1 1 
        1  1015 1 1  68 THR HG1  H -13.736  14.098   4.512 1.00 . A A .  68 THR HG1  1 1 
        1  1016 1 1  68 THR HG21 H -12.864  11.263   2.472 1.00 . A A .  68 THR HG21 1 1 
        1  1017 1 1  68 THR HG22 H -11.725  12.232   1.537 1.00 . A A .  68 THR HG22 1 1 
        1  1018 1 1  68 THR HG23 H -13.448  12.609   1.494 1.00 . A A .  68 THR HG23 1 1 
        1  1019 1 1  68 THR N    N -11.247  13.543   5.410 1.00 . A A .  68 THR N    1 1 
        1  1020 1 1  68 THR O    O  -9.480  13.867   3.157 1.00 . A A .  68 THR O    1 1 
        1  1021 1 1  68 THR OG1  O -13.685  13.250   4.046 1.00 . A A .  68 THR OG1  1 1 
        1  1022 1 1  69 PHE C    C  -8.305  10.634   1.242 1.00 . A A .  69 PHE C    1 1 
        1  1023 1 1  69 PHE CA   C  -8.155  11.522   2.470 1.00 . A A .  69 PHE CA   1 1 
        1  1024 1 1  69 PHE CB   C  -7.057  10.998   3.406 1.00 . A A .  69 PHE CB   1 1 
        1  1025 1 1  69 PHE CD1  C  -8.075  10.003   5.475 1.00 . A A .  69 PHE CD1  1 1 
        1  1026 1 1  69 PHE CD2  C  -7.253   8.523   3.797 1.00 . A A .  69 PHE CD2  1 1 
        1  1027 1 1  69 PHE CE1  C  -8.459   8.923   6.246 1.00 . A A .  69 PHE CE1  1 1 
        1  1028 1 1  69 PHE CE2  C  -7.635   7.439   4.564 1.00 . A A .  69 PHE CE2  1 1 
        1  1029 1 1  69 PHE CG   C  -7.472   9.816   4.241 1.00 . A A .  69 PHE CG   1 1 
        1  1030 1 1  69 PHE CZ   C  -8.236   7.639   5.792 1.00 . A A .  69 PHE CZ   1 1 
        1  1031 1 1  69 PHE H    H  -9.895  10.790   3.425 1.00 . A A .  69 PHE H    1 1 
        1  1032 1 1  69 PHE HA   H  -7.890  12.517   2.143 1.00 . A A .  69 PHE HA   1 1 
        1  1033 1 1  69 PHE HB2  H  -6.204  10.700   2.814 1.00 . A A .  69 PHE HB2  1 1 
        1  1034 1 1  69 PHE HB3  H  -6.761  11.793   4.076 1.00 . A A .  69 PHE HB3  1 1 
        1  1035 1 1  69 PHE HD1  H  -8.251  11.007   5.832 1.00 . A A .  69 PHE HD1  1 1 
        1  1036 1 1  69 PHE HD2  H  -6.783   8.365   2.838 1.00 . A A .  69 PHE HD2  1 1 
        1  1037 1 1  69 PHE HE1  H  -8.928   9.082   7.206 1.00 . A A .  69 PHE HE1  1 1 
        1  1038 1 1  69 PHE HE2  H  -7.460   6.436   4.206 1.00 . A A .  69 PHE HE2  1 1 
        1  1039 1 1  69 PHE HZ   H  -8.534   6.793   6.393 1.00 . A A .  69 PHE HZ   1 1 
        1  1040 1 1  69 PHE N    N  -9.428  11.618   3.172 1.00 . A A .  69 PHE N    1 1 
        1  1041 1 1  69 PHE O    O  -9.310   9.936   1.099 1.00 . A A .  69 PHE O    1 1 
        1  1042 1 1  70 GLU C    C  -6.699   8.684  -0.971 1.00 . A A .  70 GLU C    1 1 
        1  1043 1 1  70 GLU CA   C  -7.451  10.013  -0.940 1.00 . A A .  70 GLU CA   1 1 
        1  1044 1 1  70 GLU CB   C  -6.926  10.973  -2.009 1.00 . A A .  70 GLU CB   1 1 
        1  1045 1 1  70 GLU CD   C  -7.073  11.799  -4.383 1.00 . A A .  70 GLU CD   1 1 
        1  1046 1 1  70 GLU CG   C  -7.397  10.672  -3.419 1.00 . A A .  70 GLU CG   1 1 
        1  1047 1 1  70 GLU H    H  -6.455  11.084   0.600 1.00 . A A .  70 GLU H    1 1 
        1  1048 1 1  70 GLU HA   H  -8.500   9.829  -1.113 1.00 . A A .  70 GLU HA   1 1 
        1  1049 1 1  70 GLU HB2  H  -7.242  11.974  -1.757 1.00 . A A .  70 GLU HB2  1 1 
        1  1050 1 1  70 GLU HB3  H  -5.846  10.938  -2.001 1.00 . A A .  70 GLU HB3  1 1 
        1  1051 1 1  70 GLU HG2  H  -6.909   9.772  -3.763 1.00 . A A .  70 GLU HG2  1 1 
        1  1052 1 1  70 GLU HG3  H  -8.467  10.521  -3.407 1.00 . A A .  70 GLU HG3  1 1 
        1  1053 1 1  70 GLU N    N  -7.313  10.651   0.363 1.00 . A A .  70 GLU N    1 1 
        1  1054 1 1  70 GLU O    O  -5.473   8.660  -0.913 1.00 . A A .  70 GLU O    1 1 
        1  1055 1 1  70 GLU OE1  O  -5.908  11.898  -4.828 1.00 . A A .  70 GLU OE1  1 1 
        1  1056 1 1  70 GLU OE2  O  -7.983  12.597  -4.704 1.00 . A A .  70 GLU OE2  1 1 
        1  1057 1 1  71 VAL C    C  -6.789   5.565  -2.334 1.00 . A A .  71 VAL C    1 1 
        1  1058 1 1  71 VAL CA   C  -6.828   6.255  -0.974 1.00 . A A .  71 VAL CA   1 1 
        1  1059 1 1  71 VAL CB   C  -7.564   5.334   0.034 1.00 . A A .  71 VAL CB   1 1 
        1  1060 1 1  71 VAL CG1  C  -7.651   5.987   1.404 1.00 . A A .  71 VAL CG1  1 1 
        1  1061 1 1  71 VAL CG2  C  -8.954   4.961  -0.461 1.00 . A A .  71 VAL CG2  1 1 
        1  1062 1 1  71 VAL H    H  -8.407   7.657  -1.196 1.00 . A A .  71 VAL H    1 1 
        1  1063 1 1  71 VAL HA   H  -5.813   6.385  -0.627 1.00 . A A .  71 VAL HA   1 1 
        1  1064 1 1  71 VAL HB   H  -6.990   4.423   0.137 1.00 . A A .  71 VAL HB   1 1 
        1  1065 1 1  71 VAL HG11 H  -8.184   5.335   2.080 1.00 . A A .  71 VAL HG11 1 1 
        1  1066 1 1  71 VAL HG12 H  -8.177   6.926   1.321 1.00 . A A .  71 VAL HG12 1 1 
        1  1067 1 1  71 VAL HG13 H  -6.655   6.165   1.784 1.00 . A A .  71 VAL HG13 1 1 
        1  1068 1 1  71 VAL HG21 H  -9.423   4.296   0.250 1.00 . A A .  71 VAL HG21 1 1 
        1  1069 1 1  71 VAL HG22 H  -8.877   4.468  -1.419 1.00 . A A .  71 VAL HG22 1 1 
        1  1070 1 1  71 VAL HG23 H  -9.552   5.856  -0.564 1.00 . A A .  71 VAL HG23 1 1 
        1  1071 1 1  71 VAL N    N  -7.436   7.580  -1.056 1.00 . A A .  71 VAL N    1 1 
        1  1072 1 1  71 VAL O    O  -7.644   5.797  -3.194 1.00 . A A .  71 VAL O    1 1 
        1  1073 1 1  72 GLU C    C  -5.341   2.476  -3.332 1.00 . A A .  72 GLU C    1 1 
        1  1074 1 1  72 GLU CA   C  -5.627   3.928  -3.721 1.00 . A A .  72 GLU CA   1 1 
        1  1075 1 1  72 GLU CB   C  -4.494   4.488  -4.588 1.00 . A A .  72 GLU CB   1 1 
        1  1076 1 1  72 GLU CD   C  -3.524   6.522  -5.744 1.00 . A A .  72 GLU CD   1 1 
        1  1077 1 1  72 GLU CG   C  -4.697   5.944  -4.981 1.00 . A A .  72 GLU CG   1 1 
        1  1078 1 1  72 GLU H    H  -5.096   4.649  -1.809 1.00 . A A .  72 GLU H    1 1 
        1  1079 1 1  72 GLU HA   H  -6.555   3.970  -4.272 1.00 . A A .  72 GLU HA   1 1 
        1  1080 1 1  72 GLU HB2  H  -3.565   4.411  -4.043 1.00 . A A .  72 GLU HB2  1 1 
        1  1081 1 1  72 GLU HB3  H  -4.423   3.901  -5.492 1.00 . A A .  72 GLU HB3  1 1 
        1  1082 1 1  72 GLU HG2  H  -5.578   6.015  -5.601 1.00 . A A .  72 GLU HG2  1 1 
        1  1083 1 1  72 GLU HG3  H  -4.845   6.527  -4.084 1.00 . A A .  72 GLU HG3  1 1 
        1  1084 1 1  72 GLU N    N  -5.780   4.727  -2.516 1.00 . A A .  72 GLU N    1 1 
        1  1085 1 1  72 GLU O    O  -4.373   2.194  -2.622 1.00 . A A .  72 GLU O    1 1 
        1  1086 1 1  72 GLU OE1  O  -2.507   6.857  -5.103 1.00 . A A .  72 GLU OE1  1 1 
        1  1087 1 1  72 GLU OE2  O  -3.620   6.659  -6.983 1.00 . A A .  72 GLU OE2  1 1 
        1  1088 1 1  73 PHE C    C  -4.840  -0.521  -3.851 1.00 . A A .  73 PHE C    1 1 
        1  1089 1 1  73 PHE CA   C  -6.129   0.157  -3.391 1.00 . A A .  73 PHE CA   1 1 
        1  1090 1 1  73 PHE CB   C  -7.345  -0.604  -3.920 1.00 . A A .  73 PHE CB   1 1 
        1  1091 1 1  73 PHE CD1  C  -9.181   0.877  -3.063 1.00 . A A .  73 PHE CD1  1 1 
        1  1092 1 1  73 PHE CD2  C  -9.169  -1.413  -2.404 1.00 . A A .  73 PHE CD2  1 1 
        1  1093 1 1  73 PHE CE1  C -10.326   1.088  -2.321 1.00 . A A .  73 PHE CE1  1 1 
        1  1094 1 1  73 PHE CE2  C -10.313  -1.208  -1.660 1.00 . A A .  73 PHE CE2  1 1 
        1  1095 1 1  73 PHE CG   C  -8.589  -0.373  -3.111 1.00 . A A .  73 PHE CG   1 1 
        1  1096 1 1  73 PHE CZ   C -10.893   0.043  -1.620 1.00 . A A .  73 PHE CZ   1 1 
        1  1097 1 1  73 PHE H    H  -6.909   1.856  -4.396 1.00 . A A .  73 PHE H    1 1 
        1  1098 1 1  73 PHE HA   H  -6.155   0.129  -2.312 1.00 . A A .  73 PHE HA   1 1 
        1  1099 1 1  73 PHE HB2  H  -7.546  -0.290  -4.933 1.00 . A A .  73 PHE HB2  1 1 
        1  1100 1 1  73 PHE HB3  H  -7.132  -1.663  -3.911 1.00 . A A .  73 PHE HB3  1 1 
        1  1101 1 1  73 PHE HD1  H  -8.738   1.696  -3.611 1.00 . A A .  73 PHE HD1  1 1 
        1  1102 1 1  73 PHE HD2  H  -8.715  -2.392  -2.436 1.00 . A A .  73 PHE HD2  1 1 
        1  1103 1 1  73 PHE HE1  H -10.778   2.069  -2.293 1.00 . A A .  73 PHE HE1  1 1 
        1  1104 1 1  73 PHE HE2  H -10.755  -2.026  -1.111 1.00 . A A .  73 PHE HE2  1 1 
        1  1105 1 1  73 PHE HZ   H -11.789   0.205  -1.040 1.00 . A A .  73 PHE HZ   1 1 
        1  1106 1 1  73 PHE N    N  -6.199   1.568  -3.787 1.00 . A A .  73 PHE N    1 1 
        1  1107 1 1  73 PHE O    O  -4.323  -1.387  -3.154 1.00 . A A .  73 PHE O    1 1 
        1  1108 1 1  74 GLY C    C  -2.906  -2.104  -5.603 1.00 . A A .  74 GLY C    1 1 
        1  1109 1 1  74 GLY CA   C  -3.056  -0.593  -5.504 1.00 . A A .  74 GLY CA   1 1 
        1  1110 1 1  74 GLY H    H  -4.891   0.452  -5.589 1.00 . A A .  74 GLY H    1 1 
        1  1111 1 1  74 GLY HA2  H  -2.884  -0.169  -6.481 1.00 . A A .  74 GLY HA2  1 1 
        1  1112 1 1  74 GLY HA3  H  -2.301  -0.216  -4.830 1.00 . A A .  74 GLY HA3  1 1 
        1  1113 1 1  74 GLY N    N  -4.358  -0.144  -5.031 1.00 . A A .  74 GLY N    1 1 
        1  1114 1 1  74 GLY O    O  -2.385  -2.745  -4.687 1.00 . A A .  74 GLY O    1 1 
        1  1115 1 1  75 PHE C    C  -1.969  -4.242  -7.965 1.00 . A A .  75 PHE C    1 1 
        1  1116 1 1  75 PHE CA   C  -3.104  -4.094  -6.962 1.00 . A A .  75 PHE CA   1 1 
        1  1117 1 1  75 PHE CB   C  -4.369  -4.770  -7.505 1.00 . A A .  75 PHE CB   1 1 
        1  1118 1 1  75 PHE CD1  C  -6.324  -3.711  -6.332 1.00 . A A .  75 PHE CD1  1 1 
        1  1119 1 1  75 PHE CD2  C  -5.774  -5.970  -5.807 1.00 . A A .  75 PHE CD2  1 1 
        1  1120 1 1  75 PHE CE1  C  -7.375  -3.757  -5.438 1.00 . A A .  75 PHE CE1  1 1 
        1  1121 1 1  75 PHE CE2  C  -6.824  -6.020  -4.912 1.00 . A A .  75 PHE CE2  1 1 
        1  1122 1 1  75 PHE CG   C  -5.510  -4.815  -6.526 1.00 . A A .  75 PHE CG   1 1 
        1  1123 1 1  75 PHE CZ   C  -7.626  -4.913  -4.728 1.00 . A A .  75 PHE CZ   1 1 
        1  1124 1 1  75 PHE H    H  -3.825  -2.145  -7.384 1.00 . A A .  75 PHE H    1 1 
        1  1125 1 1  75 PHE HA   H  -2.818  -4.559  -6.030 1.00 . A A .  75 PHE HA   1 1 
        1  1126 1 1  75 PHE HB2  H  -4.706  -4.232  -8.378 1.00 . A A .  75 PHE HB2  1 1 
        1  1127 1 1  75 PHE HB3  H  -4.132  -5.786  -7.787 1.00 . A A .  75 PHE HB3  1 1 
        1  1128 1 1  75 PHE HD1  H  -6.129  -2.804  -6.887 1.00 . A A .  75 PHE HD1  1 1 
        1  1129 1 1  75 PHE HD2  H  -5.148  -6.838  -5.950 1.00 . A A .  75 PHE HD2  1 1 
        1  1130 1 1  75 PHE HE1  H  -8.002  -2.890  -5.296 1.00 . A A .  75 PHE HE1  1 1 
        1  1131 1 1  75 PHE HE2  H  -7.019  -6.925  -4.357 1.00 . A A .  75 PHE HE2  1 1 
        1  1132 1 1  75 PHE HZ   H  -8.447  -4.950  -4.029 1.00 . A A .  75 PHE HZ   1 1 
        1  1133 1 1  75 PHE N    N  -3.345  -2.680  -6.714 1.00 . A A .  75 PHE N    1 1 
        1  1134 1 1  75 PHE O    O  -1.918  -3.519  -8.957 1.00 . A A .  75 PHE O    1 1 
        1  1135 1 1  76 PRO C    C  -0.176  -6.297  -9.791 1.00 . A A .  76 PRO C    1 1 
        1  1136 1 1  76 PRO CA   C   0.102  -5.405  -8.588 1.00 . A A .  76 PRO CA   1 1 
        1  1137 1 1  76 PRO CB   C   1.110  -6.082  -7.646 1.00 . A A .  76 PRO CB   1 1 
        1  1138 1 1  76 PRO CD   C  -1.084  -6.160  -6.642 1.00 . A A .  76 PRO CD   1 1 
        1  1139 1 1  76 PRO CG   C   0.381  -6.330  -6.357 1.00 . A A .  76 PRO CG   1 1 
        1  1140 1 1  76 PRO HA   H   0.504  -4.462  -8.928 1.00 . A A .  76 PRO HA   1 1 
        1  1141 1 1  76 PRO HB2  H   1.447  -7.008  -8.088 1.00 . A A .  76 PRO HB2  1 1 
        1  1142 1 1  76 PRO HB3  H   1.955  -5.426  -7.496 1.00 . A A .  76 PRO HB3  1 1 
        1  1143 1 1  76 PRO HD2  H  -1.526  -7.099  -6.941 1.00 . A A .  76 PRO HD2  1 1 
        1  1144 1 1  76 PRO HD3  H  -1.595  -5.750  -5.784 1.00 . A A .  76 PRO HD3  1 1 
        1  1145 1 1  76 PRO HG2  H   0.577  -7.335  -6.015 1.00 . A A .  76 PRO HG2  1 1 
        1  1146 1 1  76 PRO HG3  H   0.702  -5.615  -5.614 1.00 . A A .  76 PRO HG3  1 1 
        1  1147 1 1  76 PRO N    N  -1.070  -5.208  -7.748 1.00 . A A .  76 PRO N    1 1 
        1  1148 1 1  76 PRO O    O  -0.590  -7.448  -9.646 1.00 . A A .  76 PRO O    1 1 
        1  1149 1 1  77 VAL C    C   1.223  -6.606 -12.943 1.00 . A A .  77 VAL C    1 1 
        1  1150 1 1  77 VAL CA   C  -0.107  -6.525 -12.201 1.00 . A A .  77 VAL CA   1 1 
        1  1151 1 1  77 VAL CB   C  -1.190  -5.909 -13.117 1.00 . A A .  77 VAL CB   1 1 
        1  1152 1 1  77 VAL CG1  C  -2.548  -5.926 -12.430 1.00 . A A .  77 VAL CG1  1 1 
        1  1153 1 1  77 VAL CG2  C  -0.815  -4.492 -13.528 1.00 . A A .  77 VAL CG2  1 1 
        1  1154 1 1  77 VAL H    H   0.373  -4.832 -11.030 1.00 . A A .  77 VAL H    1 1 
        1  1155 1 1  77 VAL HA   H  -0.417  -7.524 -11.932 1.00 . A A .  77 VAL HA   1 1 
        1  1156 1 1  77 VAL HB   H  -1.259  -6.512 -14.010 1.00 . A A .  77 VAL HB   1 1 
        1  1157 1 1  77 VAL HG11 H  -3.284  -5.476 -13.079 1.00 . A A .  77 VAL HG11 1 1 
        1  1158 1 1  77 VAL HG12 H  -2.492  -5.369 -11.508 1.00 . A A .  77 VAL HG12 1 1 
        1  1159 1 1  77 VAL HG13 H  -2.832  -6.946 -12.217 1.00 . A A .  77 VAL HG13 1 1 
        1  1160 1 1  77 VAL HG21 H  -0.659  -3.891 -12.645 1.00 . A A .  77 VAL HG21 1 1 
        1  1161 1 1  77 VAL HG22 H  -1.613  -4.065 -14.118 1.00 . A A .  77 VAL HG22 1 1 
        1  1162 1 1  77 VAL HG23 H   0.092  -4.515 -14.112 1.00 . A A .  77 VAL HG23 1 1 
        1  1163 1 1  77 VAL N    N   0.059  -5.764 -10.975 1.00 . A A .  77 VAL N    1 1 
        1  1164 1 1  77 VAL O    O   2.261  -6.224 -12.402 1.00 . A A .  77 VAL O    1 1 
        1  1165 1 1  78 GLU C    C   2.548  -6.074 -15.941 1.00 . A A .  78 GLU C    1 1 
        1  1166 1 1  78 GLU CA   C   2.410  -7.233 -14.959 1.00 . A A .  78 GLU CA   1 1 
        1  1167 1 1  78 GLU CB   C   2.457  -8.589 -15.687 1.00 . A A .  78 GLU CB   1 1 
        1  1168 1 1  78 GLU CD   C   0.160  -8.425 -16.782 1.00 . A A .  78 GLU CD   1 1 
        1  1169 1 1  78 GLU CG   C   1.095  -9.246 -15.919 1.00 . A A .  78 GLU CG   1 1 
        1  1170 1 1  78 GLU H    H   0.332  -7.372 -14.561 1.00 . A A .  78 GLU H    1 1 
        1  1171 1 1  78 GLU HA   H   3.242  -7.187 -14.272 1.00 . A A .  78 GLU HA   1 1 
        1  1172 1 1  78 GLU HB2  H   2.923  -8.444 -16.650 1.00 . A A .  78 GLU HB2  1 1 
        1  1173 1 1  78 GLU HB3  H   3.063  -9.269 -15.107 1.00 . A A .  78 GLU HB3  1 1 
        1  1174 1 1  78 GLU HG2  H   1.250 -10.199 -16.401 1.00 . A A .  78 GLU HG2  1 1 
        1  1175 1 1  78 GLU HG3  H   0.625  -9.406 -14.959 1.00 . A A .  78 GLU HG3  1 1 
        1  1176 1 1  78 GLU N    N   1.196  -7.105 -14.166 1.00 . A A .  78 GLU N    1 1 
        1  1177 1 1  78 GLU O    O   3.657  -5.667 -16.288 1.00 . A A .  78 GLU O    1 1 
        1  1178 1 1  78 GLU OE1  O  -0.456  -7.481 -16.255 1.00 . A A .  78 GLU OE1  1 1 
        1  1179 1 1  78 GLU OE2  O   0.020  -8.730 -17.983 1.00 . A A .  78 GLU OE2  1 1 
        1  1180 1 1  79 GLY C    C   0.365  -4.500 -18.340 1.00 . A A .  79 GLY C    1 1 
        1  1181 1 1  79 GLY CA   C   1.426  -4.399 -17.266 1.00 . A A .  79 GLY CA   1 1 
        1  1182 1 1  79 GLY H    H   0.561  -5.960 -16.122 1.00 . A A .  79 GLY H    1 1 
        1  1183 1 1  79 GLY HA2  H   1.248  -3.508 -16.681 1.00 . A A .  79 GLY HA2  1 1 
        1  1184 1 1  79 GLY HA3  H   2.395  -4.325 -17.735 1.00 . A A .  79 GLY HA3  1 1 
        1  1185 1 1  79 GLY N    N   1.417  -5.547 -16.383 1.00 . A A .  79 GLY N    1 1 
        1  1186 1 1  79 GLY O    O  -0.168  -3.486 -18.798 1.00 . A A .  79 GLY O    1 1 
        1  1187 1 1  80 GLY C    C  -2.353  -6.028 -19.229 1.00 . A A .  80 GLY C    1 1 
        1  1188 1 1  80 GLY CA   C  -0.941  -5.948 -19.767 1.00 . A A .  80 GLY CA   1 1 
        1  1189 1 1  80 GLY H    H   0.440  -6.500 -18.261 1.00 . A A .  80 GLY H    1 1 
        1  1190 1 1  80 GLY HA2  H  -0.880  -5.134 -20.475 1.00 . A A .  80 GLY HA2  1 1 
        1  1191 1 1  80 GLY HA3  H  -0.707  -6.873 -20.274 1.00 . A A .  80 GLY HA3  1 1 
        1  1192 1 1  80 GLY N    N   0.033  -5.728 -18.718 1.00 . A A .  80 GLY N    1 1 
        1  1193 1 1  80 GLY O    O  -3.064  -7.001 -19.468 1.00 . A A .  80 GLY O    1 1 
        1  1194 1 1  81 VAL C    C  -4.638  -3.535 -18.163 1.00 . A A .  81 VAL C    1 1 
        1  1195 1 1  81 VAL CA   C  -4.087  -4.932 -17.925 1.00 . A A .  81 VAL CA   1 1 
        1  1196 1 1  81 VAL CB   C  -4.103  -5.232 -16.405 1.00 . A A .  81 VAL CB   1 1 
        1  1197 1 1  81 VAL CG1  C  -5.522  -5.376 -15.883 1.00 . A A .  81 VAL CG1  1 1 
        1  1198 1 1  81 VAL CG2  C  -3.302  -6.482 -16.083 1.00 . A A .  81 VAL CG2  1 1 
        1  1199 1 1  81 VAL H    H  -2.111  -4.287 -18.293 1.00 . A A .  81 VAL H    1 1 
        1  1200 1 1  81 VAL HA   H  -4.710  -5.655 -18.432 1.00 . A A .  81 VAL HA   1 1 
        1  1201 1 1  81 VAL HB   H  -3.646  -4.399 -15.896 1.00 . A A .  81 VAL HB   1 1 
        1  1202 1 1  81 VAL HG11 H  -6.072  -4.469 -16.082 1.00 . A A .  81 VAL HG11 1 1 
        1  1203 1 1  81 VAL HG12 H  -5.495  -5.556 -14.818 1.00 . A A .  81 VAL HG12 1 1 
        1  1204 1 1  81 VAL HG13 H  -6.003  -6.207 -16.377 1.00 . A A .  81 VAL HG13 1 1 
        1  1205 1 1  81 VAL HG21 H  -2.284  -6.354 -16.422 1.00 . A A .  81 VAL HG21 1 1 
        1  1206 1 1  81 VAL HG22 H  -3.744  -7.332 -16.583 1.00 . A A .  81 VAL HG22 1 1 
        1  1207 1 1  81 VAL HG23 H  -3.308  -6.649 -15.016 1.00 . A A .  81 VAL HG23 1 1 
        1  1208 1 1  81 VAL N    N  -2.744  -5.013 -18.477 1.00 . A A .  81 VAL N    1 1 
        1  1209 1 1  81 VAL O    O  -3.872  -2.583 -18.318 1.00 . A A .  81 VAL O    1 1 
        1  1210 1 1  82 GLU C    C  -7.657  -1.931 -17.327 1.00 . A A .  82 GLU C    1 1 
        1  1211 1 1  82 GLU CA   C  -6.594  -2.133 -18.396 1.00 . A A .  82 GLU CA   1 1 
        1  1212 1 1  82 GLU CB   C  -7.207  -2.049 -19.799 1.00 . A A .  82 GLU CB   1 1 
        1  1213 1 1  82 GLU CD   C  -8.256  -0.559 -21.554 1.00 . A A .  82 GLU CD   1 1 
        1  1214 1 1  82 GLU CG   C  -7.846  -0.702 -20.105 1.00 . A A .  82 GLU CG   1 1 
        1  1215 1 1  82 GLU H    H  -6.503  -4.212 -18.070 1.00 . A A .  82 GLU H    1 1 
        1  1216 1 1  82 GLU HA   H  -5.842  -1.365 -18.291 1.00 . A A .  82 GLU HA   1 1 
        1  1217 1 1  82 GLU HB2  H  -6.432  -2.230 -20.529 1.00 . A A .  82 GLU HB2  1 1 
        1  1218 1 1  82 GLU HB3  H  -7.965  -2.812 -19.894 1.00 . A A .  82 GLU HB3  1 1 
        1  1219 1 1  82 GLU HG2  H  -8.723  -0.587 -19.487 1.00 . A A .  82 GLU HG2  1 1 
        1  1220 1 1  82 GLU HG3  H  -7.136   0.078 -19.868 1.00 . A A .  82 GLU HG3  1 1 
        1  1221 1 1  82 GLU N    N  -5.949  -3.417 -18.200 1.00 . A A .  82 GLU N    1 1 
        1  1222 1 1  82 GLU O    O  -8.215  -2.899 -16.809 1.00 . A A .  82 GLU O    1 1 
        1  1223 1 1  82 GLU OE1  O  -9.194  -1.257 -21.986 1.00 . A A .  82 GLU OE1  1 1 
        1  1224 1 1  82 GLU OE2  O  -7.643   0.260 -22.269 1.00 . A A .  82 GLU OE2  1 1 
        1  1225 1 1  83 GLY C    C -10.115   0.309 -16.583 1.00 . A A .  83 GLY C    1 1 
        1  1226 1 1  83 GLY CA   C  -8.909  -0.380 -15.981 1.00 . A A .  83 GLY CA   1 1 
        1  1227 1 1  83 GLY H    H  -7.423   0.044 -17.415 1.00 . A A .  83 GLY H    1 1 
        1  1228 1 1  83 GLY HA2  H  -9.223  -1.300 -15.512 1.00 . A A .  83 GLY HA2  1 1 
        1  1229 1 1  83 GLY HA3  H  -8.475   0.264 -15.235 1.00 . A A .  83 GLY HA3  1 1 
        1  1230 1 1  83 GLY N    N  -7.910  -0.682 -16.979 1.00 . A A .  83 GLY N    1 1 
        1  1231 1 1  83 GLY O    O -10.174   0.518 -17.794 1.00 . A A .  83 GLY O    1 1 
        1  1232 1 1  84 SER C    C -12.916   2.107 -15.077 1.00 . A A .  84 SER C    1 1 
        1  1233 1 1  84 SER CA   C -12.282   1.317 -16.212 1.00 . A A .  84 SER CA   1 1 
        1  1234 1 1  84 SER CB   C -13.260   0.268 -16.751 1.00 . A A .  84 SER CB   1 1 
        1  1235 1 1  84 SER H    H -10.946   0.527 -14.779 1.00 . A A .  84 SER H    1 1 
        1  1236 1 1  84 SER HA   H -12.015   1.997 -17.008 1.00 . A A .  84 SER HA   1 1 
        1  1237 1 1  84 SER HB2  H -12.724  -0.431 -17.375 1.00 . A A .  84 SER HB2  1 1 
        1  1238 1 1  84 SER HB3  H -13.704  -0.262 -15.921 1.00 . A A .  84 SER HB3  1 1 
        1  1239 1 1  84 SER HG   H -14.567   0.234 -18.212 1.00 . A A .  84 SER HG   1 1 
        1  1240 1 1  84 SER N    N -11.068   0.676 -15.744 1.00 . A A .  84 SER N    1 1 
        1  1241 1 1  84 SER O    O -12.785   1.740 -13.906 1.00 . A A .  84 SER O    1 1 
        1  1242 1 1  84 SER OG   O -14.297   0.857 -17.518 1.00 . A A .  84 SER OG   1 1 
        1  1243 1 1  85 GLY C    C -13.150   4.772 -13.618 1.00 . A A .  85 GLY C    1 1 
        1  1244 1 1  85 GLY CA   C -14.196   4.041 -14.426 1.00 . A A .  85 GLY CA   1 1 
        1  1245 1 1  85 GLY H    H -13.669   3.427 -16.377 1.00 . A A .  85 GLY H    1 1 
        1  1246 1 1  85 GLY HA2  H -14.833   4.764 -14.915 1.00 . A A .  85 GLY HA2  1 1 
        1  1247 1 1  85 GLY HA3  H -14.795   3.435 -13.761 1.00 . A A .  85 GLY HA3  1 1 
        1  1248 1 1  85 GLY N    N -13.592   3.192 -15.426 1.00 . A A .  85 GLY N    1 1 
        1  1249 1 1  85 GLY O    O -12.379   5.565 -14.160 1.00 . A A .  85 GLY O    1 1 
        1  1250 1 1  86 ARG C    C -11.023   4.121 -11.080 1.00 . A A .  86 ARG C    1 1 
        1  1251 1 1  86 ARG CA   C -12.115   5.121 -11.464 1.00 . A A .  86 ARG CA   1 1 
        1  1252 1 1  86 ARG CB   C -12.793   5.708 -10.221 1.00 . A A .  86 ARG CB   1 1 
        1  1253 1 1  86 ARG CD   C -12.584   7.159  -8.177 1.00 . A A .  86 ARG CD   1 1 
        1  1254 1 1  86 ARG CG   C -11.849   6.495  -9.327 1.00 . A A .  86 ARG CG   1 1 
        1  1255 1 1  86 ARG CZ   C -13.583   9.394  -7.888 1.00 . A A .  86 ARG CZ   1 1 
        1  1256 1 1  86 ARG H    H -13.753   3.862 -11.940 1.00 . A A .  86 ARG H    1 1 
        1  1257 1 1  86 ARG HA   H -11.660   5.924 -12.022 1.00 . A A .  86 ARG HA   1 1 
        1  1258 1 1  86 ARG HB2  H -13.587   6.368 -10.537 1.00 . A A .  86 ARG HB2  1 1 
        1  1259 1 1  86 ARG HB3  H -13.217   4.902  -9.640 1.00 . A A .  86 ARG HB3  1 1 
        1  1260 1 1  86 ARG HD2  H -13.229   6.430  -7.711 1.00 . A A .  86 ARG HD2  1 1 
        1  1261 1 1  86 ARG HD3  H -11.857   7.507  -7.459 1.00 . A A .  86 ARG HD3  1 1 
        1  1262 1 1  86 ARG HE   H -13.824   8.227  -9.507 1.00 . A A .  86 ARG HE   1 1 
        1  1263 1 1  86 ARG HG2  H -11.107   5.823  -8.923 1.00 . A A .  86 ARG HG2  1 1 
        1  1264 1 1  86 ARG HG3  H -11.362   7.258  -9.918 1.00 . A A .  86 ARG HG3  1 1 
        1  1265 1 1  86 ARG HH11 H -12.386   8.796  -6.369 1.00 . A A .  86 ARG HH11 1 1 
        1  1266 1 1  86 ARG HH12 H -13.134  10.343  -6.152 1.00 . A A .  86 ARG HH12 1 1 
        1  1267 1 1  86 ARG HH21 H -14.788  10.292  -9.246 1.00 . A A .  86 ARG HH21 1 1 
        1  1268 1 1  86 ARG HH22 H -14.498  11.198  -7.794 1.00 . A A .  86 ARG HH22 1 1 
        1  1269 1 1  86 ARG N    N -13.102   4.497 -12.326 1.00 . A A .  86 ARG N    1 1 
        1  1270 1 1  86 ARG NE   N -13.393   8.293  -8.618 1.00 . A A .  86 ARG NE   1 1 
        1  1271 1 1  86 ARG NH1  N -12.983   9.523  -6.710 1.00 . A A .  86 ARG NH1  1 1 
        1  1272 1 1  86 ARG NH2  N -14.347  10.373  -8.347 1.00 . A A .  86 ARG NH2  1 1 
        1  1273 1 1  86 ARG O    O  -9.975   4.502 -10.564 1.00 . A A .  86 ARG O    1 1 
        1  1274 1 1  87 VAL C    C  -9.423   1.588 -12.310 1.00 . A A .  87 VAL C    1 1 
        1  1275 1 1  87 VAL CA   C -10.261   1.827 -11.064 1.00 . A A .  87 VAL CA   1 1 
        1  1276 1 1  87 VAL CB   C -10.897   0.494 -10.621 1.00 . A A .  87 VAL CB   1 1 
        1  1277 1 1  87 VAL CG1  C  -9.870  -0.364  -9.901 1.00 . A A .  87 VAL CG1  1 1 
        1  1278 1 1  87 VAL CG2  C -12.117   0.729  -9.745 1.00 . A A .  87 VAL CG2  1 1 
        1  1279 1 1  87 VAL H    H -12.099   2.582 -11.772 1.00 . A A .  87 VAL H    1 1 
        1  1280 1 1  87 VAL HA   H  -9.623   2.189 -10.270 1.00 . A A .  87 VAL HA   1 1 
        1  1281 1 1  87 VAL HB   H -11.216  -0.038 -11.506 1.00 . A A .  87 VAL HB   1 1 
        1  1282 1 1  87 VAL HG11 H  -9.043  -0.570 -10.564 1.00 . A A .  87 VAL HG11 1 1 
        1  1283 1 1  87 VAL HG12 H -10.329  -1.292  -9.596 1.00 . A A .  87 VAL HG12 1 1 
        1  1284 1 1  87 VAL HG13 H  -9.511   0.163  -9.029 1.00 . A A .  87 VAL HG13 1 1 
        1  1285 1 1  87 VAL HG21 H -11.824   1.277  -8.861 1.00 . A A .  87 VAL HG21 1 1 
        1  1286 1 1  87 VAL HG22 H -12.540  -0.221  -9.455 1.00 . A A .  87 VAL HG22 1 1 
        1  1287 1 1  87 VAL HG23 H -12.851   1.298 -10.296 1.00 . A A .  87 VAL HG23 1 1 
        1  1288 1 1  87 VAL N    N -11.255   2.845 -11.350 1.00 . A A .  87 VAL N    1 1 
        1  1289 1 1  87 VAL O    O  -9.818   0.834 -13.201 1.00 . A A .  87 VAL O    1 1 
        1  1290 1 1  88 VAL C    C  -6.042   1.786 -13.281 1.00 . A A .  88 VAL C    1 1 
        1  1291 1 1  88 VAL CA   C  -7.464   2.231 -13.587 1.00 . A A .  88 VAL CA   1 1 
        1  1292 1 1  88 VAL CB   C  -7.432   3.614 -14.272 1.00 . A A .  88 VAL CB   1 1 
        1  1293 1 1  88 VAL CG1  C  -8.816   3.994 -14.773 1.00 . A A .  88 VAL CG1  1 1 
        1  1294 1 1  88 VAL CG2  C  -6.900   4.678 -13.322 1.00 . A A .  88 VAL CG2  1 1 
        1  1295 1 1  88 VAL H    H  -7.977   2.771 -11.605 1.00 . A A .  88 VAL H    1 1 
        1  1296 1 1  88 VAL HA   H  -7.908   1.526 -14.275 1.00 . A A .  88 VAL HA   1 1 
        1  1297 1 1  88 VAL HB   H  -6.768   3.558 -15.123 1.00 . A A .  88 VAL HB   1 1 
        1  1298 1 1  88 VAL HG11 H  -9.153   3.261 -15.492 1.00 . A A .  88 VAL HG11 1 1 
        1  1299 1 1  88 VAL HG12 H  -8.775   4.966 -15.243 1.00 . A A .  88 VAL HG12 1 1 
        1  1300 1 1  88 VAL HG13 H  -9.504   4.026 -13.941 1.00 . A A .  88 VAL HG13 1 1 
        1  1301 1 1  88 VAL HG21 H  -7.538   4.734 -12.453 1.00 . A A .  88 VAL HG21 1 1 
        1  1302 1 1  88 VAL HG22 H  -6.890   5.634 -13.824 1.00 . A A .  88 VAL HG22 1 1 
        1  1303 1 1  88 VAL HG23 H  -5.897   4.420 -13.018 1.00 . A A .  88 VAL HG23 1 1 
        1  1304 1 1  88 VAL N    N  -8.284   2.256 -12.385 1.00 . A A .  88 VAL N    1 1 
        1  1305 1 1  88 VAL O    O  -5.601   1.830 -12.133 1.00 . A A .  88 VAL O    1 1 
        1  1306 1 1  89 THR C    C  -3.004   2.080 -14.148 1.00 . A A .  89 THR C    1 1 
        1  1307 1 1  89 THR CA   C  -3.968   0.896 -14.172 1.00 . A A .  89 THR CA   1 1 
        1  1308 1 1  89 THR CB   C  -3.595  -0.034 -15.337 1.00 . A A .  89 THR CB   1 1 
        1  1309 1 1  89 THR CG2  C  -2.894  -1.287 -14.833 1.00 . A A .  89 THR CG2  1 1 
        1  1310 1 1  89 THR H    H  -5.757   1.316 -15.194 1.00 . A A .  89 THR H    1 1 
        1  1311 1 1  89 THR HA   H  -3.883   0.343 -13.248 1.00 . A A .  89 THR HA   1 1 
        1  1312 1 1  89 THR HB   H  -2.929   0.494 -16.001 1.00 . A A .  89 THR HB   1 1 
        1  1313 1 1  89 THR HG1  H  -4.755  -0.019 -16.943 1.00 . A A .  89 THR HG1  1 1 
        1  1314 1 1  89 THR HG21 H  -2.673  -1.935 -15.668 1.00 . A A .  89 THR HG21 1 1 
        1  1315 1 1  89 THR HG22 H  -3.538  -1.806 -14.136 1.00 . A A .  89 THR HG22 1 1 
        1  1316 1 1  89 THR HG23 H  -1.976  -1.012 -14.338 1.00 . A A .  89 THR HG23 1 1 
        1  1317 1 1  89 THR N    N  -5.339   1.349 -14.311 1.00 . A A .  89 THR N    1 1 
        1  1318 1 1  89 THR O    O  -3.211   3.073 -14.849 1.00 . A A .  89 THR O    1 1 
        1  1319 1 1  89 THR OG1  O  -4.783  -0.404 -16.052 1.00 . A A .  89 THR OG1  1 1 
        1  1320 1 1  90 GLY C    C   0.390   2.499 -12.852 1.00 . A A .  90 GLY C    1 1 
        1  1321 1 1  90 GLY CA   C  -0.978   3.027 -13.240 1.00 . A A .  90 GLY CA   1 1 
        1  1322 1 1  90 GLY H    H  -1.860   1.162 -12.791 1.00 . A A .  90 GLY H    1 1 
        1  1323 1 1  90 GLY HA2  H  -0.903   3.529 -14.194 1.00 . A A .  90 GLY HA2  1 1 
        1  1324 1 1  90 GLY HA3  H  -1.301   3.738 -12.495 1.00 . A A .  90 GLY HA3  1 1 
        1  1325 1 1  90 GLY N    N  -1.962   1.972 -13.340 1.00 . A A .  90 GLY N    1 1 
        1  1326 1 1  90 GLY O    O   0.617   1.286 -12.837 1.00 . A A .  90 GLY O    1 1 
        1  1327 1 1  91 LEU C    C   3.079   3.824 -10.924 1.00 . A A .  91 LEU C    1 1 
        1  1328 1 1  91 LEU CA   C   2.655   3.041 -12.161 1.00 . A A .  91 LEU CA   1 1 
        1  1329 1 1  91 LEU CB   C   3.614   3.330 -13.321 1.00 . A A .  91 LEU CB   1 1 
        1  1330 1 1  91 LEU CD1  C   5.245   1.460 -12.940 1.00 . A A .  91 LEU CD1  1 1 
        1  1331 1 1  91 LEU CD2  C   5.953   3.499 -14.203 1.00 . A A .  91 LEU CD2  1 1 
        1  1332 1 1  91 LEU CG   C   5.080   2.964 -13.079 1.00 . A A .  91 LEU CG   1 1 
        1  1333 1 1  91 LEU H    H   1.051   4.362 -12.561 1.00 . A A .  91 LEU H    1 1 
        1  1334 1 1  91 LEU HA   H   2.670   1.985 -11.936 1.00 . A A .  91 LEU HA   1 1 
        1  1335 1 1  91 LEU HB2  H   3.268   2.785 -14.188 1.00 . A A .  91 LEU HB2  1 1 
        1  1336 1 1  91 LEU HB3  H   3.565   4.386 -13.541 1.00 . A A .  91 LEU HB3  1 1 
        1  1337 1 1  91 LEU HD11 H   4.652   1.109 -12.108 1.00 . A A .  91 LEU HD11 1 1 
        1  1338 1 1  91 LEU HD12 H   6.285   1.229 -12.763 1.00 . A A .  91 LEU HD12 1 1 
        1  1339 1 1  91 LEU HD13 H   4.916   0.975 -13.847 1.00 . A A .  91 LEU HD13 1 1 
        1  1340 1 1  91 LEU HD21 H   6.980   3.210 -14.031 1.00 . A A .  91 LEU HD21 1 1 
        1  1341 1 1  91 LEU HD22 H   5.883   4.577 -14.230 1.00 . A A .  91 LEU HD22 1 1 
        1  1342 1 1  91 LEU HD23 H   5.618   3.093 -15.147 1.00 . A A .  91 LEU HD23 1 1 
        1  1343 1 1  91 LEU HG   H   5.407   3.420 -12.155 1.00 . A A .  91 LEU HG   1 1 
        1  1344 1 1  91 LEU N    N   1.300   3.407 -12.539 1.00 . A A .  91 LEU N    1 1 
        1  1345 1 1  91 LEU O    O   2.768   5.010 -10.800 1.00 . A A .  91 LEU O    1 1 
        1  1346 1 1  92 THR C    C   5.702   4.299  -9.018 1.00 . A A .  92 THR C    1 1 
        1  1347 1 1  92 THR CA   C   4.262   3.830  -8.813 1.00 . A A .  92 THR CA   1 1 
        1  1348 1 1  92 THR CB   C   4.197   2.898  -7.585 1.00 . A A .  92 THR CB   1 1 
        1  1349 1 1  92 THR CG2  C   2.754   2.608  -7.197 1.00 . A A .  92 THR CG2  1 1 
        1  1350 1 1  92 THR H    H   3.936   2.204 -10.125 1.00 . A A .  92 THR H    1 1 
        1  1351 1 1  92 THR HA   H   3.635   4.690  -8.623 1.00 . A A .  92 THR HA   1 1 
        1  1352 1 1  92 THR HB   H   4.686   3.387  -6.755 1.00 . A A .  92 THR HB   1 1 
        1  1353 1 1  92 THR HG1  H   5.576   1.528  -7.214 1.00 . A A .  92 THR HG1  1 1 
        1  1354 1 1  92 THR HG21 H   2.248   2.133  -8.024 1.00 . A A .  92 THR HG21 1 1 
        1  1355 1 1  92 THR HG22 H   2.254   3.533  -6.952 1.00 . A A .  92 THR HG22 1 1 
        1  1356 1 1  92 THR HG23 H   2.738   1.951  -6.339 1.00 . A A .  92 THR HG23 1 1 
        1  1357 1 1  92 THR N    N   3.764   3.164 -10.004 1.00 . A A .  92 THR N    1 1 
        1  1358 1 1  92 THR O    O   6.487   3.641  -9.703 1.00 . A A .  92 THR O    1 1 
        1  1359 1 1  92 THR OG1  O   4.874   1.665  -7.866 1.00 . A A .  92 THR OG1  1 1 
        1  1360 1 1  93 PRO C    C   8.213   5.505  -7.244 1.00 . A A .  93 PRO C    1 1 
        1  1361 1 1  93 PRO CA   C   7.424   5.958  -8.471 1.00 . A A .  93 PRO CA   1 1 
        1  1362 1 1  93 PRO CB   C   7.223   7.470  -8.458 1.00 . A A .  93 PRO CB   1 1 
        1  1363 1 1  93 PRO CD   C   5.145   6.410  -7.799 1.00 . A A .  93 PRO CD   1 1 
        1  1364 1 1  93 PRO CG   C   5.957   7.682  -7.689 1.00 . A A .  93 PRO CG   1 1 
        1  1365 1 1  93 PRO HA   H   7.947   5.667  -9.368 1.00 . A A .  93 PRO HA   1 1 
        1  1366 1 1  93 PRO HB2  H   8.064   7.944  -7.972 1.00 . A A .  93 PRO HB2  1 1 
        1  1367 1 1  93 PRO HB3  H   7.134   7.834  -9.471 1.00 . A A .  93 PRO HB3  1 1 
        1  1368 1 1  93 PRO HD2  H   4.866   6.055  -6.819 1.00 . A A .  93 PRO HD2  1 1 
        1  1369 1 1  93 PRO HD3  H   4.266   6.577  -8.404 1.00 . A A .  93 PRO HD3  1 1 
        1  1370 1 1  93 PRO HG2  H   6.190   7.883  -6.654 1.00 . A A .  93 PRO HG2  1 1 
        1  1371 1 1  93 PRO HG3  H   5.408   8.510  -8.114 1.00 . A A .  93 PRO HG3  1 1 
        1  1372 1 1  93 PRO N    N   6.057   5.461  -8.457 1.00 . A A .  93 PRO N    1 1 
        1  1373 1 1  93 PRO O    O   7.650   4.942  -6.302 1.00 . A A .  93 PRO O    1 1 
        1  1374 1 1  94 SER C    C  10.583   6.597  -5.240 1.00 . A A .  94 SER C    1 1 
        1  1375 1 1  94 SER CA   C  10.362   5.386  -6.139 1.00 . A A .  94 SER CA   1 1 
        1  1376 1 1  94 SER CB   C  11.704   4.841  -6.639 1.00 . A A .  94 SER CB   1 1 
        1  1377 1 1  94 SER H    H   9.916   6.185  -8.045 1.00 . A A .  94 SER H    1 1 
        1  1378 1 1  94 SER HA   H   9.858   4.617  -5.572 1.00 . A A .  94 SER HA   1 1 
        1  1379 1 1  94 SER HB2  H  11.531   4.155  -7.455 1.00 . A A .  94 SER HB2  1 1 
        1  1380 1 1  94 SER HB3  H  12.315   5.662  -6.982 1.00 . A A .  94 SER HB3  1 1 
        1  1381 1 1  94 SER HG   H  11.808   3.493  -5.211 1.00 . A A .  94 SER HG   1 1 
        1  1382 1 1  94 SER N    N   9.514   5.747  -7.259 1.00 . A A .  94 SER N    1 1 
        1  1383 1 1  94 SER O    O  10.693   7.726  -5.720 1.00 . A A .  94 SER O    1 1 
        1  1384 1 1  94 SER OG   O  12.400   4.155  -5.606 1.00 . A A .  94 SER OG   1 1 
        1  1385 1 1  95 GLY C    C  11.165   6.872  -1.613 1.00 . A A .  95 GLY C    1 1 
        1  1386 1 1  95 GLY CA   C  10.841   7.419  -2.985 1.00 . A A .  95 GLY CA   1 1 
        1  1387 1 1  95 GLY H    H  10.523   5.433  -3.625 1.00 . A A .  95 GLY H    1 1 
        1  1388 1 1  95 GLY HA2  H  11.659   8.038  -3.323 1.00 . A A .  95 GLY HA2  1 1 
        1  1389 1 1  95 GLY HA3  H   9.945   8.020  -2.922 1.00 . A A .  95 GLY HA3  1 1 
        1  1390 1 1  95 GLY N    N  10.629   6.353  -3.941 1.00 . A A .  95 GLY N    1 1 
        1  1391 1 1  95 GLY O    O  10.764   5.757  -1.285 1.00 . A A .  95 GLY O    1 1 
        1  1392 1 1  96 LYS C    C  11.238   7.524   1.550 1.00 . A A .  96 LYS C    1 1 
        1  1393 1 1  96 LYS CA   C  12.307   7.204   0.511 1.00 . A A .  96 LYS CA   1 1 
        1  1394 1 1  96 LYS CB   C  13.621   7.884   0.901 1.00 . A A .  96 LYS CB   1 1 
        1  1395 1 1  96 LYS CD   C  15.208   6.212  -0.128 1.00 . A A .  96 LYS CD   1 1 
        1  1396 1 1  96 LYS CE   C  16.409   6.031  -1.045 1.00 . A A .  96 LYS CE   1 1 
        1  1397 1 1  96 LYS CG   C  14.754   7.665  -0.092 1.00 . A A .  96 LYS CG   1 1 
        1  1398 1 1  96 LYS H    H  12.118   8.558  -1.109 1.00 . A A .  96 LYS H    1 1 
        1  1399 1 1  96 LYS HA   H  12.458   6.136   0.476 1.00 . A A .  96 LYS HA   1 1 
        1  1400 1 1  96 LYS HB2  H  13.448   8.947   0.985 1.00 . A A .  96 LYS HB2  1 1 
        1  1401 1 1  96 LYS HB3  H  13.936   7.505   1.863 1.00 . A A .  96 LYS HB3  1 1 
        1  1402 1 1  96 LYS HD2  H  15.482   5.903   0.871 1.00 . A A .  96 LYS HD2  1 1 
        1  1403 1 1  96 LYS HD3  H  14.395   5.597  -0.487 1.00 . A A .  96 LYS HD3  1 1 
        1  1404 1 1  96 LYS HE2  H  16.100   6.224  -2.062 1.00 . A A .  96 LYS HE2  1 1 
        1  1405 1 1  96 LYS HE3  H  17.172   6.741  -0.762 1.00 . A A .  96 LYS HE3  1 1 
        1  1406 1 1  96 LYS HG2  H  14.413   7.947  -1.076 1.00 . A A .  96 LYS HG2  1 1 
        1  1407 1 1  96 LYS HG3  H  15.591   8.286   0.192 1.00 . A A .  96 LYS HG3  1 1 
        1  1408 1 1  96 LYS HZ1  H  17.893   4.621  -1.451 1.00 . A A .  96 LYS HZ1  1 1 
        1  1409 1 1  96 LYS HZ2  H  16.330   3.976  -1.427 1.00 . A A .  96 LYS HZ2  1 1 
        1  1410 1 1  96 LYS HZ3  H  17.103   4.382   0.030 1.00 . A A .  96 LYS HZ3  1 1 
        1  1411 1 1  96 LYS N    N  11.882   7.648  -0.812 1.00 . A A .  96 LYS N    1 1 
        1  1412 1 1  96 LYS NZ   N  16.971   4.659  -0.966 1.00 . A A .  96 LYS NZ   1 1 
        1  1413 1 1  96 LYS O    O  10.746   8.651   1.612 1.00 . A A .  96 LYS O    1 1 
        1  1414 1 1  97 ALA C    C  10.141   5.827   4.586 1.00 . A A .  97 ALA C    1 1 
        1  1415 1 1  97 ALA CA   C   9.863   6.714   3.380 1.00 . A A .  97 ALA CA   1 1 
        1  1416 1 1  97 ALA CB   C   8.487   6.407   2.805 1.00 . A A .  97 ALA CB   1 1 
        1  1417 1 1  97 ALA H    H  11.316   5.657   2.267 1.00 . A A .  97 ALA H    1 1 
        1  1418 1 1  97 ALA HA   H   9.878   7.747   3.690 1.00 . A A .  97 ALA HA   1 1 
        1  1419 1 1  97 ALA HB1  H   8.302   7.046   1.954 1.00 . A A .  97 ALA HB1  1 1 
        1  1420 1 1  97 ALA HB2  H   7.735   6.585   3.559 1.00 . A A .  97 ALA HB2  1 1 
        1  1421 1 1  97 ALA HB3  H   8.449   5.373   2.494 1.00 . A A .  97 ALA HB3  1 1 
        1  1422 1 1  97 ALA N    N  10.883   6.535   2.358 1.00 . A A .  97 ALA N    1 1 
        1  1423 1 1  97 ALA O    O  10.944   4.895   4.511 1.00 . A A .  97 ALA O    1 1 
        1  1424 1 1  98 ALA C    C   8.635   4.125   6.791 1.00 . A A .  98 ALA C    1 1 
        1  1425 1 1  98 ALA CA   C   9.608   5.283   6.884 1.00 . A A .  98 ALA CA   1 1 
        1  1426 1 1  98 ALA CB   C   9.368   6.082   8.156 1.00 . A A .  98 ALA CB   1 1 
        1  1427 1 1  98 ALA H    H   8.903   6.907   5.725 1.00 . A A .  98 ALA H    1 1 
        1  1428 1 1  98 ALA HA   H  10.616   4.892   6.914 1.00 . A A .  98 ALA HA   1 1 
        1  1429 1 1  98 ALA HB1  H   9.514   5.444   9.017 1.00 . A A .  98 ALA HB1  1 1 
        1  1430 1 1  98 ALA HB2  H   8.360   6.466   8.160 1.00 . A A .  98 ALA HB2  1 1 
        1  1431 1 1  98 ALA HB3  H  10.068   6.905   8.200 1.00 . A A .  98 ALA HB3  1 1 
        1  1432 1 1  98 ALA N    N   9.487   6.119   5.702 1.00 . A A .  98 ALA N    1 1 
        1  1433 1 1  98 ALA O    O   7.416   4.329   6.714 1.00 . A A .  98 ALA O    1 1 
        1  1434 1 1  99 SER C    C   8.835   0.731   7.749 1.00 . A A .  99 SER C    1 1 
        1  1435 1 1  99 SER CA   C   8.404   1.709   6.664 1.00 . A A .  99 SER CA   1 1 
        1  1436 1 1  99 SER CB   C   8.597   1.093   5.267 1.00 . A A .  99 SER CB   1 1 
        1  1437 1 1  99 SER H    H  10.165   2.846   6.858 1.00 . A A .  99 SER H    1 1 
        1  1438 1 1  99 SER HA   H   7.363   1.961   6.805 1.00 . A A .  99 SER HA   1 1 
        1  1439 1 1  99 SER HB2  H   8.290   1.807   4.518 1.00 . A A .  99 SER HB2  1 1 
        1  1440 1 1  99 SER HB3  H   9.642   0.856   5.126 1.00 . A A .  99 SER HB3  1 1 
        1  1441 1 1  99 SER HG   H   8.340  -0.852   5.435 1.00 . A A .  99 SER HG   1 1 
        1  1442 1 1  99 SER N    N   9.186   2.923   6.777 1.00 . A A .  99 SER N    1 1 
        1  1443 1 1  99 SER O    O   9.993   0.727   8.166 1.00 . A A .  99 SER O    1 1 
        1  1444 1 1  99 SER OG   O   7.833  -0.094   5.096 1.00 . A A .  99 SER OG   1 1 
        1  1445 1 1 100 SER C    C   7.191  -2.231   9.053 1.00 . A A . 100 SER C    1 1 
        1  1446 1 1 100 SER CA   C   8.190  -1.098   9.207 1.00 . A A . 100 SER CA   1 1 
        1  1447 1 1 100 SER CB   C   8.146  -0.536  10.631 1.00 . A A . 100 SER CB   1 1 
        1  1448 1 1 100 SER H    H   6.967   0.071   7.942 1.00 . A A . 100 SER H    1 1 
        1  1449 1 1 100 SER HA   H   9.182  -1.475   9.005 1.00 . A A . 100 SER HA   1 1 
        1  1450 1 1 100 SER HB2  H   7.166  -0.129  10.828 1.00 . A A . 100 SER HB2  1 1 
        1  1451 1 1 100 SER HB3  H   8.356  -1.326  11.337 1.00 . A A . 100 SER HB3  1 1 
        1  1452 1 1 100 SER HG   H   9.516   0.676   9.939 1.00 . A A . 100 SER HG   1 1 
        1  1453 1 1 100 SER N    N   7.896  -0.057   8.236 1.00 . A A . 100 SER N    1 1 
        1  1454 1 1 100 SER O    O   5.989  -1.993   8.953 1.00 . A A . 100 SER O    1 1 
        1  1455 1 1 100 SER OG   O   9.106   0.493  10.794 1.00 . A A . 100 SER OG   1 1 
        1  1456 1 1 101 LEU C    C   6.148  -5.020  10.126 1.00 . A A . 101 LEU C    1 1 
        1  1457 1 1 101 LEU CA   C   6.794  -4.590   8.820 1.00 . A A . 101 LEU CA   1 1 
        1  1458 1 1 101 LEU CB   C   7.507  -5.765   8.146 1.00 . A A . 101 LEU CB   1 1 
        1  1459 1 1 101 LEU CD1  C   9.408  -6.184   9.759 1.00 . A A . 101 LEU CD1  1 1 
        1  1460 1 1 101 LEU CD2  C   9.590  -6.871   7.365 1.00 . A A . 101 LEU CD2  1 1 
        1  1461 1 1 101 LEU CG   C   9.026  -5.844   8.325 1.00 . A A . 101 LEU CG   1 1 
        1  1462 1 1 101 LEU H    H   8.640  -3.604   9.111 1.00 . A A . 101 LEU H    1 1 
        1  1463 1 1 101 LEU HA   H   6.006  -4.257   8.160 1.00 . A A . 101 LEU HA   1 1 
        1  1464 1 1 101 LEU HB2  H   7.079  -6.677   8.532 1.00 . A A . 101 LEU HB2  1 1 
        1  1465 1 1 101 LEU HB3  H   7.299  -5.717   7.087 1.00 . A A . 101 LEU HB3  1 1 
        1  1466 1 1 101 LEU HD11 H   9.055  -7.176   9.999 1.00 . A A . 101 LEU HD11 1 1 
        1  1467 1 1 101 LEU HD12 H   8.956  -5.469  10.431 1.00 . A A . 101 LEU HD12 1 1 
        1  1468 1 1 101 LEU HD13 H  10.483  -6.148   9.865 1.00 . A A . 101 LEU HD13 1 1 
        1  1469 1 1 101 LEU HD21 H  10.655  -6.947   7.504 1.00 . A A . 101 LEU HD21 1 1 
        1  1470 1 1 101 LEU HD22 H   9.375  -6.567   6.351 1.00 . A A . 101 LEU HD22 1 1 
        1  1471 1 1 101 LEU HD23 H   9.129  -7.828   7.559 1.00 . A A . 101 LEU HD23 1 1 
        1  1472 1 1 101 LEU HG   H   9.462  -4.887   8.081 1.00 . A A . 101 LEU HG   1 1 
        1  1473 1 1 101 LEU N    N   7.677  -3.457   9.007 1.00 . A A . 101 LEU N    1 1 
        1  1474 1 1 101 LEU O    O   6.812  -5.417  11.082 1.00 . A A . 101 LEU O    1 1 
        1  1475 1 1 102 TYR C    C   3.735  -6.823  11.112 1.00 . A A . 102 TYR C    1 1 
        1  1476 1 1 102 TYR CA   C   4.049  -5.344  11.280 1.00 . A A . 102 TYR CA   1 1 
        1  1477 1 1 102 TYR CB   C   2.760  -4.516  11.365 1.00 . A A . 102 TYR CB   1 1 
        1  1478 1 1 102 TYR CD1  C   2.430  -3.968  13.805 1.00 . A A . 102 TYR CD1  1 1 
        1  1479 1 1 102 TYR CD2  C   0.888  -5.464  12.774 1.00 . A A . 102 TYR CD2  1 1 
        1  1480 1 1 102 TYR CE1  C   1.749  -4.082  15.002 1.00 . A A . 102 TYR CE1  1 1 
        1  1481 1 1 102 TYR CE2  C   0.201  -5.584  13.967 1.00 . A A . 102 TYR CE2  1 1 
        1  1482 1 1 102 TYR CG   C   2.013  -4.656  12.673 1.00 . A A . 102 TYR CG   1 1 
        1  1483 1 1 102 TYR CZ   C   0.636  -4.892  15.077 1.00 . A A . 102 TYR CZ   1 1 
        1  1484 1 1 102 TYR H    H   4.386  -4.535   9.362 1.00 . A A . 102 TYR H    1 1 
        1  1485 1 1 102 TYR HA   H   4.632  -5.202  12.176 1.00 . A A . 102 TYR HA   1 1 
        1  1486 1 1 102 TYR HB2  H   3.005  -3.473  11.237 1.00 . A A . 102 TYR HB2  1 1 
        1  1487 1 1 102 TYR HB3  H   2.095  -4.822  10.570 1.00 . A A . 102 TYR HB3  1 1 
        1  1488 1 1 102 TYR HD1  H   3.303  -3.336  13.743 1.00 . A A . 102 TYR HD1  1 1 
        1  1489 1 1 102 TYR HD2  H   0.550  -6.006  11.903 1.00 . A A . 102 TYR HD2  1 1 
        1  1490 1 1 102 TYR HE1  H   2.089  -3.538  15.871 1.00 . A A . 102 TYR HE1  1 1 
        1  1491 1 1 102 TYR HE2  H  -0.671  -6.218  14.026 1.00 . A A . 102 TYR HE2  1 1 
        1  1492 1 1 102 TYR HH   H  -0.180  -4.139  16.649 1.00 . A A . 102 TYR HH   1 1 
        1  1493 1 1 102 TYR N    N   4.840  -4.913  10.148 1.00 . A A . 102 TYR N    1 1 
        1  1494 1 1 102 TYR O    O   2.861  -7.194  10.330 1.00 . A A . 102 TYR O    1 1 
        1  1495 1 1 102 TYR OH   O  -0.045  -5.011  16.268 1.00 . A A . 102 TYR OH   1 1 
        1  1496 1 1 103 ILE C    C   3.724  -9.680  12.930 1.00 . A A . 103 ILE C    1 1 
        1  1497 1 1 103 ILE CA   C   4.350  -9.097  11.673 1.00 . A A . 103 ILE CA   1 1 
        1  1498 1 1 103 ILE CB   C   5.711  -9.780  11.408 1.00 . A A . 103 ILE CB   1 1 
        1  1499 1 1 103 ILE CD1  C   7.746  -9.743   9.868 1.00 . A A . 103 ILE CD1  1 1 
        1  1500 1 1 103 ILE CG1  C   6.384  -9.159  10.179 1.00 . A A . 103 ILE CG1  1 1 
        1  1501 1 1 103 ILE CG2  C   5.523 -11.279  11.210 1.00 . A A . 103 ILE CG2  1 1 
        1  1502 1 1 103 ILE H    H   5.170  -7.299  12.410 1.00 . A A . 103 ILE H    1 1 
        1  1503 1 1 103 ILE HA   H   3.701  -9.296  10.833 1.00 . A A . 103 ILE HA   1 1 
        1  1504 1 1 103 ILE HB   H   6.341  -9.630  12.272 1.00 . A A . 103 ILE HB   1 1 
        1  1505 1 1 103 ILE HD11 H   7.653 -10.808   9.715 1.00 . A A . 103 ILE HD11 1 1 
        1  1506 1 1 103 ILE HD12 H   8.416  -9.553  10.693 1.00 . A A . 103 ILE HD12 1 1 
        1  1507 1 1 103 ILE HD13 H   8.137  -9.284   8.972 1.00 . A A . 103 ILE HD13 1 1 
        1  1508 1 1 103 ILE HG12 H   5.755  -9.311   9.315 1.00 . A A . 103 ILE HG12 1 1 
        1  1509 1 1 103 ILE HG13 H   6.508  -8.098  10.344 1.00 . A A . 103 ILE HG13 1 1 
        1  1510 1 1 103 ILE HG21 H   6.484 -11.743  11.043 1.00 . A A . 103 ILE HG21 1 1 
        1  1511 1 1 103 ILE HG22 H   4.886 -11.452  10.355 1.00 . A A . 103 ILE HG22 1 1 
        1  1512 1 1 103 ILE HG23 H   5.066 -11.703  12.091 1.00 . A A . 103 ILE HG23 1 1 
        1  1513 1 1 103 ILE N    N   4.495  -7.658  11.798 1.00 . A A . 103 ILE N    1 1 
        1  1514 1 1 103 ILE O    O   4.289  -9.583  14.022 1.00 . A A . 103 ILE O    1 1 
        1  1515 1 1 104 GLY C    C   0.409 -10.486  13.953 1.00 . A A . 104 GLY C    1 1 
        1  1516 1 1 104 GLY CA   C   1.870 -10.871  13.894 1.00 . A A . 104 GLY CA   1 1 
        1  1517 1 1 104 GLY H    H   2.128 -10.271  11.883 1.00 . A A . 104 GLY H    1 1 
        1  1518 1 1 104 GLY HA2  H   1.948 -11.945  13.808 1.00 . A A . 104 GLY HA2  1 1 
        1  1519 1 1 104 GLY HA3  H   2.351 -10.557  14.808 1.00 . A A . 104 GLY HA3  1 1 
        1  1520 1 1 104 GLY N    N   2.549 -10.263  12.774 1.00 . A A . 104 GLY N    1 1 
        1  1521 1 1 104 GLY O    O  -0.137  -9.986  12.969 1.00 . A A . 104 GLY O    1 1 
        1  1522 1 1 105 PRO C    C  -1.883  -8.849  15.205 1.00 . A A . 105 PRO C    1 1 
        1  1523 1 1 105 PRO CA   C  -1.663 -10.356  15.282 1.00 . A A . 105 PRO CA   1 1 
        1  1524 1 1 105 PRO CB   C  -1.988 -10.874  16.687 1.00 . A A . 105 PRO CB   1 1 
        1  1525 1 1 105 PRO CD   C   0.327 -11.320  16.308 1.00 . A A . 105 PRO CD   1 1 
        1  1526 1 1 105 PRO CG   C  -0.670 -10.975  17.376 1.00 . A A . 105 PRO CG   1 1 
        1  1527 1 1 105 PRO HA   H  -2.292 -10.851  14.557 1.00 . A A . 105 PRO HA   1 1 
        1  1528 1 1 105 PRO HB2  H  -2.643 -10.175  17.186 1.00 . A A . 105 PRO HB2  1 1 
        1  1529 1 1 105 PRO HB3  H  -2.470 -11.838  16.616 1.00 . A A . 105 PRO HB3  1 1 
        1  1530 1 1 105 PRO HD2  H   1.291 -10.888  16.537 1.00 . A A . 105 PRO HD2  1 1 
        1  1531 1 1 105 PRO HD3  H   0.407 -12.391  16.199 1.00 . A A . 105 PRO HD3  1 1 
        1  1532 1 1 105 PRO HG2  H  -0.420 -10.028  17.831 1.00 . A A . 105 PRO HG2  1 1 
        1  1533 1 1 105 PRO HG3  H  -0.704 -11.754  18.122 1.00 . A A . 105 PRO HG3  1 1 
        1  1534 1 1 105 PRO N    N  -0.251 -10.710  15.100 1.00 . A A . 105 PRO N    1 1 
        1  1535 1 1 105 PRO O    O  -0.957  -8.068  15.420 1.00 . A A . 105 PRO O    1 1 
        1  1536 1 1 106 TYR C    C  -3.975  -6.436  16.043 1.00 . A A . 106 TYR C    1 1 
        1  1537 1 1 106 TYR CA   C  -3.423  -7.033  14.754 1.00 . A A . 106 TYR CA   1 1 
        1  1538 1 1 106 TYR CB   C  -4.424  -6.827  13.614 1.00 . A A . 106 TYR CB   1 1 
        1  1539 1 1 106 TYR CD1  C  -3.275  -5.815  11.606 1.00 . A A . 106 TYR CD1  1 1 
        1  1540 1 1 106 TYR CD2  C  -3.806  -8.139  11.539 1.00 . A A . 106 TYR CD2  1 1 
        1  1541 1 1 106 TYR CE1  C  -2.736  -5.895  10.335 1.00 . A A . 106 TYR CE1  1 1 
        1  1542 1 1 106 TYR CE2  C  -3.265  -8.228  10.269 1.00 . A A . 106 TYR CE2  1 1 
        1  1543 1 1 106 TYR CG   C  -3.820  -6.932  12.230 1.00 . A A . 106 TYR CG   1 1 
        1  1544 1 1 106 TYR CZ   C  -2.732  -7.105   9.672 1.00 . A A . 106 TYR CZ   1 1 
        1  1545 1 1 106 TYR H    H  -3.831  -9.110  14.836 1.00 . A A . 106 TYR H    1 1 
        1  1546 1 1 106 TYR HA   H  -2.505  -6.522  14.505 1.00 . A A . 106 TYR HA   1 1 
        1  1547 1 1 106 TYR HB2  H  -5.202  -7.572  13.691 1.00 . A A . 106 TYR HB2  1 1 
        1  1548 1 1 106 TYR HB3  H  -4.866  -5.846  13.710 1.00 . A A . 106 TYR HB3  1 1 
        1  1549 1 1 106 TYR HD1  H  -3.278  -4.871  12.130 1.00 . A A . 106 TYR HD1  1 1 
        1  1550 1 1 106 TYR HD2  H  -4.224  -9.019  12.010 1.00 . A A . 106 TYR HD2  1 1 
        1  1551 1 1 106 TYR HE1  H  -2.319  -5.012   9.869 1.00 . A A . 106 TYR HE1  1 1 
        1  1552 1 1 106 TYR HE2  H  -3.262  -9.172   9.749 1.00 . A A . 106 TYR HE2  1 1 
        1  1553 1 1 106 TYR HH   H  -1.344  -6.756   8.379 1.00 . A A . 106 TYR HH   1 1 
        1  1554 1 1 106 TYR N    N  -3.110  -8.443  14.920 1.00 . A A . 106 TYR N    1 1 
        1  1555 1 1 106 TYR O    O  -4.170  -7.136  17.037 1.00 . A A . 106 TYR O    1 1 
        1  1556 1 1 106 TYR OH   O  -2.205  -7.192   8.404 1.00 . A A . 106 TYR OH   1 1 
        1  1557 1 1 107 GLY C    C  -4.791  -2.942  16.841 1.00 . A A . 107 GLY C    1 1 
        1  1558 1 1 107 GLY CA   C  -4.707  -4.414  17.160 1.00 . A A . 107 GLY CA   1 1 
        1  1559 1 1 107 GLY H    H  -4.043  -4.647  15.177 1.00 . A A . 107 GLY H    1 1 
        1  1560 1 1 107 GLY HA2  H  -5.690  -4.783  17.418 1.00 . A A . 107 GLY HA2  1 1 
        1  1561 1 1 107 GLY HA3  H  -4.037  -4.558  17.994 1.00 . A A . 107 GLY HA3  1 1 
        1  1562 1 1 107 GLY N    N  -4.207  -5.137  16.010 1.00 . A A . 107 GLY N    1 1 
        1  1563 1 1 107 GLY O    O  -5.189  -2.577  15.733 1.00 . A A . 107 GLY O    1 1 
        1  1564 1 1 108 GLU C    C  -3.086  -0.398  16.642 1.00 . A A . 108 GLU C    1 1 
        1  1565 1 1 108 GLU CA   C  -4.316  -0.671  17.499 1.00 . A A . 108 GLU CA   1 1 
        1  1566 1 1 108 GLU CB   C  -4.259   0.151  18.788 1.00 . A A . 108 GLU CB   1 1 
        1  1567 1 1 108 GLU CD   C  -5.464   0.913  20.864 1.00 . A A . 108 GLU CD   1 1 
        1  1568 1 1 108 GLU CG   C  -5.494   0.002  19.658 1.00 . A A . 108 GLU CG   1 1 
        1  1569 1 1 108 GLU H    H  -4.175  -2.429  18.676 1.00 . A A . 108 GLU H    1 1 
        1  1570 1 1 108 GLU HA   H  -5.196  -0.389  16.939 1.00 . A A . 108 GLU HA   1 1 
        1  1571 1 1 108 GLU HB2  H  -3.399  -0.158  19.365 1.00 . A A . 108 GLU HB2  1 1 
        1  1572 1 1 108 GLU HB3  H  -4.152   1.194  18.530 1.00 . A A . 108 GLU HB3  1 1 
        1  1573 1 1 108 GLU HG2  H  -6.365   0.241  19.067 1.00 . A A . 108 GLU HG2  1 1 
        1  1574 1 1 108 GLU HG3  H  -5.559  -1.021  19.998 1.00 . A A . 108 GLU HG3  1 1 
        1  1575 1 1 108 GLU N    N  -4.405  -2.094  17.779 1.00 . A A . 108 GLU N    1 1 
        1  1576 1 1 108 GLU O    O  -1.957  -0.382  17.136 1.00 . A A . 108 GLU O    1 1 
        1  1577 1 1 108 GLU OE1  O  -4.391   1.051  21.485 1.00 . A A . 108 GLU OE1  1 1 
        1  1578 1 1 108 GLU OE2  O  -6.521   1.475  21.219 1.00 . A A . 108 GLU OE2  1 1 
        1  1579 1 1 109 ILE C    C  -1.609   1.403  14.631 1.00 . A A . 109 ILE C    1 1 
        1  1580 1 1 109 ILE CA   C  -2.214   0.015  14.411 1.00 . A A . 109 ILE CA   1 1 
        1  1581 1 1 109 ILE CB   C  -2.692  -0.155  12.947 1.00 . A A . 109 ILE CB   1 1 
        1  1582 1 1 109 ILE CD1  C  -1.884  -0.441  10.541 1.00 . A A . 109 ILE CD1  1 1 
        1  1583 1 1 109 ILE CG1  C  -1.506  -0.120  11.973 1.00 . A A . 109 ILE CG1  1 1 
        1  1584 1 1 109 ILE CG2  C  -3.716   0.914  12.589 1.00 . A A . 109 ILE CG2  1 1 
        1  1585 1 1 109 ILE H    H  -4.229  -0.225  15.015 1.00 . A A . 109 ILE H    1 1 
        1  1586 1 1 109 ILE HA   H  -1.454  -0.727  14.608 1.00 . A A . 109 ILE HA   1 1 
        1  1587 1 1 109 ILE HB   H  -3.180  -1.115  12.868 1.00 . A A . 109 ILE HB   1 1 
        1  1588 1 1 109 ILE HD11 H  -2.311  -1.432  10.494 1.00 . A A . 109 ILE HD11 1 1 
        1  1589 1 1 109 ILE HD12 H  -1.004  -0.398   9.918 1.00 . A A . 109 ILE HD12 1 1 
        1  1590 1 1 109 ILE HD13 H  -2.610   0.279  10.190 1.00 . A A . 109 ILE HD13 1 1 
        1  1591 1 1 109 ILE HG12 H  -1.068   0.866  11.986 1.00 . A A . 109 ILE HG12 1 1 
        1  1592 1 1 109 ILE HG13 H  -0.767  -0.841  12.292 1.00 . A A . 109 ILE HG13 1 1 
        1  1593 1 1 109 ILE HG21 H  -3.270   1.891  12.700 1.00 . A A . 109 ILE HG21 1 1 
        1  1594 1 1 109 ILE HG22 H  -4.568   0.831  13.249 1.00 . A A . 109 ILE HG22 1 1 
        1  1595 1 1 109 ILE HG23 H  -4.037   0.778  11.567 1.00 . A A . 109 ILE HG23 1 1 
        1  1596 1 1 109 ILE N    N  -3.306  -0.211  15.349 1.00 . A A . 109 ILE N    1 1 
        1  1597 1 1 109 ILE O    O  -0.530   1.720  14.136 1.00 . A A . 109 ILE O    1 1 
        1  1598 1 1 110 GLU C    C  -0.516   3.466  16.528 1.00 . A A . 110 GLU C    1 1 
        1  1599 1 1 110 GLU CA   C  -1.843   3.541  15.775 1.00 . A A . 110 GLU CA   1 1 
        1  1600 1 1 110 GLU CB   C  -2.888   4.246  16.645 1.00 . A A . 110 GLU CB   1 1 
        1  1601 1 1 110 GLU CD   C  -5.012   3.161  15.760 1.00 . A A . 110 GLU CD   1 1 
        1  1602 1 1 110 GLU CG   C  -4.241   4.447  15.972 1.00 . A A . 110 GLU CG   1 1 
        1  1603 1 1 110 GLU H    H  -3.163   1.895  15.775 1.00 . A A . 110 GLU H    1 1 
        1  1604 1 1 110 GLU HA   H  -1.702   4.103  14.864 1.00 . A A . 110 GLU HA   1 1 
        1  1605 1 1 110 GLU HB2  H  -3.042   3.660  17.539 1.00 . A A . 110 GLU HB2  1 1 
        1  1606 1 1 110 GLU HB3  H  -2.504   5.216  16.927 1.00 . A A . 110 GLU HB3  1 1 
        1  1607 1 1 110 GLU HG2  H  -4.838   5.103  16.589 1.00 . A A . 110 GLU HG2  1 1 
        1  1608 1 1 110 GLU HG3  H  -4.080   4.914  15.011 1.00 . A A . 110 GLU HG3  1 1 
        1  1609 1 1 110 GLU N    N  -2.303   2.209  15.419 1.00 . A A . 110 GLU N    1 1 
        1  1610 1 1 110 GLU O    O   0.330   4.358  16.417 1.00 . A A . 110 GLU O    1 1 
        1  1611 1 1 110 GLU OE1  O  -5.220   2.430  16.740 1.00 . A A . 110 GLU OE1  1 1 
        1  1612 1 1 110 GLU OE2  O  -5.410   2.883  14.609 1.00 . A A . 110 GLU OE2  1 1 
        1  1613 1 1 111 ALA C    C   2.123   2.182  17.245 1.00 . A A . 111 ALA C    1 1 
        1  1614 1 1 111 ALA CA   C   0.855   2.182  18.093 1.00 . A A . 111 ALA CA   1 1 
        1  1615 1 1 111 ALA CB   C   0.747   0.884  18.879 1.00 . A A . 111 ALA CB   1 1 
        1  1616 1 1 111 ALA H    H  -1.032   1.684  17.278 1.00 . A A . 111 ALA H    1 1 
        1  1617 1 1 111 ALA HA   H   0.910   2.996  18.800 1.00 . A A . 111 ALA HA   1 1 
        1  1618 1 1 111 ALA HB1  H   0.710   0.050  18.194 1.00 . A A . 111 ALA HB1  1 1 
        1  1619 1 1 111 ALA HB2  H  -0.151   0.899  19.477 1.00 . A A . 111 ALA HB2  1 1 
        1  1620 1 1 111 ALA HB3  H   1.607   0.780  19.525 1.00 . A A . 111 ALA HB3  1 1 
        1  1621 1 1 111 ALA N    N  -0.338   2.379  17.277 1.00 . A A . 111 ALA N    1 1 
        1  1622 1 1 111 ALA O    O   3.164   2.682  17.673 1.00 . A A . 111 ALA O    1 1 
        1  1623 1 1 112 VAL C    C   3.400   2.908  14.452 1.00 . A A . 112 VAL C    1 1 
        1  1624 1 1 112 VAL CA   C   3.195   1.568  15.161 1.00 . A A . 112 VAL CA   1 1 
        1  1625 1 1 112 VAL CB   C   3.090   0.411  14.131 1.00 . A A . 112 VAL CB   1 1 
        1  1626 1 1 112 VAL CG1  C   2.068   0.709  13.046 1.00 . A A . 112 VAL CG1  1 1 
        1  1627 1 1 112 VAL CG2  C   4.450   0.109  13.520 1.00 . A A . 112 VAL CG2  1 1 
        1  1628 1 1 112 VAL H    H   1.172   1.283  15.729 1.00 . A A . 112 VAL H    1 1 
        1  1629 1 1 112 VAL HA   H   4.057   1.381  15.787 1.00 . A A . 112 VAL HA   1 1 
        1  1630 1 1 112 VAL HB   H   2.763  -0.474  14.659 1.00 . A A . 112 VAL HB   1 1 
        1  1631 1 1 112 VAL HG11 H   1.102   0.875  13.497 1.00 . A A . 112 VAL HG11 1 1 
        1  1632 1 1 112 VAL HG12 H   2.009  -0.129  12.369 1.00 . A A . 112 VAL HG12 1 1 
        1  1633 1 1 112 VAL HG13 H   2.368   1.591  12.501 1.00 . A A . 112 VAL HG13 1 1 
        1  1634 1 1 112 VAL HG21 H   4.351  -0.689  12.799 1.00 . A A . 112 VAL HG21 1 1 
        1  1635 1 1 112 VAL HG22 H   5.136  -0.192  14.297 1.00 . A A . 112 VAL HG22 1 1 
        1  1636 1 1 112 VAL HG23 H   4.828   0.993  13.028 1.00 . A A . 112 VAL HG23 1 1 
        1  1637 1 1 112 VAL N    N   2.034   1.635  16.037 1.00 . A A . 112 VAL N    1 1 
        1  1638 1 1 112 VAL O    O   4.526   3.280  14.129 1.00 . A A . 112 VAL O    1 1 
        1  1639 1 1 113 TYR C    C   3.200   5.893  14.567 1.00 . A A . 113 TYR C    1 1 
        1  1640 1 1 113 TYR CA   C   2.398   4.978  13.655 1.00 . A A . 113 TYR CA   1 1 
        1  1641 1 1 113 TYR CB   C   1.012   5.585  13.421 1.00 . A A . 113 TYR CB   1 1 
        1  1642 1 1 113 TYR CD1  C   0.725   4.767  11.046 1.00 . A A . 113 TYR CD1  1 1 
        1  1643 1 1 113 TYR CD2  C  -1.068   4.436  12.579 1.00 . A A . 113 TYR CD2  1 1 
        1  1644 1 1 113 TYR CE1  C  -0.015   4.167  10.044 1.00 . A A . 113 TYR CE1  1 1 
        1  1645 1 1 113 TYR CE2  C  -1.812   3.833  11.585 1.00 . A A . 113 TYR CE2  1 1 
        1  1646 1 1 113 TYR CG   C   0.211   4.911  12.329 1.00 . A A . 113 TYR CG   1 1 
        1  1647 1 1 113 TYR CZ   C  -1.283   3.701  10.320 1.00 . A A . 113 TYR CZ   1 1 
        1  1648 1 1 113 TYR H    H   1.432   3.286  14.489 1.00 . A A . 113 TYR H    1 1 
        1  1649 1 1 113 TYR HA   H   2.911   4.893  12.707 1.00 . A A . 113 TYR HA   1 1 
        1  1650 1 1 113 TYR HB2  H   0.442   5.517  14.335 1.00 . A A . 113 TYR HB2  1 1 
        1  1651 1 1 113 TYR HB3  H   1.127   6.626  13.153 1.00 . A A . 113 TYR HB3  1 1 
        1  1652 1 1 113 TYR HD1  H   1.720   5.132  10.835 1.00 . A A . 113 TYR HD1  1 1 
        1  1653 1 1 113 TYR HD2  H  -1.481   4.540  13.572 1.00 . A A . 113 TYR HD2  1 1 
        1  1654 1 1 113 TYR HE1  H   0.402   4.063   9.053 1.00 . A A . 113 TYR HE1  1 1 
        1  1655 1 1 113 TYR HE2  H  -2.805   3.467  11.802 1.00 . A A . 113 TYR HE2  1 1 
        1  1656 1 1 113 TYR HH   H  -1.492   2.476   8.844 1.00 . A A . 113 TYR HH   1 1 
        1  1657 1 1 113 TYR N    N   2.309   3.645  14.240 1.00 . A A . 113 TYR N    1 1 
        1  1658 1 1 113 TYR O    O   4.097   6.602  14.113 1.00 . A A . 113 TYR O    1 1 
        1  1659 1 1 113 TYR OH   O  -2.032   3.110   9.328 1.00 . A A . 113 TYR OH   1 1 
        1  1660 1 1 114 ASP C    C   5.081   6.348  16.867 1.00 . A A . 114 ASP C    1 1 
        1  1661 1 1 114 ASP CA   C   3.587   6.664  16.852 1.00 . A A . 114 ASP CA   1 1 
        1  1662 1 1 114 ASP CB   C   3.007   6.441  18.252 1.00 . A A . 114 ASP CB   1 1 
        1  1663 1 1 114 ASP CG   C   1.775   7.280  18.525 1.00 . A A . 114 ASP CG   1 1 
        1  1664 1 1 114 ASP H    H   2.132   5.278  16.151 1.00 . A A . 114 ASP H    1 1 
        1  1665 1 1 114 ASP HA   H   3.457   7.702  16.583 1.00 . A A . 114 ASP HA   1 1 
        1  1666 1 1 114 ASP HB2  H   2.738   5.401  18.359 1.00 . A A . 114 ASP HB2  1 1 
        1  1667 1 1 114 ASP HB3  H   3.758   6.690  18.987 1.00 . A A . 114 ASP HB3  1 1 
        1  1668 1 1 114 ASP N    N   2.878   5.857  15.858 1.00 . A A . 114 ASP N    1 1 
        1  1669 1 1 114 ASP O    O   5.908   7.238  17.077 1.00 . A A . 114 ASP O    1 1 
        1  1670 1 1 114 ASP OD1  O   1.923   8.430  18.993 1.00 . A A . 114 ASP OD1  1 1 
        1  1671 1 1 114 ASP OD2  O   0.654   6.792  18.293 1.00 . A A . 114 ASP OD2  1 1 
        1  1672 1 1 115 ALA C    C   7.576   5.256  15.461 1.00 . A A . 115 ALA C    1 1 
        1  1673 1 1 115 ALA CA   C   6.814   4.649  16.635 1.00 . A A . 115 ALA CA   1 1 
        1  1674 1 1 115 ALA CB   C   6.892   3.128  16.592 1.00 . A A . 115 ALA CB   1 1 
        1  1675 1 1 115 ALA H    H   4.715   4.426  16.466 1.00 . A A . 115 ALA H    1 1 
        1  1676 1 1 115 ALA HA   H   7.268   4.983  17.557 1.00 . A A . 115 ALA HA   1 1 
        1  1677 1 1 115 ALA HB1  H   7.923   2.817  16.679 1.00 . A A . 115 ALA HB1  1 1 
        1  1678 1 1 115 ALA HB2  H   6.487   2.772  15.656 1.00 . A A . 115 ALA HB2  1 1 
        1  1679 1 1 115 ALA HB3  H   6.321   2.715  17.410 1.00 . A A . 115 ALA HB3  1 1 
        1  1680 1 1 115 ALA N    N   5.420   5.083  16.636 1.00 . A A . 115 ALA N    1 1 
        1  1681 1 1 115 ALA O    O   8.608   5.908  15.644 1.00 . A A . 115 ALA O    1 1 
        1  1682 1 1 116 LEU C    C   7.641   7.108  13.020 1.00 . A A . 116 LEU C    1 1 
        1  1683 1 1 116 LEU CA   C   7.677   5.583  13.051 1.00 . A A . 116 LEU CA   1 1 
        1  1684 1 1 116 LEU CB   C   7.037   4.999  11.788 1.00 . A A . 116 LEU CB   1 1 
        1  1685 1 1 116 LEU CD1  C   6.968   2.549  12.385 1.00 . A A . 116 LEU CD1  1 1 
        1  1686 1 1 116 LEU CD2  C   7.099   3.243   9.993 1.00 . A A . 116 LEU CD2  1 1 
        1  1687 1 1 116 LEU CG   C   7.507   3.587  11.414 1.00 . A A . 116 LEU CG   1 1 
        1  1688 1 1 116 LEU H    H   6.204   4.563  14.182 1.00 . A A . 116 LEU H    1 1 
        1  1689 1 1 116 LEU HA   H   8.713   5.273  13.081 1.00 . A A . 116 LEU HA   1 1 
        1  1690 1 1 116 LEU HB2  H   5.966   4.972  11.931 1.00 . A A . 116 LEU HB2  1 1 
        1  1691 1 1 116 LEU HB3  H   7.257   5.658  10.961 1.00 . A A . 116 LEU HB3  1 1 
        1  1692 1 1 116 LEU HD11 H   7.317   2.774  13.381 1.00 . A A . 116 LEU HD11 1 1 
        1  1693 1 1 116 LEU HD12 H   7.316   1.568  12.095 1.00 . A A . 116 LEU HD12 1 1 
        1  1694 1 1 116 LEU HD13 H   5.889   2.567  12.367 1.00 . A A . 116 LEU HD13 1 1 
        1  1695 1 1 116 LEU HD21 H   7.560   3.940   9.308 1.00 . A A . 116 LEU HD21 1 1 
        1  1696 1 1 116 LEU HD22 H   6.025   3.306   9.903 1.00 . A A . 116 LEU HD22 1 1 
        1  1697 1 1 116 LEU HD23 H   7.423   2.239   9.759 1.00 . A A . 116 LEU HD23 1 1 
        1  1698 1 1 116 LEU HG   H   8.585   3.556  11.465 1.00 . A A . 116 LEU HG   1 1 
        1  1699 1 1 116 LEU N    N   7.044   5.067  14.259 1.00 . A A . 116 LEU N    1 1 
        1  1700 1 1 116 LEU O    O   8.476   7.748  12.385 1.00 . A A . 116 LEU O    1 1 
        1  1701 1 1 117 MET C    C   7.770   9.674  14.611 1.00 . A A . 117 MET C    1 1 
        1  1702 1 1 117 MET CA   C   6.575   9.130  13.824 1.00 . A A . 117 MET CA   1 1 
        1  1703 1 1 117 MET CB   C   5.274   9.498  14.539 1.00 . A A . 117 MET CB   1 1 
        1  1704 1 1 117 MET CE   C   2.319  10.442  14.756 1.00 . A A . 117 MET CE   1 1 
        1  1705 1 1 117 MET CG   C   5.037  10.992  14.680 1.00 . A A . 117 MET CG   1 1 
        1  1706 1 1 117 MET H    H   5.969   7.121  14.101 1.00 . A A . 117 MET H    1 1 
        1  1707 1 1 117 MET HA   H   6.574   9.562  12.836 1.00 . A A . 117 MET HA   1 1 
        1  1708 1 1 117 MET HB2  H   4.445   9.079  13.988 1.00 . A A . 117 MET HB2  1 1 
        1  1709 1 1 117 MET HB3  H   5.289   9.064  15.529 1.00 . A A . 117 MET HB3  1 1 
        1  1710 1 1 117 MET HE1  H   1.360  10.577  15.233 1.00 . A A . 117 MET HE1  1 1 
        1  1711 1 1 117 MET HE2  H   2.578   9.393  14.754 1.00 . A A . 117 MET HE2  1 1 
        1  1712 1 1 117 MET HE3  H   2.268  10.802  13.739 1.00 . A A . 117 MET HE3  1 1 
        1  1713 1 1 117 MET HG2  H   5.896  11.436  15.161 1.00 . A A . 117 MET HG2  1 1 
        1  1714 1 1 117 MET HG3  H   4.918  11.420  13.696 1.00 . A A . 117 MET HG3  1 1 
        1  1715 1 1 117 MET N    N   6.663   7.684  13.690 1.00 . A A . 117 MET N    1 1 
        1  1716 1 1 117 MET O    O   8.282  10.756  14.319 1.00 . A A . 117 MET O    1 1 
        1  1717 1 1 117 MET SD   S   3.564  11.364  15.656 1.00 . A A . 117 MET SD   1 1 
        1  1718 1 1 118 LYS C    C  10.655   9.309  15.944 1.00 . A A . 118 LYS C    1 1 
        1  1719 1 1 118 LYS CA   C   9.238   9.375  16.532 1.00 . A A . 118 LYS CA   1 1 
        1  1720 1 1 118 LYS CB   C   9.158   8.577  17.839 1.00 . A A . 118 LYS CB   1 1 
        1  1721 1 1 118 LYS CD   C   9.830  10.575  19.240 1.00 . A A . 118 LYS CD   1 1 
        1  1722 1 1 118 LYS CE   C   8.396  10.856  19.671 1.00 . A A . 118 LYS CE   1 1 
        1  1723 1 1 118 LYS CG   C  10.071   9.097  18.947 1.00 . A A . 118 LYS CG   1 1 
        1  1724 1 1 118 LYS H    H   7.846   8.005  15.709 1.00 . A A . 118 LYS H    1 1 
        1  1725 1 1 118 LYS HA   H   9.016  10.408  16.753 1.00 . A A . 118 LYS HA   1 1 
        1  1726 1 1 118 LYS HB2  H   8.142   8.606  18.201 1.00 . A A . 118 LYS HB2  1 1 
        1  1727 1 1 118 LYS HB3  H   9.426   7.550  17.635 1.00 . A A . 118 LYS HB3  1 1 
        1  1728 1 1 118 LYS HD2  H  10.495  10.884  20.033 1.00 . A A . 118 LYS HD2  1 1 
        1  1729 1 1 118 LYS HD3  H  10.046  11.145  18.348 1.00 . A A . 118 LYS HD3  1 1 
        1  1730 1 1 118 LYS HE2  H   8.266  11.923  19.763 1.00 . A A . 118 LYS HE2  1 1 
        1  1731 1 1 118 LYS HE3  H   7.724  10.478  18.913 1.00 . A A . 118 LYS HE3  1 1 
        1  1732 1 1 118 LYS HG2  H   9.886   8.528  19.847 1.00 . A A . 118 LYS HG2  1 1 
        1  1733 1 1 118 LYS HG3  H  11.099   8.963  18.642 1.00 . A A . 118 LYS HG3  1 1 
        1  1734 1 1 118 LYS HZ1  H   7.052  10.369  21.201 1.00 . A A . 118 LYS HZ1  1 1 
        1  1735 1 1 118 LYS HZ2  H   8.642  10.627  21.738 1.00 . A A . 118 LYS HZ2  1 1 
        1  1736 1 1 118 LYS HZ3  H   8.247   9.196  20.936 1.00 . A A . 118 LYS HZ3  1 1 
        1  1737 1 1 118 LYS N    N   8.215   8.909  15.601 1.00 . A A . 118 LYS N    1 1 
        1  1738 1 1 118 LYS NZ   N   8.061  10.219  20.972 1.00 . A A . 118 LYS NZ   1 1 
        1  1739 1 1 118 LYS O    O  11.426  10.259  16.084 1.00 . A A . 118 LYS O    1 1 
        1  1740 1 1 119 TRP C    C  12.787   9.033  13.772 1.00 . A A . 119 TRP C    1 1 
        1  1741 1 1 119 TRP CA   C  12.388   8.008  14.835 1.00 . A A . 119 TRP CA   1 1 
        1  1742 1 1 119 TRP CB   C  12.616   6.575  14.321 1.00 . A A . 119 TRP CB   1 1 
        1  1743 1 1 119 TRP CD1  C  10.771   6.102  12.612 1.00 . A A . 119 TRP CD1  1 1 
        1  1744 1 1 119 TRP CD2  C  12.814   6.127  11.740 1.00 . A A . 119 TRP CD2  1 1 
        1  1745 1 1 119 TRP CE2  C  11.908   5.855  10.713 1.00 . A A . 119 TRP CE2  1 1 
        1  1746 1 1 119 TRP CE3  C  14.158   6.193  11.435 1.00 . A A . 119 TRP CE3  1 1 
        1  1747 1 1 119 TRP CG   C  12.066   6.290  12.950 1.00 . A A . 119 TRP CG   1 1 
        1  1748 1 1 119 TRP CH2  C  13.646   5.704   9.127 1.00 . A A . 119 TRP CH2  1 1 
        1  1749 1 1 119 TRP CZ2  C  12.311   5.639   9.399 1.00 . A A . 119 TRP CZ2  1 1 
        1  1750 1 1 119 TRP CZ3  C  14.570   5.982  10.132 1.00 . A A . 119 TRP CZ3  1 1 
        1  1751 1 1 119 TRP H    H  10.332   7.513  15.103 1.00 . A A . 119 TRP H    1 1 
        1  1752 1 1 119 TRP HA   H  13.022   8.162  15.696 1.00 . A A . 119 TRP HA   1 1 
        1  1753 1 1 119 TRP HB2  H  13.678   6.381  14.291 1.00 . A A . 119 TRP HB2  1 1 
        1  1754 1 1 119 TRP HB3  H  12.156   5.882  15.011 1.00 . A A . 119 TRP HB3  1 1 
        1  1755 1 1 119 TRP HD1  H   9.948   6.160  13.309 1.00 . A A . 119 TRP HD1  1 1 
        1  1756 1 1 119 TRP HE1  H   9.839   5.704  10.783 1.00 . A A . 119 TRP HE1  1 1 
        1  1757 1 1 119 TRP HE3  H  14.866   6.434  12.189 1.00 . A A . 119 TRP HE3  1 1 
        1  1758 1 1 119 TRP HH2  H  14.005   5.544   8.121 1.00 . A A . 119 TRP HH2  1 1 
        1  1759 1 1 119 TRP HZ2  H  11.604   5.424   8.612 1.00 . A A . 119 TRP HZ2  1 1 
        1  1760 1 1 119 TRP HZ3  H  15.621   6.026   9.884 1.00 . A A . 119 TRP HZ3  1 1 
        1  1761 1 1 119 TRP N    N  11.004   8.205  15.283 1.00 . A A . 119 TRP N    1 1 
        1  1762 1 1 119 TRP NE1  N  10.666   5.857  11.265 1.00 . A A . 119 TRP NE1  1 1 
        1  1763 1 1 119 TRP O    O  13.890   9.576  13.804 1.00 . A A . 119 TRP O    1 1 
        1  1764 1 1 120 VAL C    C  12.207  11.680  12.301 1.00 . A A . 120 VAL C    1 1 
        1  1765 1 1 120 VAL CA   C  12.155  10.256  11.771 1.00 . A A . 120 VAL CA   1 1 
        1  1766 1 1 120 VAL CB   C  11.101  10.130  10.662 1.00 . A A . 120 VAL CB   1 1 
        1  1767 1 1 120 VAL CG1  C   9.709  10.295  11.225 1.00 . A A . 120 VAL CG1  1 1 
        1  1768 1 1 120 VAL CG2  C  11.358  11.118   9.532 1.00 . A A . 120 VAL CG2  1 1 
        1  1769 1 1 120 VAL H    H  10.999   8.887  12.896 1.00 . A A . 120 VAL H    1 1 
        1  1770 1 1 120 VAL HA   H  13.119  10.005  11.351 1.00 . A A . 120 VAL HA   1 1 
        1  1771 1 1 120 VAL HB   H  11.170   9.139  10.265 1.00 . A A . 120 VAL HB   1 1 
        1  1772 1 1 120 VAL HG11 H   9.515   9.493  11.925 1.00 . A A . 120 VAL HG11 1 1 
        1  1773 1 1 120 VAL HG12 H   8.990  10.255  10.423 1.00 . A A . 120 VAL HG12 1 1 
        1  1774 1 1 120 VAL HG13 H   9.639  11.242  11.734 1.00 . A A . 120 VAL HG13 1 1 
        1  1775 1 1 120 VAL HG21 H  10.603  10.996   8.767 1.00 . A A . 120 VAL HG21 1 1 
        1  1776 1 1 120 VAL HG22 H  12.333  10.932   9.105 1.00 . A A . 120 VAL HG22 1 1 
        1  1777 1 1 120 VAL HG23 H  11.320  12.127   9.916 1.00 . A A . 120 VAL HG23 1 1 
        1  1778 1 1 120 VAL N    N  11.880   9.317  12.849 1.00 . A A . 120 VAL N    1 1 
        1  1779 1 1 120 VAL O    O  12.942  12.526  11.786 1.00 . A A . 120 VAL O    1 1 
        1  1780 1 1 121 ASP C    C  12.872  13.483  14.541 1.00 . A A . 121 ASP C    1 1 
        1  1781 1 1 121 ASP CA   C  11.455  13.194  14.056 1.00 . A A . 121 ASP CA   1 1 
        1  1782 1 1 121 ASP CB   C  10.491  13.151  15.247 1.00 . A A . 121 ASP CB   1 1 
        1  1783 1 1 121 ASP CG   C  10.479  14.436  16.053 1.00 . A A . 121 ASP CG   1 1 
        1  1784 1 1 121 ASP H    H  10.801  11.220  13.623 1.00 . A A . 121 ASP H    1 1 
        1  1785 1 1 121 ASP HA   H  11.147  13.971  13.375 1.00 . A A . 121 ASP HA   1 1 
        1  1786 1 1 121 ASP HB2  H   9.490  12.970  14.884 1.00 . A A . 121 ASP HB2  1 1 
        1  1787 1 1 121 ASP HB3  H  10.780  12.342  15.902 1.00 . A A . 121 ASP HB3  1 1 
        1  1788 1 1 121 ASP N    N  11.425  11.921  13.338 1.00 . A A . 121 ASP N    1 1 
        1  1789 1 1 121 ASP O    O  13.414  14.564  14.308 1.00 . A A . 121 ASP O    1 1 
        1  1790 1 1 121 ASP OD1  O  11.366  14.611  16.914 1.00 . A A . 121 ASP OD1  1 1 
        1  1791 1 1 121 ASP OD2  O   9.566  15.265  15.849 1.00 . A A . 121 ASP OD2  1 1 
        1  1792 1 1 122 ASP C    C  15.820  12.726  14.492 1.00 . A A . 122 ASP C    1 1 
        1  1793 1 1 122 ASP CA   C  14.851  12.583  15.664 1.00 . A A . 122 ASP CA   1 1 
        1  1794 1 1 122 ASP CB   C  15.204  11.344  16.493 1.00 . A A . 122 ASP CB   1 1 
        1  1795 1 1 122 ASP CG   C  16.687  11.232  16.790 1.00 . A A . 122 ASP CG   1 1 
        1  1796 1 1 122 ASP H    H  12.960  11.672  15.378 1.00 . A A . 122 ASP H    1 1 
        1  1797 1 1 122 ASP HA   H  14.930  13.459  16.289 1.00 . A A . 122 ASP HA   1 1 
        1  1798 1 1 122 ASP HB2  H  14.673  11.386  17.432 1.00 . A A . 122 ASP HB2  1 1 
        1  1799 1 1 122 ASP HB3  H  14.898  10.459  15.953 1.00 . A A . 122 ASP HB3  1 1 
        1  1800 1 1 122 ASP N    N  13.470  12.491  15.194 1.00 . A A . 122 ASP N    1 1 
        1  1801 1 1 122 ASP O    O  16.787  13.488  14.561 1.00 . A A . 122 ASP O    1 1 
        1  1802 1 1 122 ASP OD1  O  17.217  12.071  17.550 1.00 . A A . 122 ASP OD1  1 1 
        1  1803 1 1 122 ASP OD2  O  17.330  10.295  16.268 1.00 . A A . 122 ASP OD2  1 1 
        1  1804 1 1 123 ASN C    C  16.448  13.455  11.628 1.00 . A A . 123 ASN C    1 1 
        1  1805 1 1 123 ASN CA   C  16.374  12.051  12.205 1.00 . A A . 123 ASN CA   1 1 
        1  1806 1 1 123 ASN CB   C  15.811  11.132  11.119 1.00 . A A . 123 ASN CB   1 1 
        1  1807 1 1 123 ASN CG   C  15.893   9.664  11.459 1.00 . A A . 123 ASN CG   1 1 
        1  1808 1 1 123 ASN H    H  14.745  11.429  13.419 1.00 . A A . 123 ASN H    1 1 
        1  1809 1 1 123 ASN HA   H  17.365  11.721  12.472 1.00 . A A . 123 ASN HA   1 1 
        1  1810 1 1 123 ASN HB2  H  14.773  11.379  10.956 1.00 . A A . 123 ASN HB2  1 1 
        1  1811 1 1 123 ASN HB3  H  16.359  11.300  10.204 1.00 . A A . 123 ASN HB3  1 1 
        1  1812 1 1 123 ASN HD21 H  14.191   9.326  10.487 1.00 . A A . 123 ASN HD21 1 1 
        1  1813 1 1 123 ASN HD22 H  14.930   7.949  11.217 1.00 . A A . 123 ASN HD22 1 1 
        1  1814 1 1 123 ASN N    N  15.535  12.011  13.407 1.00 . A A . 123 ASN N    1 1 
        1  1815 1 1 123 ASN ND2  N  14.908   8.907  11.007 1.00 . A A . 123 ASN ND2  1 1 
        1  1816 1 1 123 ASN O    O  17.493  13.883  11.140 1.00 . A A . 123 ASN O    1 1 
        1  1817 1 1 123 ASN OD1  O  16.824   9.213  12.121 1.00 . A A . 123 ASN OD1  1 1 
        1  1818 1 1 124 GLY C    C  14.984  15.375   9.585 1.00 . A A . 124 GLY C    1 1 
        1  1819 1 1 124 GLY CA   C  15.259  15.468  11.071 1.00 . A A . 124 GLY CA   1 1 
        1  1820 1 1 124 GLY H    H  14.549  13.796  12.152 1.00 . A A . 124 GLY H    1 1 
        1  1821 1 1 124 GLY HA2  H  14.466  16.033  11.540 1.00 . A A . 124 GLY HA2  1 1 
        1  1822 1 1 124 GLY HA3  H  16.196  15.982  11.223 1.00 . A A . 124 GLY HA3  1 1 
        1  1823 1 1 124 GLY N    N  15.332  14.163  11.684 1.00 . A A . 124 GLY N    1 1 
        1  1824 1 1 124 GLY O    O  15.560  16.118   8.789 1.00 . A A . 124 GLY O    1 1 
        1  1825 1 1 125 PHE C    C  12.276  14.795   7.669 1.00 . A A . 125 PHE C    1 1 
        1  1826 1 1 125 PHE CA   C  13.696  14.280   7.834 1.00 . A A . 125 PHE CA   1 1 
        1  1827 1 1 125 PHE CB   C  13.764  12.815   7.404 1.00 . A A . 125 PHE CB   1 1 
        1  1828 1 1 125 PHE CD1  C  15.611  12.644   5.716 1.00 . A A . 125 PHE CD1  1 1 
        1  1829 1 1 125 PHE CD2  C  15.940  11.653   7.858 1.00 . A A . 125 PHE CD2  1 1 
        1  1830 1 1 125 PHE CE1  C  16.869  12.227   5.326 1.00 . A A . 125 PHE CE1  1 1 
        1  1831 1 1 125 PHE CE2  C  17.198  11.232   7.475 1.00 . A A . 125 PHE CE2  1 1 
        1  1832 1 1 125 PHE CG   C  15.134  12.362   6.986 1.00 . A A . 125 PHE CG   1 1 
        1  1833 1 1 125 PHE CZ   C  17.663  11.520   6.207 1.00 . A A . 125 PHE CZ   1 1 
        1  1834 1 1 125 PHE H    H  13.749  13.837   9.891 1.00 . A A . 125 PHE H    1 1 
        1  1835 1 1 125 PHE HA   H  14.358  14.864   7.211 1.00 . A A . 125 PHE HA   1 1 
        1  1836 1 1 125 PHE HB2  H  13.450  12.193   8.229 1.00 . A A . 125 PHE HB2  1 1 
        1  1837 1 1 125 PHE HB3  H  13.094  12.662   6.576 1.00 . A A . 125 PHE HB3  1 1 
        1  1838 1 1 125 PHE HD1  H  14.989  13.197   5.028 1.00 . A A . 125 PHE HD1  1 1 
        1  1839 1 1 125 PHE HD2  H  15.577  11.428   8.850 1.00 . A A . 125 PHE HD2  1 1 
        1  1840 1 1 125 PHE HE1  H  17.229  12.453   4.333 1.00 . A A . 125 PHE HE1  1 1 
        1  1841 1 1 125 PHE HE2  H  17.818  10.680   8.166 1.00 . A A . 125 PHE HE2  1 1 
        1  1842 1 1 125 PHE HZ   H  18.647  11.192   5.905 1.00 . A A . 125 PHE HZ   1 1 
        1  1843 1 1 125 PHE N    N  14.123  14.435   9.214 1.00 . A A . 125 PHE N    1 1 
        1  1844 1 1 125 PHE O    O  11.554  14.958   8.654 1.00 . A A . 125 PHE O    1 1 
        1  1845 1 1 126 ASP C    C   9.728  14.616   5.305 1.00 . A A . 126 ASP C    1 1 
        1  1846 1 1 126 ASP CA   C  10.553  15.574   6.160 1.00 . A A . 126 ASP CA   1 1 
        1  1847 1 1 126 ASP CB   C  10.657  16.940   5.476 1.00 . A A . 126 ASP CB   1 1 
        1  1848 1 1 126 ASP CG   C  11.283  16.866   4.097 1.00 . A A . 126 ASP CG   1 1 
        1  1849 1 1 126 ASP H    H  12.477  14.846   5.684 1.00 . A A . 126 ASP H    1 1 
        1  1850 1 1 126 ASP HA   H  10.054  15.700   7.109 1.00 . A A . 126 ASP HA   1 1 
        1  1851 1 1 126 ASP HB2  H   9.667  17.358   5.376 1.00 . A A . 126 ASP HB2  1 1 
        1  1852 1 1 126 ASP HB3  H  11.258  17.595   6.089 1.00 . A A . 126 ASP HB3  1 1 
        1  1853 1 1 126 ASP N    N  11.874  15.035   6.433 1.00 . A A . 126 ASP N    1 1 
        1  1854 1 1 126 ASP O    O  10.226  13.583   4.856 1.00 . A A . 126 ASP O    1 1 
        1  1855 1 1 126 ASP OD1  O  12.479  16.513   3.994 1.00 . A A . 126 ASP OD1  1 1 
        1  1856 1 1 126 ASP OD2  O  10.585  17.164   3.109 1.00 . A A . 126 ASP OD2  1 1 
        1  1857 1 1 127 LEU C    C   7.963  13.436   3.196 1.00 . A A . 127 LEU C    1 1 
        1  1858 1 1 127 LEU CA   C   7.451  14.171   4.431 1.00 . A A . 127 LEU CA   1 1 
        1  1859 1 1 127 LEU CB   C   6.235  15.016   4.020 1.00 . A A . 127 LEU CB   1 1 
        1  1860 1 1 127 LEU CD1  C   6.195  16.843   5.761 1.00 . A A . 127 LEU CD1  1 1 
        1  1861 1 1 127 LEU CD2  C   4.082  16.132   4.644 1.00 . A A . 127 LEU CD2  1 1 
        1  1862 1 1 127 LEU CG   C   5.437  15.672   5.156 1.00 . A A . 127 LEU CG   1 1 
        1  1863 1 1 127 LEU H    H   8.211  15.877   5.418 1.00 . A A . 127 LEU H    1 1 
        1  1864 1 1 127 LEU HA   H   7.123  13.437   5.151 1.00 . A A . 127 LEU HA   1 1 
        1  1865 1 1 127 LEU HB2  H   6.577  15.795   3.359 1.00 . A A . 127 LEU HB2  1 1 
        1  1866 1 1 127 LEU HB3  H   5.561  14.379   3.466 1.00 . A A . 127 LEU HB3  1 1 
        1  1867 1 1 127 LEU HD11 H   6.387  17.581   4.996 1.00 . A A . 127 LEU HD11 1 1 
        1  1868 1 1 127 LEU HD12 H   7.133  16.493   6.168 1.00 . A A . 127 LEU HD12 1 1 
        1  1869 1 1 127 LEU HD13 H   5.604  17.287   6.548 1.00 . A A . 127 LEU HD13 1 1 
        1  1870 1 1 127 LEU HD21 H   3.524  16.577   5.453 1.00 . A A . 127 LEU HD21 1 1 
        1  1871 1 1 127 LEU HD22 H   3.538  15.285   4.253 1.00 . A A . 127 LEU HD22 1 1 
        1  1872 1 1 127 LEU HD23 H   4.225  16.860   3.860 1.00 . A A . 127 LEU HD23 1 1 
        1  1873 1 1 127 LEU HG   H   5.269  14.943   5.936 1.00 . A A . 127 LEU HG   1 1 
        1  1874 1 1 127 LEU N    N   8.473  15.001   5.087 1.00 . A A . 127 LEU N    1 1 
        1  1875 1 1 127 LEU O    O   8.701  13.981   2.374 1.00 . A A . 127 LEU O    1 1 
        1  1876 1 1 128 SER C    C   6.924  11.414   0.818 1.00 . A A . 128 SER C    1 1 
        1  1877 1 1 128 SER CA   C   7.914  11.327   1.977 1.00 . A A . 128 SER CA   1 1 
        1  1878 1 1 128 SER CB   C   7.984   9.900   2.504 1.00 . A A . 128 SER CB   1 1 
        1  1879 1 1 128 SER H    H   6.919  11.835   3.749 1.00 . A A . 128 SER H    1 1 
        1  1880 1 1 128 SER HA   H   8.892  11.627   1.636 1.00 . A A . 128 SER HA   1 1 
        1  1881 1 1 128 SER HB2  H   7.974   9.209   1.674 1.00 . A A . 128 SER HB2  1 1 
        1  1882 1 1 128 SER HB3  H   8.893   9.771   3.073 1.00 . A A . 128 SER HB3  1 1 
        1  1883 1 1 128 SER HG   H   6.600   8.710   3.237 1.00 . A A . 128 SER HG   1 1 
        1  1884 1 1 128 SER N    N   7.524  12.193   3.071 1.00 . A A . 128 SER N    1 1 
        1  1885 1 1 128 SER O    O   7.291  11.224  -0.343 1.00 . A A . 128 SER O    1 1 
        1  1886 1 1 128 SER OG   O   6.871   9.629   3.348 1.00 . A A . 128 SER OG   1 1 
        1  1887 1 1 129 GLY C    C   3.326  11.174   0.631 1.00 . A A . 129 GLY C    1 1 
        1  1888 1 1 129 GLY CA   C   4.635  11.755   0.130 1.00 . A A . 129 GLY CA   1 1 
        1  1889 1 1 129 GLY H    H   5.453  11.922   2.070 1.00 . A A . 129 GLY H    1 1 
        1  1890 1 1 129 GLY HA2  H   4.473  12.782  -0.165 1.00 . A A . 129 GLY HA2  1 1 
        1  1891 1 1 129 GLY HA3  H   4.962  11.190  -0.730 1.00 . A A . 129 GLY HA3  1 1 
        1  1892 1 1 129 GLY N    N   5.673  11.716   1.140 1.00 . A A . 129 GLY N    1 1 
        1  1893 1 1 129 GLY O    O   2.509  11.889   1.208 1.00 . A A . 129 GLY O    1 1 
        1  1894 1 1 130 GLU C    C   2.252   8.020   1.766 1.00 . A A . 130 GLU C    1 1 
        1  1895 1 1 130 GLU CA   C   1.920   9.188   0.836 1.00 . A A . 130 GLU CA   1 1 
        1  1896 1 1 130 GLU CB   C   1.118   8.688  -0.378 1.00 . A A . 130 GLU CB   1 1 
        1  1897 1 1 130 GLU CD   C   2.909   8.416  -2.147 1.00 . A A . 130 GLU CD   1 1 
        1  1898 1 1 130 GLU CG   C   1.872   7.726  -1.284 1.00 . A A . 130 GLU CG   1 1 
        1  1899 1 1 130 GLU H    H   3.834   9.363  -0.052 1.00 . A A . 130 GLU H    1 1 
        1  1900 1 1 130 GLU HA   H   1.315   9.897   1.382 1.00 . A A . 130 GLU HA   1 1 
        1  1901 1 1 130 GLU HB2  H   0.230   8.185  -0.023 1.00 . A A . 130 GLU HB2  1 1 
        1  1902 1 1 130 GLU HB3  H   0.820   9.543  -0.969 1.00 . A A . 130 GLU HB3  1 1 
        1  1903 1 1 130 GLU HG2  H   2.371   6.992  -0.670 1.00 . A A . 130 GLU HG2  1 1 
        1  1904 1 1 130 GLU HG3  H   1.162   7.230  -1.929 1.00 . A A . 130 GLU HG3  1 1 
        1  1905 1 1 130 GLU N    N   3.135   9.878   0.416 1.00 . A A . 130 GLU N    1 1 
        1  1906 1 1 130 GLU O    O   3.420   7.673   1.950 1.00 . A A . 130 GLU O    1 1 
        1  1907 1 1 130 GLU OE1  O   2.553   8.890  -3.247 1.00 . A A . 130 GLU OE1  1 1 
        1  1908 1 1 130 GLU OE2  O   4.082   8.489  -1.732 1.00 . A A . 130 GLU OE2  1 1 
        1  1909 1 1 131 ALA C    C   1.002   5.000   2.650 1.00 . A A . 131 ALA C    1 1 
        1  1910 1 1 131 ALA CA   C   1.400   6.326   3.296 1.00 . A A . 131 ALA CA   1 1 
        1  1911 1 1 131 ALA CB   C   0.600   6.570   4.565 1.00 . A A . 131 ALA CB   1 1 
        1  1912 1 1 131 ALA H    H   0.310   7.750   2.164 1.00 . A A . 131 ALA H    1 1 
        1  1913 1 1 131 ALA HA   H   2.446   6.282   3.561 1.00 . A A . 131 ALA HA   1 1 
        1  1914 1 1 131 ALA HB1  H  -0.452   6.602   4.328 1.00 . A A . 131 ALA HB1  1 1 
        1  1915 1 1 131 ALA HB2  H   0.899   7.510   5.005 1.00 . A A . 131 ALA HB2  1 1 
        1  1916 1 1 131 ALA HB3  H   0.786   5.770   5.267 1.00 . A A . 131 ALA HB3  1 1 
        1  1917 1 1 131 ALA N    N   1.221   7.436   2.366 1.00 . A A . 131 ALA N    1 1 
        1  1918 1 1 131 ALA O    O   0.174   4.971   1.738 1.00 . A A . 131 ALA O    1 1 
        1  1919 1 1 132 TYR C    C   1.063   1.521   3.583 1.00 . A A . 132 TYR C    1 1 
        1  1920 1 1 132 TYR CA   C   1.403   2.588   2.543 1.00 . A A . 132 TYR CA   1 1 
        1  1921 1 1 132 TYR CB   C   2.679   2.144   1.823 1.00 . A A . 132 TYR CB   1 1 
        1  1922 1 1 132 TYR CD1  C   3.107   3.858   0.015 1.00 . A A . 132 TYR CD1  1 1 
        1  1923 1 1 132 TYR CD2  C   2.564   1.633  -0.639 1.00 . A A . 132 TYR CD2  1 1 
        1  1924 1 1 132 TYR CE1  C   3.219   4.223  -1.312 1.00 . A A . 132 TYR CE1  1 1 
        1  1925 1 1 132 TYR CE2  C   2.671   1.990  -1.967 1.00 . A A . 132 TYR CE2  1 1 
        1  1926 1 1 132 TYR CG   C   2.778   2.559   0.373 1.00 . A A . 132 TYR CG   1 1 
        1  1927 1 1 132 TYR CZ   C   3.000   3.285  -2.299 1.00 . A A . 132 TYR CZ   1 1 
        1  1928 1 1 132 TYR H    H   2.171   3.997   3.926 1.00 . A A . 132 TYR H    1 1 
        1  1929 1 1 132 TYR HA   H   0.601   2.651   1.825 1.00 . A A . 132 TYR HA   1 1 
        1  1930 1 1 132 TYR HB2  H   3.531   2.560   2.338 1.00 . A A . 132 TYR HB2  1 1 
        1  1931 1 1 132 TYR HB3  H   2.739   1.067   1.863 1.00 . A A . 132 TYR HB3  1 1 
        1  1932 1 1 132 TYR HD1  H   3.278   4.590   0.790 1.00 . A A . 132 TYR HD1  1 1 
        1  1933 1 1 132 TYR HD2  H   2.306   0.618  -0.375 1.00 . A A . 132 TYR HD2  1 1 
        1  1934 1 1 132 TYR HE1  H   3.477   5.239  -1.573 1.00 . A A . 132 TYR HE1  1 1 
        1  1935 1 1 132 TYR HE2  H   2.498   1.254  -2.740 1.00 . A A . 132 TYR HE2  1 1 
        1  1936 1 1 132 TYR HH   H   3.959   4.091  -3.758 1.00 . A A . 132 TYR HH   1 1 
        1  1937 1 1 132 TYR N    N   1.591   3.911   3.135 1.00 . A A . 132 TYR N    1 1 
        1  1938 1 1 132 TYR O    O   1.741   1.391   4.603 1.00 . A A . 132 TYR O    1 1 
        1  1939 1 1 132 TYR OH   O   3.117   3.641  -3.623 1.00 . A A . 132 TYR OH   1 1 
        1  1940 1 1 133 GLU C    C  -0.229  -1.608   2.947 1.00 . A A . 133 GLU C    1 1 
        1  1941 1 1 133 GLU CA   C  -0.257  -0.495   3.985 1.00 . A A . 133 GLU CA   1 1 
        1  1942 1 1 133 GLU CB   C  -1.609  -0.475   4.705 1.00 . A A . 133 GLU CB   1 1 
        1  1943 1 1 133 GLU CD   C  -2.911   0.204   6.761 1.00 . A A . 133 GLU CD   1 1 
        1  1944 1 1 133 GLU CG   C  -1.582   0.257   6.035 1.00 . A A . 133 GLU CG   1 1 
        1  1945 1 1 133 GLU H    H  -0.621   1.070   2.612 1.00 . A A . 133 GLU H    1 1 
        1  1946 1 1 133 GLU HA   H   0.532  -0.665   4.704 1.00 . A A . 133 GLU HA   1 1 
        1  1947 1 1 133 GLU HB2  H  -2.334   0.010   4.068 1.00 . A A . 133 GLU HB2  1 1 
        1  1948 1 1 133 GLU HB3  H  -1.925  -1.492   4.884 1.00 . A A . 133 GLU HB3  1 1 
        1  1949 1 1 133 GLU HG2  H  -0.830  -0.196   6.662 1.00 . A A . 133 GLU HG2  1 1 
        1  1950 1 1 133 GLU HG3  H  -1.326   1.290   5.856 1.00 . A A . 133 GLU HG3  1 1 
        1  1951 1 1 133 GLU N    N   0.010   0.767   3.306 1.00 . A A . 133 GLU N    1 1 
        1  1952 1 1 133 GLU O    O  -0.223  -1.331   1.751 1.00 . A A . 133 GLU O    1 1 
        1  1953 1 1 133 GLU OE1  O  -3.200  -0.829   7.405 1.00 . A A . 133 GLU OE1  1 1 
        1  1954 1 1 133 GLU OE2  O  -3.665   1.195   6.700 1.00 . A A . 133 GLU OE2  1 1 
        1  1955 1 1 134 ILE C    C  -0.512  -5.281   3.128 1.00 . A A . 134 ILE C    1 1 
        1  1956 1 1 134 ILE CA   C  -0.148  -3.968   2.442 1.00 . A A . 134 ILE CA   1 1 
        1  1957 1 1 134 ILE CB   C   1.245  -4.076   1.770 1.00 . A A . 134 ILE CB   1 1 
        1  1958 1 1 134 ILE CD1  C   2.517  -5.229  -0.117 1.00 . A A . 134 ILE CD1  1 1 
        1  1959 1 1 134 ILE CG1  C   1.266  -5.208   0.738 1.00 . A A . 134 ILE CG1  1 1 
        1  1960 1 1 134 ILE CG2  C   2.335  -4.279   2.813 1.00 . A A . 134 ILE CG2  1 1 
        1  1961 1 1 134 ILE H    H  -0.208  -3.036   4.345 1.00 . A A . 134 ILE H    1 1 
        1  1962 1 1 134 ILE HA   H  -0.876  -3.772   1.667 1.00 . A A . 134 ILE HA   1 1 
        1  1963 1 1 134 ILE HB   H   1.442  -3.142   1.266 1.00 . A A . 134 ILE HB   1 1 
        1  1964 1 1 134 ILE HD11 H   3.381  -5.375   0.513 1.00 . A A . 134 ILE HD11 1 1 
        1  1965 1 1 134 ILE HD12 H   2.608  -4.288  -0.641 1.00 . A A . 134 ILE HD12 1 1 
        1  1966 1 1 134 ILE HD13 H   2.450  -6.035  -0.833 1.00 . A A . 134 ILE HD13 1 1 
        1  1967 1 1 134 ILE HG12 H   1.200  -6.157   1.251 1.00 . A A . 134 ILE HG12 1 1 
        1  1968 1 1 134 ILE HG13 H   0.416  -5.101   0.081 1.00 . A A . 134 ILE HG13 1 1 
        1  1969 1 1 134 ILE HG21 H   3.293  -4.355   2.321 1.00 . A A . 134 ILE HG21 1 1 
        1  1970 1 1 134 ILE HG22 H   2.140  -5.187   3.366 1.00 . A A . 134 ILE HG22 1 1 
        1  1971 1 1 134 ILE HG23 H   2.344  -3.439   3.493 1.00 . A A . 134 ILE HG23 1 1 
        1  1972 1 1 134 ILE N    N  -0.195  -2.856   3.382 1.00 . A A . 134 ILE N    1 1 
        1  1973 1 1 134 ILE O    O  -0.040  -5.578   4.227 1.00 . A A . 134 ILE O    1 1 
        1  1974 1 1 135 TYR C    C  -1.236  -8.496   2.277 1.00 . A A . 135 TYR C    1 1 
        1  1975 1 1 135 TYR CA   C  -1.818  -7.321   3.043 1.00 . A A . 135 TYR CA   1 1 
        1  1976 1 1 135 TYR CB   C  -3.348  -7.402   3.041 1.00 . A A . 135 TYR CB   1 1 
        1  1977 1 1 135 TYR CD1  C  -4.016  -6.679   5.363 1.00 . A A . 135 TYR CD1  1 1 
        1  1978 1 1 135 TYR CD2  C  -4.653  -5.292   3.530 1.00 . A A . 135 TYR CD2  1 1 
        1  1979 1 1 135 TYR CE1  C  -4.630  -5.807   6.239 1.00 . A A . 135 TYR CE1  1 1 
        1  1980 1 1 135 TYR CE2  C  -5.268  -4.415   4.403 1.00 . A A . 135 TYR CE2  1 1 
        1  1981 1 1 135 TYR CG   C  -4.016  -6.438   3.995 1.00 . A A . 135 TYR CG   1 1 
        1  1982 1 1 135 TYR CZ   C  -5.253  -4.677   5.756 1.00 . A A . 135 TYR CZ   1 1 
        1  1983 1 1 135 TYR H    H  -1.682  -5.786   1.587 1.00 . A A . 135 TYR H    1 1 
        1  1984 1 1 135 TYR HA   H  -1.469  -7.367   4.064 1.00 . A A . 135 TYR HA   1 1 
        1  1985 1 1 135 TYR HB2  H  -3.710  -7.185   2.047 1.00 . A A . 135 TYR HB2  1 1 
        1  1986 1 1 135 TYR HB3  H  -3.647  -8.402   3.316 1.00 . A A . 135 TYR HB3  1 1 
        1  1987 1 1 135 TYR HD1  H  -3.525  -7.565   5.740 1.00 . A A . 135 TYR HD1  1 1 
        1  1988 1 1 135 TYR HD2  H  -4.665  -5.091   2.471 1.00 . A A . 135 TYR HD2  1 1 
        1  1989 1 1 135 TYR HE1  H  -4.618  -6.012   7.300 1.00 . A A . 135 TYR HE1  1 1 
        1  1990 1 1 135 TYR HE2  H  -5.756  -3.530   4.025 1.00 . A A . 135 TYR HE2  1 1 
        1  1991 1 1 135 TYR HH   H  -5.224  -3.544   7.316 1.00 . A A . 135 TYR HH   1 1 
        1  1992 1 1 135 TYR N    N  -1.363  -6.059   2.479 1.00 . A A . 135 TYR N    1 1 
        1  1993 1 1 135 TYR O    O  -1.636  -8.770   1.145 1.00 . A A . 135 TYR O    1 1 
        1  1994 1 1 135 TYR OH   O  -5.865  -3.809   6.630 1.00 . A A . 135 TYR OH   1 1 
        1  1995 1 1 136 LEU C    C  -0.348 -11.609   2.801 1.00 . A A . 136 LEU C    1 1 
        1  1996 1 1 136 LEU CA   C   0.330 -10.349   2.287 1.00 . A A . 136 LEU CA   1 1 
        1  1997 1 1 136 LEU CB   C   1.838 -10.419   2.569 1.00 . A A . 136 LEU CB   1 1 
        1  1998 1 1 136 LEU CD1  C   2.590  -8.013   2.515 1.00 . A A . 136 LEU CD1  1 1 
        1  1999 1 1 136 LEU CD2  C   4.156  -9.826   1.800 1.00 . A A . 136 LEU CD2  1 1 
        1  2000 1 1 136 LEU CG   C   2.704  -9.376   1.850 1.00 . A A . 136 LEU CG   1 1 
        1  2001 1 1 136 LEU H    H   0.031  -8.876   3.773 1.00 . A A . 136 LEU H    1 1 
        1  2002 1 1 136 LEU HA   H   0.177 -10.286   1.219 1.00 . A A . 136 LEU HA   1 1 
        1  2003 1 1 136 LEU HB2  H   1.986 -10.302   3.633 1.00 . A A . 136 LEU HB2  1 1 
        1  2004 1 1 136 LEU HB3  H   2.187 -11.401   2.282 1.00 . A A . 136 LEU HB3  1 1 
        1  2005 1 1 136 LEU HD11 H   1.567  -7.668   2.459 1.00 . A A . 136 LEU HD11 1 1 
        1  2006 1 1 136 LEU HD12 H   3.236  -7.311   2.008 1.00 . A A . 136 LEU HD12 1 1 
        1  2007 1 1 136 LEU HD13 H   2.887  -8.093   3.551 1.00 . A A . 136 LEU HD13 1 1 
        1  2008 1 1 136 LEU HD21 H   4.522  -9.969   2.806 1.00 . A A . 136 LEU HD21 1 1 
        1  2009 1 1 136 LEU HD22 H   4.749  -9.073   1.305 1.00 . A A . 136 LEU HD22 1 1 
        1  2010 1 1 136 LEU HD23 H   4.226 -10.756   1.256 1.00 . A A . 136 LEU HD23 1 1 
        1  2011 1 1 136 LEU HG   H   2.354  -9.275   0.833 1.00 . A A . 136 LEU HG   1 1 
        1  2012 1 1 136 LEU N    N  -0.274  -9.171   2.889 1.00 . A A . 136 LEU N    1 1 
        1  2013 1 1 136 LEU O    O  -0.226 -11.948   3.981 1.00 . A A . 136 LEU O    1 1 
        1  2014 1 1 137 ASP C    C  -2.987 -13.256   3.111 1.00 . A A . 137 ASP C    1 1 
        1  2015 1 1 137 ASP CA   C  -1.789 -13.519   2.207 1.00 . A A . 137 ASP CA   1 1 
        1  2016 1 1 137 ASP CB   C  -0.872 -14.576   2.840 1.00 . A A . 137 ASP CB   1 1 
        1  2017 1 1 137 ASP CG   C   0.185 -15.074   1.880 1.00 . A A . 137 ASP CG   1 1 
        1  2018 1 1 137 ASP H    H  -1.119 -11.924   0.990 1.00 . A A . 137 ASP H    1 1 
        1  2019 1 1 137 ASP HA   H  -2.160 -13.909   1.269 1.00 . A A . 137 ASP HA   1 1 
        1  2020 1 1 137 ASP HB2  H  -0.378 -14.148   3.700 1.00 . A A . 137 ASP HB2  1 1 
        1  2021 1 1 137 ASP HB3  H  -1.470 -15.419   3.158 1.00 . A A . 137 ASP HB3  1 1 
        1  2022 1 1 137 ASP N    N  -1.065 -12.281   1.900 1.00 . A A . 137 ASP N    1 1 
        1  2023 1 1 137 ASP O    O  -3.284 -12.113   3.461 1.00 . A A . 137 ASP O    1 1 
        1  2024 1 1 137 ASP OD1  O  -0.158 -15.859   0.963 1.00 . A A . 137 ASP OD1  1 1 
        1  2025 1 1 137 ASP OD2  O   1.364 -14.685   2.033 1.00 . A A . 137 ASP OD2  1 1 
        1  2026 1 1 138 ASN C    C  -4.534 -14.521   5.751 1.00 . A A . 138 ASN C    1 1 
        1  2027 1 1 138 ASN CA   C  -4.878 -14.207   4.294 1.00 . A A . 138 ASN CA   1 1 
        1  2028 1 1 138 ASN CB   C  -5.928 -15.196   3.765 1.00 . A A . 138 ASN CB   1 1 
        1  2029 1 1 138 ASN CG   C  -7.302 -15.052   4.400 1.00 . A A . 138 ASN CG   1 1 
        1  2030 1 1 138 ASN H    H  -3.378 -15.206   3.194 1.00 . A A . 138 ASN H    1 1 
        1  2031 1 1 138 ASN HA   H  -5.255 -13.200   4.219 1.00 . A A . 138 ASN HA   1 1 
        1  2032 1 1 138 ASN HB2  H  -6.037 -15.051   2.702 1.00 . A A . 138 ASN HB2  1 1 
        1  2033 1 1 138 ASN HB3  H  -5.576 -16.203   3.945 1.00 . A A . 138 ASN HB3  1 1 
        1  2034 1 1 138 ASN HD21 H  -7.577 -17.016   4.257 1.00 . A A . 138 ASN HD21 1 1 
        1  2035 1 1 138 ASN HD22 H  -8.886 -16.111   4.961 1.00 . A A . 138 ASN HD22 1 1 
        1  2036 1 1 138 ASN N    N  -3.683 -14.321   3.474 1.00 . A A . 138 ASN N    1 1 
        1  2037 1 1 138 ASN ND2  N  -7.991 -16.168   4.557 1.00 . A A . 138 ASN ND2  1 1 
        1  2038 1 1 138 ASN O    O  -3.753 -15.437   6.025 1.00 . A A . 138 ASN O    1 1 
        1  2039 1 1 138 ASN OD1  O  -7.744 -13.955   4.733 1.00 . A A . 138 ASN OD1  1 1 
        1  2040 1 1 139 PRO C    C  -5.487 -15.329   8.619 1.00 . A A . 139 PRO C    1 1 
        1  2041 1 1 139 PRO CA   C  -4.892 -14.007   8.138 1.00 . A A . 139 PRO CA   1 1 
        1  2042 1 1 139 PRO CB   C  -5.606 -12.830   8.817 1.00 . A A . 139 PRO CB   1 1 
        1  2043 1 1 139 PRO CD   C  -5.932 -12.572   6.474 1.00 . A A . 139 PRO CD   1 1 
        1  2044 1 1 139 PRO CG   C  -5.774 -11.804   7.751 1.00 . A A . 139 PRO CG   1 1 
        1  2045 1 1 139 PRO HA   H  -3.842 -13.980   8.388 1.00 . A A . 139 PRO HA   1 1 
        1  2046 1 1 139 PRO HB2  H  -6.561 -13.161   9.199 1.00 . A A . 139 PRO HB2  1 1 
        1  2047 1 1 139 PRO HB3  H  -4.998 -12.458   9.629 1.00 . A A . 139 PRO HB3  1 1 
        1  2048 1 1 139 PRO HD2  H  -6.968 -12.840   6.321 1.00 . A A . 139 PRO HD2  1 1 
        1  2049 1 1 139 PRO HD3  H  -5.559 -11.999   5.639 1.00 . A A . 139 PRO HD3  1 1 
        1  2050 1 1 139 PRO HG2  H  -6.656 -11.211   7.944 1.00 . A A . 139 PRO HG2  1 1 
        1  2051 1 1 139 PRO HG3  H  -4.899 -11.174   7.704 1.00 . A A . 139 PRO HG3  1 1 
        1  2052 1 1 139 PRO N    N  -5.103 -13.766   6.706 1.00 . A A . 139 PRO N    1 1 
        1  2053 1 1 139 PRO O    O  -6.391 -15.885   7.987 1.00 . A A . 139 PRO O    1 1 
        1  2054 1 1 140 ALA C    C  -5.082 -18.316   9.750 1.00 . A A . 140 ALA C    1 1 
        1  2055 1 1 140 ALA CA   C  -5.431 -17.004  10.447 1.00 . A A . 140 ALA CA   1 1 
        1  2056 1 1 140 ALA CB   C  -6.931 -16.907  10.692 1.00 . A A . 140 ALA CB   1 1 
        1  2057 1 1 140 ALA H    H  -4.155 -15.366  10.095 1.00 . A A . 140 ALA H    1 1 
        1  2058 1 1 140 ALA HA   H  -4.952 -17.008  11.415 1.00 . A A . 140 ALA HA   1 1 
        1  2059 1 1 140 ALA HB1  H  -7.257 -17.755  11.277 1.00 . A A . 140 ALA HB1  1 1 
        1  2060 1 1 140 ALA HB2  H  -7.450 -16.900   9.745 1.00 . A A . 140 ALA HB2  1 1 
        1  2061 1 1 140 ALA HB3  H  -7.149 -15.994  11.228 1.00 . A A . 140 ALA HB3  1 1 
        1  2062 1 1 140 ALA N    N  -4.937 -15.823   9.732 1.00 . A A . 140 ALA N    1 1 
        1  2063 1 1 140 ALA O    O  -4.745 -19.298  10.409 1.00 . A A . 140 ALA O    1 1 
        1  2064 1 1 141 GLU C    C  -3.472 -19.941   7.537 1.00 . A A . 141 GLU C    1 1 
        1  2065 1 1 141 GLU CA   C  -4.950 -19.589   7.696 1.00 . A A . 141 GLU CA   1 1 
        1  2066 1 1 141 GLU CB   C  -5.631 -19.542   6.326 1.00 . A A . 141 GLU CB   1 1 
        1  2067 1 1 141 GLU CD   C  -5.541 -18.745   3.946 1.00 . A A . 141 GLU CD   1 1 
        1  2068 1 1 141 GLU CG   C  -5.031 -18.541   5.358 1.00 . A A . 141 GLU CG   1 1 
        1  2069 1 1 141 GLU H    H  -5.294 -17.500   7.939 1.00 . A A . 141 GLU H    1 1 
        1  2070 1 1 141 GLU HA   H  -5.415 -20.369   8.280 1.00 . A A . 141 GLU HA   1 1 
        1  2071 1 1 141 GLU HB2  H  -5.567 -20.521   5.875 1.00 . A A . 141 GLU HB2  1 1 
        1  2072 1 1 141 GLU HB3  H  -6.672 -19.292   6.469 1.00 . A A . 141 GLU HB3  1 1 
        1  2073 1 1 141 GLU HG2  H  -5.291 -17.544   5.680 1.00 . A A . 141 GLU HG2  1 1 
        1  2074 1 1 141 GLU HG3  H  -3.956 -18.652   5.358 1.00 . A A . 141 GLU HG3  1 1 
        1  2075 1 1 141 GLU N    N  -5.132 -18.338   8.428 1.00 . A A . 141 GLU N    1 1 
        1  2076 1 1 141 GLU O    O  -3.129 -21.087   7.248 1.00 . A A . 141 GLU O    1 1 
        1  2077 1 1 141 GLU OE1  O  -6.671 -18.312   3.651 1.00 . A A . 141 GLU OE1  1 1 
        1  2078 1 1 141 GLU OE2  O  -4.824 -19.363   3.133 1.00 . A A . 141 GLU OE2  1 1 
        1  2079 1 1 142 THR C    C  -0.483 -18.764   8.932 1.00 . A A . 142 THR C    1 1 
        1  2080 1 1 142 THR CA   C  -1.168 -19.200   7.632 1.00 . A A . 142 THR CA   1 1 
        1  2081 1 1 142 THR CB   C  -0.560 -18.469   6.408 1.00 . A A . 142 THR CB   1 1 
        1  2082 1 1 142 THR CG2  C  -0.578 -16.957   6.594 1.00 . A A . 142 THR CG2  1 1 
        1  2083 1 1 142 THR H    H  -2.926 -18.060   7.920 1.00 . A A . 142 THR H    1 1 
        1  2084 1 1 142 THR HA   H  -1.018 -20.262   7.502 1.00 . A A . 142 THR HA   1 1 
        1  2085 1 1 142 THR HB   H  -1.159 -18.712   5.541 1.00 . A A . 142 THR HB   1 1 
        1  2086 1 1 142 THR HG1  H   0.874 -19.827   6.493 1.00 . A A . 142 THR HG1  1 1 
        1  2087 1 1 142 THR HG21 H  -0.141 -16.485   5.727 1.00 . A A . 142 THR HG21 1 1 
        1  2088 1 1 142 THR HG22 H  -0.008 -16.696   7.472 1.00 . A A . 142 THR HG22 1 1 
        1  2089 1 1 142 THR HG23 H  -1.597 -16.622   6.712 1.00 . A A . 142 THR HG23 1 1 
        1  2090 1 1 142 THR N    N  -2.601 -18.962   7.724 1.00 . A A . 142 THR N    1 1 
        1  2091 1 1 142 THR O    O   0.712 -18.450   8.952 1.00 . A A . 142 THR O    1 1 
        1  2092 1 1 142 THR OG1  O   0.783 -18.914   6.177 1.00 . A A . 142 THR OG1  1 1 
        1  2093 1 1 143 ALA C    C  -0.788 -16.836  11.419 1.00 . A A . 143 ALA C    1 1 
        1  2094 1 1 143 ALA CA   C  -0.854 -18.361  11.352 1.00 . A A . 143 ALA CA   1 1 
        1  2095 1 1 143 ALA CB   C   0.478 -18.982  11.767 1.00 . A A . 143 ALA CB   1 1 
        1  2096 1 1 143 ALA H    H  -2.168 -19.186   9.917 1.00 . A A . 143 ALA H    1 1 
        1  2097 1 1 143 ALA HA   H  -1.606 -18.698  12.053 1.00 . A A . 143 ALA HA   1 1 
        1  2098 1 1 143 ALA HB1  H   0.403 -20.060  11.721 1.00 . A A . 143 ALA HB1  1 1 
        1  2099 1 1 143 ALA HB2  H   0.716 -18.682  12.776 1.00 . A A . 143 ALA HB2  1 1 
        1  2100 1 1 143 ALA HB3  H   1.257 -18.645  11.098 1.00 . A A . 143 ALA HB3  1 1 
        1  2101 1 1 143 ALA N    N  -1.267 -18.814  10.018 1.00 . A A . 143 ALA N    1 1 
        1  2102 1 1 143 ALA O    O  -0.375 -16.181  10.465 1.00 . A A . 143 ALA O    1 1 
        1  2103 1 1 144 PRO C    C   0.174 -14.184  12.736 1.00 . A A . 144 PRO C    1 1 
        1  2104 1 1 144 PRO CA   C  -1.219 -14.795  12.730 1.00 . A A . 144 PRO CA   1 1 
        1  2105 1 1 144 PRO CB   C  -1.892 -14.606  14.093 1.00 . A A . 144 PRO CB   1 1 
        1  2106 1 1 144 PRO CD   C  -1.648 -16.959  13.769 1.00 . A A . 144 PRO CD   1 1 
        1  2107 1 1 144 PRO CG   C  -1.652 -15.886  14.819 1.00 . A A . 144 PRO CG   1 1 
        1  2108 1 1 144 PRO HA   H  -1.814 -14.322  11.962 1.00 . A A . 144 PRO HA   1 1 
        1  2109 1 1 144 PRO HB2  H  -1.442 -13.768  14.606 1.00 . A A . 144 PRO HB2  1 1 
        1  2110 1 1 144 PRO HB3  H  -2.947 -14.425  13.954 1.00 . A A . 144 PRO HB3  1 1 
        1  2111 1 1 144 PRO HD2  H  -0.963 -17.749  14.039 1.00 . A A . 144 PRO HD2  1 1 
        1  2112 1 1 144 PRO HD3  H  -2.644 -17.351  13.628 1.00 . A A . 144 PRO HD3  1 1 
        1  2113 1 1 144 PRO HG2  H  -0.696 -15.851  15.322 1.00 . A A . 144 PRO HG2  1 1 
        1  2114 1 1 144 PRO HG3  H  -2.445 -16.060  15.530 1.00 . A A . 144 PRO HG3  1 1 
        1  2115 1 1 144 PRO N    N  -1.186 -16.251  12.560 1.00 . A A . 144 PRO N    1 1 
        1  2116 1 1 144 PRO O    O   0.385 -13.089  12.224 1.00 . A A . 144 PRO O    1 1 
        1  2117 1 1 145 ASP C    C   3.252 -14.510  12.106 1.00 . A A . 145 ASP C    1 1 
        1  2118 1 1 145 ASP CA   C   2.496 -14.444  13.429 1.00 . A A . 145 ASP CA   1 1 
        1  2119 1 1 145 ASP CB   C   3.227 -15.258  14.501 1.00 . A A . 145 ASP CB   1 1 
        1  2120 1 1 145 ASP CG   C   3.260 -16.740  14.186 1.00 . A A . 145 ASP CG   1 1 
        1  2121 1 1 145 ASP H    H   0.910 -15.838  13.583 1.00 . A A . 145 ASP H    1 1 
        1  2122 1 1 145 ASP HA   H   2.448 -13.414  13.748 1.00 . A A . 145 ASP HA   1 1 
        1  2123 1 1 145 ASP HB2  H   4.243 -14.904  14.582 1.00 . A A . 145 ASP HB2  1 1 
        1  2124 1 1 145 ASP HB3  H   2.727 -15.122  15.449 1.00 . A A . 145 ASP HB3  1 1 
        1  2125 1 1 145 ASP N    N   1.128 -14.926  13.280 1.00 . A A . 145 ASP N    1 1 
        1  2126 1 1 145 ASP O    O   4.463 -14.296  12.056 1.00 . A A . 145 ASP O    1 1 
        1  2127 1 1 145 ASP OD1  O   2.179 -17.359  14.119 1.00 . A A . 145 ASP OD1  1 1 
        1  2128 1 1 145 ASP OD2  O   4.362 -17.298  14.024 1.00 . A A . 145 ASP OD2  1 1 
        1  2129 1 1 146 GLN C    C   2.380 -13.776   8.821 1.00 . A A . 146 GLN C    1 1 
        1  2130 1 1 146 GLN CA   C   3.106 -14.783   9.699 1.00 . A A . 146 GLN CA   1 1 
        1  2131 1 1 146 GLN CB   C   3.090 -16.172   9.066 1.00 . A A . 146 GLN CB   1 1 
        1  2132 1 1 146 GLN CD   C   5.590 -16.476   9.204 1.00 . A A . 146 GLN CD   1 1 
        1  2133 1 1 146 GLN CG   C   4.229 -17.053   9.551 1.00 . A A . 146 GLN CG   1 1 
        1  2134 1 1 146 GLN H    H   1.593 -15.062  11.146 1.00 . A A . 146 GLN H    1 1 
        1  2135 1 1 146 GLN HA   H   4.133 -14.464   9.800 1.00 . A A . 146 GLN HA   1 1 
        1  2136 1 1 146 GLN HB2  H   2.154 -16.657   9.306 1.00 . A A . 146 GLN HB2  1 1 
        1  2137 1 1 146 GLN HB3  H   3.171 -16.071   7.995 1.00 . A A . 146 GLN HB3  1 1 
        1  2138 1 1 146 GLN HE21 H   5.625 -15.453  10.910 1.00 . A A . 146 GLN HE21 1 1 
        1  2139 1 1 146 GLN HE22 H   7.011 -15.261   9.886 1.00 . A A . 146 GLN HE22 1 1 
        1  2140 1 1 146 GLN HG2  H   4.160 -17.153  10.623 1.00 . A A . 146 GLN HG2  1 1 
        1  2141 1 1 146 GLN HG3  H   4.140 -18.025   9.089 1.00 . A A . 146 GLN HG3  1 1 
        1  2142 1 1 146 GLN N    N   2.533 -14.812  11.035 1.00 . A A . 146 GLN N    1 1 
        1  2143 1 1 146 GLN NE2  N   6.129 -15.648  10.087 1.00 . A A . 146 GLN NE2  1 1 
        1  2144 1 1 146 GLN O    O   2.642 -13.679   7.622 1.00 . A A . 146 GLN O    1 1 
        1  2145 1 1 146 GLN OE1  O   6.144 -16.757   8.139 1.00 . A A . 146 GLN OE1  1 1 
        1  2146 1 1 147 LEU C    C   1.793 -10.714   8.803 1.00 . A A . 147 LEU C    1 1 
        1  2147 1 1 147 LEU CA   C   0.853 -11.900   8.740 1.00 . A A . 147 LEU CA   1 1 
        1  2148 1 1 147 LEU CB   C  -0.504 -11.541   9.357 1.00 . A A . 147 LEU CB   1 1 
        1  2149 1 1 147 LEU CD1  C  -1.836 -11.972   7.278 1.00 . A A . 147 LEU CD1  1 1 
        1  2150 1 1 147 LEU CD2  C  -1.596 -13.775   8.989 1.00 . A A . 147 LEU CD2  1 1 
        1  2151 1 1 147 LEU CG   C  -1.709 -12.276   8.763 1.00 . A A . 147 LEU CG   1 1 
        1  2152 1 1 147 LEU H    H   1.224 -13.212  10.353 1.00 . A A . 147 LEU H    1 1 
        1  2153 1 1 147 LEU HA   H   0.711 -12.179   7.706 1.00 . A A . 147 LEU HA   1 1 
        1  2154 1 1 147 LEU HB2  H  -0.462 -11.758  10.415 1.00 . A A . 147 LEU HB2  1 1 
        1  2155 1 1 147 LEU HB3  H  -0.662 -10.480   9.232 1.00 . A A . 147 LEU HB3  1 1 
        1  2156 1 1 147 LEU HD11 H  -1.998 -10.913   7.139 1.00 . A A . 147 LEU HD11 1 1 
        1  2157 1 1 147 LEU HD12 H  -2.671 -12.521   6.868 1.00 . A A . 147 LEU HD12 1 1 
        1  2158 1 1 147 LEU HD13 H  -0.928 -12.266   6.771 1.00 . A A . 147 LEU HD13 1 1 
        1  2159 1 1 147 LEU HD21 H  -0.708 -14.146   8.499 1.00 . A A . 147 LEU HD21 1 1 
        1  2160 1 1 147 LEU HD22 H  -2.464 -14.268   8.580 1.00 . A A . 147 LEU HD22 1 1 
        1  2161 1 1 147 LEU HD23 H  -1.533 -13.977  10.047 1.00 . A A . 147 LEU HD23 1 1 
        1  2162 1 1 147 LEU HG   H  -2.609 -11.930   9.251 1.00 . A A . 147 LEU HG   1 1 
        1  2163 1 1 147 LEU N    N   1.472 -13.022   9.423 1.00 . A A . 147 LEU N    1 1 
        1  2164 1 1 147 LEU O    O   2.147 -10.253   9.887 1.00 . A A . 147 LEU O    1 1 
        1  2165 1 1 148 ARG C    C   2.685  -7.999   6.800 1.00 . A A . 148 ARG C    1 1 
        1  2166 1 1 148 ARG CA   C   3.214  -9.191   7.589 1.00 . A A . 148 ARG CA   1 1 
        1  2167 1 1 148 ARG CB   C   4.514  -9.735   6.982 1.00 . A A . 148 ARG CB   1 1 
        1  2168 1 1 148 ARG CD   C   5.331 -11.293   5.184 1.00 . A A . 148 ARG CD   1 1 
        1  2169 1 1 148 ARG CG   C   4.395 -10.144   5.523 1.00 . A A . 148 ARG CG   1 1 
        1  2170 1 1 148 ARG CZ   C   5.488 -13.662   5.890 1.00 . A A . 148 ARG CZ   1 1 
        1  2171 1 1 148 ARG H    H   1.855 -10.610   6.813 1.00 . A A . 148 ARG H    1 1 
        1  2172 1 1 148 ARG HA   H   3.411  -8.872   8.602 1.00 . A A . 148 ARG HA   1 1 
        1  2173 1 1 148 ARG HB2  H   5.278  -8.976   7.059 1.00 . A A . 148 ARG HB2  1 1 
        1  2174 1 1 148 ARG HB3  H   4.824 -10.599   7.550 1.00 . A A . 148 ARG HB3  1 1 
        1  2175 1 1 148 ARG HD2  H   5.506 -11.295   4.118 1.00 . A A . 148 ARG HD2  1 1 
        1  2176 1 1 148 ARG HD3  H   6.266 -11.144   5.703 1.00 . A A . 148 ARG HD3  1 1 
        1  2177 1 1 148 ARG HE   H   3.781 -12.663   5.583 1.00 . A A . 148 ARG HE   1 1 
        1  2178 1 1 148 ARG HG2  H   3.379 -10.455   5.331 1.00 . A A . 148 ARG HG2  1 1 
        1  2179 1 1 148 ARG HG3  H   4.637  -9.296   4.900 1.00 . A A . 148 ARG HG3  1 1 
        1  2180 1 1 148 ARG HH11 H   7.290 -12.739   5.731 1.00 . A A . 148 ARG HH11 1 1 
        1  2181 1 1 148 ARG HH12 H   7.345 -14.428   6.136 1.00 . A A . 148 ARG HH12 1 1 
        1  2182 1 1 148 ARG HH21 H   3.879 -14.859   6.169 1.00 . A A . 148 ARG HH21 1 1 
        1  2183 1 1 148 ARG HH22 H   5.423 -15.616   6.425 1.00 . A A . 148 ARG HH22 1 1 
        1  2184 1 1 148 ARG N    N   2.222 -10.246   7.647 1.00 . A A . 148 ARG N    1 1 
        1  2185 1 1 148 ARG NE   N   4.766 -12.585   5.578 1.00 . A A . 148 ARG NE   1 1 
        1  2186 1 1 148 ARG NH1  N   6.811 -13.601   5.929 1.00 . A A . 148 ARG NH1  1 1 
        1  2187 1 1 148 ARG NH2  N   4.882 -14.804   6.183 1.00 . A A . 148 ARG NH2  1 1 
        1  2188 1 1 148 ARG O    O   2.132  -8.148   5.710 1.00 . A A . 148 ARG O    1 1 
        1  2189 1 1 149 THR C    C   3.435  -4.509   6.900 1.00 . A A . 149 THR C    1 1 
        1  2190 1 1 149 THR CA   C   2.383  -5.596   6.748 1.00 . A A . 149 THR CA   1 1 
        1  2191 1 1 149 THR CB   C   1.060  -5.113   7.383 1.00 . A A . 149 THR CB   1 1 
        1  2192 1 1 149 THR CG2  C   0.574  -3.822   6.736 1.00 . A A . 149 THR CG2  1 1 
        1  2193 1 1 149 THR H    H   3.257  -6.777   8.262 1.00 . A A . 149 THR H    1 1 
        1  2194 1 1 149 THR HA   H   2.214  -5.789   5.699 1.00 . A A . 149 THR HA   1 1 
        1  2195 1 1 149 THR HB   H   1.233  -4.927   8.433 1.00 . A A . 149 THR HB   1 1 
        1  2196 1 1 149 THR HG1  H   0.062  -6.466   6.348 1.00 . A A . 149 THR HG1  1 1 
        1  2197 1 1 149 THR HG21 H   1.322  -3.054   6.860 1.00 . A A . 149 THR HG21 1 1 
        1  2198 1 1 149 THR HG22 H  -0.346  -3.508   7.205 1.00 . A A . 149 THR HG22 1 1 
        1  2199 1 1 149 THR HG23 H   0.402  -3.991   5.682 1.00 . A A . 149 THR HG23 1 1 
        1  2200 1 1 149 THR N    N   2.838  -6.822   7.374 1.00 . A A . 149 THR N    1 1 
        1  2201 1 1 149 THR O    O   3.608  -3.961   7.986 1.00 . A A . 149 THR O    1 1 
        1  2202 1 1 149 THR OG1  O   0.056  -6.126   7.250 1.00 . A A . 149 THR OG1  1 1 
        1  2203 1 1 150 ARG C    C   4.380  -1.805   5.820 1.00 . A A . 150 ARG C    1 1 
        1  2204 1 1 150 ARG CA   C   5.126  -3.130   5.879 1.00 . A A . 150 ARG CA   1 1 
        1  2205 1 1 150 ARG CB   C   6.176  -3.225   4.760 1.00 . A A . 150 ARG CB   1 1 
        1  2206 1 1 150 ARG CD   C   6.695  -3.092   2.302 1.00 . A A . 150 ARG CD   1 1 
        1  2207 1 1 150 ARG CG   C   5.606  -3.261   3.351 1.00 . A A . 150 ARG CG   1 1 
        1  2208 1 1 150 ARG CZ   C   8.100  -1.271   1.380 1.00 . A A . 150 ARG CZ   1 1 
        1  2209 1 1 150 ARG H    H   4.053  -4.736   5.010 1.00 . A A . 150 ARG H    1 1 
        1  2210 1 1 150 ARG HA   H   5.631  -3.189   6.835 1.00 . A A . 150 ARG HA   1 1 
        1  2211 1 1 150 ARG HB2  H   6.831  -2.370   4.830 1.00 . A A . 150 ARG HB2  1 1 
        1  2212 1 1 150 ARG HB3  H   6.758  -4.122   4.910 1.00 . A A . 150 ARG HB3  1 1 
        1  2213 1 1 150 ARG HD2  H   7.450  -3.848   2.466 1.00 . A A . 150 ARG HD2  1 1 
        1  2214 1 1 150 ARG HD3  H   6.258  -3.230   1.325 1.00 . A A . 150 ARG HD3  1 1 
        1  2215 1 1 150 ARG HE   H   7.171  -1.223   3.163 1.00 . A A . 150 ARG HE   1 1 
        1  2216 1 1 150 ARG HG2  H   5.116  -4.212   3.197 1.00 . A A . 150 ARG HG2  1 1 
        1  2217 1 1 150 ARG HG3  H   4.886  -2.463   3.243 1.00 . A A . 150 ARG HG3  1 1 
        1  2218 1 1 150 ARG HH11 H   7.945  -2.904   0.196 1.00 . A A . 150 ARG HH11 1 1 
        1  2219 1 1 150 ARG HH12 H   8.910  -1.619  -0.460 1.00 . A A . 150 ARG HH12 1 1 
        1  2220 1 1 150 ARG HH21 H   8.450   0.494   2.316 1.00 . A A . 150 ARG HH21 1 1 
        1  2221 1 1 150 ARG HH22 H   9.206   0.318   0.763 1.00 . A A . 150 ARG HH22 1 1 
        1  2222 1 1 150 ARG N    N   4.168  -4.221   5.833 1.00 . A A . 150 ARG N    1 1 
        1  2223 1 1 150 ARG NE   N   7.332  -1.770   2.357 1.00 . A A . 150 ARG NE   1 1 
        1  2224 1 1 150 ARG NH1  N   8.338  -1.991   0.289 1.00 . A A . 150 ARG NH1  1 1 
        1  2225 1 1 150 ARG NH2  N   8.627  -0.056   1.497 1.00 . A A . 150 ARG NH2  1 1 
        1  2226 1 1 150 ARG O    O   3.975  -1.344   4.753 1.00 . A A . 150 ARG O    1 1 
        1  2227 1 1 151 VAL C    C   4.374   1.204   6.940 1.00 . A A . 151 VAL C    1 1 
        1  2228 1 1 151 VAL CA   C   3.428   0.022   7.075 1.00 . A A . 151 VAL CA   1 1 
        1  2229 1 1 151 VAL CB   C   2.612   0.112   8.392 1.00 . A A . 151 VAL CB   1 1 
        1  2230 1 1 151 VAL CG1  C   3.501  -0.036   9.618 1.00 . A A . 151 VAL CG1  1 1 
        1  2231 1 1 151 VAL CG2  C   1.825   1.414   8.453 1.00 . A A . 151 VAL CG2  1 1 
        1  2232 1 1 151 VAL H    H   4.532  -1.623   7.802 1.00 . A A . 151 VAL H    1 1 
        1  2233 1 1 151 VAL HA   H   2.732   0.046   6.248 1.00 . A A . 151 VAL HA   1 1 
        1  2234 1 1 151 VAL HB   H   1.903  -0.703   8.399 1.00 . A A . 151 VAL HB   1 1 
        1  2235 1 1 151 VAL HG11 H   4.017  -0.984   9.577 1.00 . A A . 151 VAL HG11 1 1 
        1  2236 1 1 151 VAL HG12 H   2.893   0.004  10.509 1.00 . A A . 151 VAL HG12 1 1 
        1  2237 1 1 151 VAL HG13 H   4.223   0.767   9.639 1.00 . A A . 151 VAL HG13 1 1 
        1  2238 1 1 151 VAL HG21 H   1.282   1.463   9.385 1.00 . A A . 151 VAL HG21 1 1 
        1  2239 1 1 151 VAL HG22 H   1.128   1.454   7.629 1.00 . A A . 151 VAL HG22 1 1 
        1  2240 1 1 151 VAL HG23 H   2.506   2.250   8.389 1.00 . A A . 151 VAL HG23 1 1 
        1  2241 1 1 151 VAL N    N   4.169  -1.216   6.983 1.00 . A A . 151 VAL N    1 1 
        1  2242 1 1 151 VAL O    O   5.296   1.388   7.736 1.00 . A A . 151 VAL O    1 1 
        1  2243 1 1 152 SER C    C   4.119   4.373   5.758 1.00 . A A . 152 SER C    1 1 
        1  2244 1 1 152 SER CA   C   4.982   3.132   5.632 1.00 . A A . 152 SER CA   1 1 
        1  2245 1 1 152 SER CB   C   5.604   3.036   4.235 1.00 . A A . 152 SER CB   1 1 
        1  2246 1 1 152 SER H    H   3.430   1.754   5.278 1.00 . A A . 152 SER H    1 1 
        1  2247 1 1 152 SER HA   H   5.768   3.169   6.373 1.00 . A A . 152 SER HA   1 1 
        1  2248 1 1 152 SER HB2  H   6.022   2.049   4.097 1.00 . A A . 152 SER HB2  1 1 
        1  2249 1 1 152 SER HB3  H   4.840   3.211   3.491 1.00 . A A . 152 SER HB3  1 1 
        1  2250 1 1 152 SER HG   H   6.984   4.237   4.929 1.00 . A A . 152 SER HG   1 1 
        1  2251 1 1 152 SER N    N   4.168   1.971   5.892 1.00 . A A . 152 SER N    1 1 
        1  2252 1 1 152 SER O    O   2.951   4.358   5.374 1.00 . A A . 152 SER O    1 1 
        1  2253 1 1 152 SER OG   O   6.632   3.994   4.065 1.00 . A A . 152 SER OG   1 1 
        1  2254 1 1 153 LEU C    C   4.696   7.894   6.145 1.00 . A A . 153 LEU C    1 1 
        1  2255 1 1 153 LEU CA   C   3.886   6.655   6.484 1.00 . A A . 153 LEU CA   1 1 
        1  2256 1 1 153 LEU CB   C   3.261   6.784   7.896 1.00 . A A . 153 LEU CB   1 1 
        1  2257 1 1 153 LEU CD1  C   4.164   4.856   9.258 1.00 . A A . 153 LEU CD1  1 1 
        1  2258 1 1 153 LEU CD2  C   5.515   6.956   9.062 1.00 . A A . 153 LEU CD2  1 1 
        1  2259 1 1 153 LEU CG   C   4.109   6.369   9.119 1.00 . A A . 153 LEU CG   1 1 
        1  2260 1 1 153 LEU H    H   5.607   5.397   6.627 1.00 . A A . 153 LEU H    1 1 
        1  2261 1 1 153 LEU HA   H   3.076   6.595   5.770 1.00 . A A . 153 LEU HA   1 1 
        1  2262 1 1 153 LEU HB2  H   2.980   7.816   8.033 1.00 . A A . 153 LEU HB2  1 1 
        1  2263 1 1 153 LEU HB3  H   2.358   6.190   7.905 1.00 . A A . 153 LEU HB3  1 1 
        1  2264 1 1 153 LEU HD11 H   4.759   4.597  10.121 1.00 . A A . 153 LEU HD11 1 1 
        1  2265 1 1 153 LEU HD12 H   4.608   4.429   8.371 1.00 . A A . 153 LEU HD12 1 1 
        1  2266 1 1 153 LEU HD13 H   3.162   4.470   9.381 1.00 . A A . 153 LEU HD13 1 1 
        1  2267 1 1 153 LEU HD21 H   5.996   6.651   8.144 1.00 . A A . 153 LEU HD21 1 1 
        1  2268 1 1 153 LEU HD22 H   6.090   6.601   9.904 1.00 . A A . 153 LEU HD22 1 1 
        1  2269 1 1 153 LEU HD23 H   5.457   8.034   9.095 1.00 . A A . 153 LEU HD23 1 1 
        1  2270 1 1 153 LEU HG   H   3.632   6.753  10.008 1.00 . A A . 153 LEU HG   1 1 
        1  2271 1 1 153 LEU N    N   4.664   5.433   6.322 1.00 . A A . 153 LEU N    1 1 
        1  2272 1 1 153 LEU O    O   5.896   7.814   5.867 1.00 . A A . 153 LEU O    1 1 
        1  2273 1 1 154 MET C    C   5.572  10.710   7.015 1.00 . A A . 154 MET C    1 1 
        1  2274 1 1 154 MET CA   C   4.652  10.309   5.872 1.00 . A A . 154 MET CA   1 1 
        1  2275 1 1 154 MET CB   C   3.585  11.372   5.628 1.00 . A A . 154 MET CB   1 1 
        1  2276 1 1 154 MET CE   C   0.379  11.422   5.759 1.00 . A A . 154 MET CE   1 1 
        1  2277 1 1 154 MET CG   C   2.747  11.097   4.389 1.00 . A A . 154 MET CG   1 1 
        1  2278 1 1 154 MET H    H   3.066   9.023   6.382 1.00 . A A . 154 MET H    1 1 
        1  2279 1 1 154 MET HA   H   5.241  10.190   4.976 1.00 . A A . 154 MET HA   1 1 
        1  2280 1 1 154 MET HB2  H   2.927  11.410   6.484 1.00 . A A . 154 MET HB2  1 1 
        1  2281 1 1 154 MET HB3  H   4.066  12.331   5.509 1.00 . A A . 154 MET HB3  1 1 
        1  2282 1 1 154 MET HE1  H   0.228  10.360   5.634 1.00 . A A . 154 MET HE1  1 1 
        1  2283 1 1 154 MET HE2  H  -0.578  11.913   5.859 1.00 . A A . 154 MET HE2  1 1 
        1  2284 1 1 154 MET HE3  H   0.970  11.600   6.644 1.00 . A A . 154 MET HE3  1 1 
        1  2285 1 1 154 MET HG2  H   3.338  11.323   3.514 1.00 . A A . 154 MET HG2  1 1 
        1  2286 1 1 154 MET HG3  H   2.479  10.051   4.379 1.00 . A A . 154 MET HG3  1 1 
        1  2287 1 1 154 MET N    N   4.021   9.036   6.160 1.00 . A A . 154 MET N    1 1 
        1  2288 1 1 154 MET O    O   5.322  10.386   8.175 1.00 . A A . 154 MET O    1 1 
        1  2289 1 1 154 MET SD   S   1.239  12.075   4.330 1.00 . A A . 154 MET SD   1 1 
        1  2290 1 1 155 LEU C    C   7.487  13.045   8.307 1.00 . A A . 155 LEU C    1 1 
        1  2291 1 1 155 LEU CA   C   7.684  11.694   7.640 1.00 . A A . 155 LEU CA   1 1 
        1  2292 1 1 155 LEU CB   C   9.045  11.650   6.951 1.00 . A A . 155 LEU CB   1 1 
        1  2293 1 1 155 LEU CD1  C  10.750  10.390   5.614 1.00 . A A . 155 LEU CD1  1 1 
        1  2294 1 1 155 LEU CD2  C   9.186   9.166   7.121 1.00 . A A . 155 LEU CD2  1 1 
        1  2295 1 1 155 LEU CG   C   9.349  10.356   6.199 1.00 . A A . 155 LEU CG   1 1 
        1  2296 1 1 155 LEU H    H   6.724  11.742   5.769 1.00 . A A . 155 LEU H    1 1 
        1  2297 1 1 155 LEU HA   H   7.655  10.926   8.399 1.00 . A A . 155 LEU HA   1 1 
        1  2298 1 1 155 LEU HB2  H   9.095  12.470   6.249 1.00 . A A . 155 LEU HB2  1 1 
        1  2299 1 1 155 LEU HB3  H   9.809  11.793   7.699 1.00 . A A . 155 LEU HB3  1 1 
        1  2300 1 1 155 LEU HD11 H  11.469  10.537   6.408 1.00 . A A . 155 LEU HD11 1 1 
        1  2301 1 1 155 LEU HD12 H  10.825  11.202   4.906 1.00 . A A . 155 LEU HD12 1 1 
        1  2302 1 1 155 LEU HD13 H  10.953   9.455   5.112 1.00 . A A . 155 LEU HD13 1 1 
        1  2303 1 1 155 LEU HD21 H   9.450   8.262   6.591 1.00 . A A . 155 LEU HD21 1 1 
        1  2304 1 1 155 LEU HD22 H   8.159   9.103   7.449 1.00 . A A . 155 LEU HD22 1 1 
        1  2305 1 1 155 LEU HD23 H   9.832   9.283   7.979 1.00 . A A . 155 LEU HD23 1 1 
        1  2306 1 1 155 LEU HG   H   8.649  10.247   5.384 1.00 . A A . 155 LEU HG   1 1 
        1  2307 1 1 155 LEU N    N   6.638  11.408   6.680 1.00 . A A . 155 LEU N    1 1 
        1  2308 1 1 155 LEU O    O   7.715  14.083   7.693 1.00 . A A . 155 LEU O    1 1 
        1  2309 1 1 156 HIS C    C   6.086  15.292   9.842 1.00 . A A . 156 HIS C    1 1 
        1  2310 1 1 156 HIS CA   C   7.007  14.204  10.406 1.00 . A A . 156 HIS CA   1 1 
        1  2311 1 1 156 HIS CB   C   8.444  14.730  10.586 1.00 . A A . 156 HIS CB   1 1 
        1  2312 1 1 156 HIS CD2  C   8.781  17.222  11.209 1.00 . A A . 156 HIS CD2  1 1 
        1  2313 1 1 156 HIS CE1  C   8.721  17.019  13.385 1.00 . A A . 156 HIS CE1  1 1 
        1  2314 1 1 156 HIS CG   C   8.577  15.916  11.490 1.00 . A A . 156 HIS CG   1 1 
        1  2315 1 1 156 HIS H    H   6.682  12.170   9.910 1.00 . A A . 156 HIS H    1 1 
        1  2316 1 1 156 HIS HA   H   6.628  13.904  11.372 1.00 . A A . 156 HIS HA   1 1 
        1  2317 1 1 156 HIS HB2  H   9.054  13.941  10.997 1.00 . A A . 156 HIS HB2  1 1 
        1  2318 1 1 156 HIS HB3  H   8.836  15.006   9.618 1.00 . A A . 156 HIS HB3  1 1 
        1  2319 1 1 156 HIS HD1  H   8.398  14.995  13.379 1.00 . A A . 156 HIS HD1  1 1 
        1  2320 1 1 156 HIS HD2  H   8.863  17.660  10.224 1.00 . A A . 156 HIS HD2  1 1 
        1  2321 1 1 156 HIS HE1  H   8.747  17.248  14.440 1.00 . A A . 156 HIS HE1  1 1 
        1  2322 1 1 156 HIS HE2  H   9.192  18.809  12.511 1.00 . A A . 156 HIS HE2  1 1 
        1  2323 1 1 156 HIS N    N   7.030  13.015   9.555 1.00 . A A . 156 HIS N    1 1 
        1  2324 1 1 156 HIS ND1  N   8.543  15.823  12.861 1.00 . A A . 156 HIS ND1  1 1 
        1  2325 1 1 156 HIS NE2  N   8.867  17.887  12.403 1.00 . A A . 156 HIS NE2  1 1 
        1  2326 1 1 156 HIS O    O   6.543  16.254   9.226 1.00 . A A . 156 HIS O    1 1 
        1  2327 1 1 157 GLU C    C   2.730  16.301  10.702 1.00 . A A . 157 GLU C    1 1 
        1  2328 1 1 157 GLU CA   C   3.811  16.128   9.634 1.00 . A A . 157 GLU CA   1 1 
        1  2329 1 1 157 GLU CB   C   3.191  15.803   8.258 1.00 . A A . 157 GLU CB   1 1 
        1  2330 1 1 157 GLU CD   C   2.208  13.525   8.814 1.00 . A A . 157 GLU CD   1 1 
        1  2331 1 1 157 GLU CG   C   3.121  14.317   7.903 1.00 . A A . 157 GLU CG   1 1 
        1  2332 1 1 157 GLU H    H   4.471  14.292  10.461 1.00 . A A . 157 GLU H    1 1 
        1  2333 1 1 157 GLU HA   H   4.346  17.064   9.552 1.00 . A A . 157 GLU HA   1 1 
        1  2334 1 1 157 GLU HB2  H   2.186  16.195   8.237 1.00 . A A . 157 GLU HB2  1 1 
        1  2335 1 1 157 GLU HB3  H   3.772  16.302   7.495 1.00 . A A . 157 GLU HB3  1 1 
        1  2336 1 1 157 GLU HG2  H   2.760  14.220   6.890 1.00 . A A . 157 GLU HG2  1 1 
        1  2337 1 1 157 GLU HG3  H   4.117  13.901   7.968 1.00 . A A . 157 GLU HG3  1 1 
        1  2338 1 1 157 GLU N    N   4.786  15.119  10.035 1.00 . A A . 157 GLU N    1 1 
        1  2339 1 1 157 GLU O    O   2.462  17.418  11.149 1.00 . A A . 157 GLU O    1 1 
        1  2340 1 1 157 GLU OE1  O   0.975  13.562   8.615 1.00 . A A . 157 GLU OE1  1 1 
        1  2341 1 1 157 GLU OE2  O   2.722  12.894   9.760 1.00 . A A . 157 GLU OE2  1 1 
        1  2342 1 1 158 SER C    C   0.697  13.746  12.431 1.00 . A A . 158 SER C    1 1 
        1  2343 1 1 158 SER CA   C   1.083  15.187  12.114 1.00 . A A . 158 SER CA   1 1 
        1  2344 1 1 158 SER CB   C  -0.132  15.960  11.592 1.00 . A A . 158 SER CB   1 1 
        1  2345 1 1 158 SER H    H   2.422  14.327  10.732 1.00 . A A . 158 SER H    1 1 
        1  2346 1 1 158 SER HA   H   1.456  15.661  13.010 1.00 . A A . 158 SER HA   1 1 
        1  2347 1 1 158 SER HB2  H   0.180  16.948  11.289 1.00 . A A . 158 SER HB2  1 1 
        1  2348 1 1 158 SER HB3  H  -0.546  15.440  10.740 1.00 . A A . 158 SER HB3  1 1 
        1  2349 1 1 158 SER HG   H  -1.934  16.459  12.172 1.00 . A A . 158 SER HG   1 1 
        1  2350 1 1 158 SER N    N   2.140  15.190  11.121 1.00 . A A . 158 SER N    1 1 
        1  2351 1 1 158 SER O    O   0.964  13.253  13.529 1.00 . A A . 158 SER O    1 1 
        1  2352 1 1 158 SER OG   O  -1.139  16.089  12.580 1.00 . A A . 158 SER OG   1 1 
        1  2353 1 1 159 LEU C    C  -1.092  11.428  12.839 1.00 . A A . 159 LEU C    1 1 
        1  2354 1 1 159 LEU CA   C  -0.332  11.686  11.536 1.00 . A A . 159 LEU CA   1 1 
        1  2355 1 1 159 LEU CB   C   0.879  10.745  11.422 1.00 . A A . 159 LEU CB   1 1 
        1  2356 1 1 159 LEU CD1  C  -0.395   8.580  11.126 1.00 . A A . 159 LEU CD1  1 1 
        1  2357 1 1 159 LEU CD2  C   0.325   9.888   9.124 1.00 . A A . 159 LEU CD2  1 1 
        1  2358 1 1 159 LEU CG   C   0.677   9.492  10.550 1.00 . A A . 159 LEU CG   1 1 
        1  2359 1 1 159 LEU H    H  -0.026  13.543  10.576 1.00 . A A . 159 LEU H    1 1 
        1  2360 1 1 159 LEU HA   H  -0.998  11.492  10.708 1.00 . A A . 159 LEU HA   1 1 
        1  2361 1 1 159 LEU HB2  H   1.705  11.309  11.013 1.00 . A A . 159 LEU HB2  1 1 
        1  2362 1 1 159 LEU HB3  H   1.148  10.421  12.416 1.00 . A A . 159 LEU HB3  1 1 
        1  2363 1 1 159 LEU HD11 H  -1.335   9.110  11.164 1.00 . A A . 159 LEU HD11 1 1 
        1  2364 1 1 159 LEU HD12 H  -0.113   8.277  12.124 1.00 . A A . 159 LEU HD12 1 1 
        1  2365 1 1 159 LEU HD13 H  -0.499   7.706  10.501 1.00 . A A . 159 LEU HD13 1 1 
        1  2366 1 1 159 LEU HD21 H   1.125  10.482   8.707 1.00 . A A . 159 LEU HD21 1 1 
        1  2367 1 1 159 LEU HD22 H  -0.588  10.465   9.127 1.00 . A A . 159 LEU HD22 1 1 
        1  2368 1 1 159 LEU HD23 H   0.188   8.999   8.526 1.00 . A A . 159 LEU HD23 1 1 
        1  2369 1 1 159 LEU HG   H   1.602   8.935  10.520 1.00 . A A . 159 LEU HG   1 1 
        1  2370 1 1 159 LEU N    N   0.103  13.081  11.434 1.00 . A A . 159 LEU N    1 1 
        1  2371 1 1 159 LEU O    O  -0.880  10.412  13.507 1.00 . A A . 159 LEU O    1 1 
        1  2372 1 1 160 GLU C    C  -3.926  11.186  14.140 1.00 . A A . 160 GLU C    1 1 
        1  2373 1 1 160 GLU CA   C  -2.776  12.143  14.404 1.00 . A A . 160 GLU CA   1 1 
        1  2374 1 1 160 GLU CB   C  -3.300  13.460  14.979 1.00 . A A . 160 GLU CB   1 1 
        1  2375 1 1 160 GLU CD   C  -4.440  14.542  16.963 1.00 . A A . 160 GLU CD   1 1 
        1  2376 1 1 160 GLU CG   C  -4.120  13.255  16.245 1.00 . A A . 160 GLU CG   1 1 
        1  2377 1 1 160 GLU H    H  -2.117  13.140  12.661 1.00 . A A . 160 GLU H    1 1 
        1  2378 1 1 160 GLU HA   H  -2.125  11.688  15.133 1.00 . A A . 160 GLU HA   1 1 
        1  2379 1 1 160 GLU HB2  H  -2.462  14.102  15.212 1.00 . A A . 160 GLU HB2  1 1 
        1  2380 1 1 160 GLU HB3  H  -3.924  13.942  14.242 1.00 . A A . 160 GLU HB3  1 1 
        1  2381 1 1 160 GLU HG2  H  -5.047  12.770  15.982 1.00 . A A . 160 GLU HG2  1 1 
        1  2382 1 1 160 GLU HG3  H  -3.562  12.617  16.916 1.00 . A A . 160 GLU HG3  1 1 
        1  2383 1 1 160 GLU N    N  -1.989  12.336  13.203 1.00 . A A . 160 GLU N    1 1 
        1  2384 1 1 160 GLU O    O  -5.010  11.580  13.709 1.00 . A A . 160 GLU O    1 1 
        1  2385 1 1 160 GLU OE1  O  -5.245  15.336  16.440 1.00 . A A . 160 GLU OE1  1 1 
        1  2386 1 1 160 GLU OE2  O  -3.894  14.756  18.067 1.00 . A A . 160 GLU OE2  1 1 
        1  2387 1 1 161 HIS C    C  -4.506   7.983  15.505 1.00 . A A . 161 HIS C    1 1 
        1  2388 1 1 161 HIS CA   C  -4.655   8.878  14.288 1.00 . A A . 161 HIS CA   1 1 
        1  2389 1 1 161 HIS CB   C  -4.504   8.077  12.986 1.00 . A A . 161 HIS CB   1 1 
        1  2390 1 1 161 HIS CD2  C  -5.000   5.543  12.819 1.00 . A A . 161 HIS CD2  1 1 
        1  2391 1 1 161 HIS CE1  C  -7.183   5.623  12.901 1.00 . A A . 161 HIS CE1  1 1 
        1  2392 1 1 161 HIS CG   C  -5.353   6.843  12.915 1.00 . A A . 161 HIS CG   1 1 
        1  2393 1 1 161 HIS H    H  -2.724   9.668  14.571 1.00 . A A . 161 HIS H    1 1 
        1  2394 1 1 161 HIS HA   H  -5.627   9.349  14.311 1.00 . A A . 161 HIS HA   1 1 
        1  2395 1 1 161 HIS HB2  H  -4.774   8.707  12.152 1.00 . A A . 161 HIS HB2  1 1 
        1  2396 1 1 161 HIS HB3  H  -3.473   7.774  12.879 1.00 . A A . 161 HIS HB3  1 1 
        1  2397 1 1 161 HIS HD1  H  -7.293   7.665  13.037 1.00 . A A . 161 HIS HD1  1 1 
        1  2398 1 1 161 HIS HD2  H  -3.992   5.159  12.751 1.00 . A A . 161 HIS HD2  1 1 
        1  2399 1 1 161 HIS HE1  H  -8.224   5.333  12.915 1.00 . A A . 161 HIS HE1  1 1 
        1  2400 1 1 161 HIS HE2  H  -6.192   3.843  13.062 1.00 . A A . 161 HIS HE2  1 1 
        1  2401 1 1 161 HIS N    N  -3.650   9.918  14.357 1.00 . A A . 161 HIS N    1 1 
        1  2402 1 1 161 HIS ND1  N  -6.728   6.860  12.962 1.00 . A A . 161 HIS ND1  1 1 
        1  2403 1 1 161 HIS NE2  N  -6.153   4.799  12.815 1.00 . A A . 161 HIS NE2  1 1 
        1  2404 1 1 161 HIS O    O  -3.467   7.352  15.684 1.00 . A A . 161 HIS O    1 1 
        1  2405 1 1 162 HIS C    C  -6.821   6.614  17.946 1.00 . A A . 162 HIS C    1 1 
        1  2406 1 1 162 HIS CA   C  -5.462   7.188  17.593 1.00 . A A . 162 HIS CA   1 1 
        1  2407 1 1 162 HIS CB   C  -4.966   8.048  18.761 1.00 . A A . 162 HIS CB   1 1 
        1  2408 1 1 162 HIS CD2  C  -2.415   7.636  18.707 1.00 . A A . 162 HIS CD2  1 1 
        1  2409 1 1 162 HIS CE1  C  -1.746   9.712  18.513 1.00 . A A . 162 HIS CE1  1 1 
        1  2410 1 1 162 HIS CG   C  -3.518   8.414  18.679 1.00 . A A . 162 HIS CG   1 1 
        1  2411 1 1 162 HIS H    H  -6.337   8.473  16.150 1.00 . A A . 162 HIS H    1 1 
        1  2412 1 1 162 HIS HA   H  -4.769   6.373  17.440 1.00 . A A . 162 HIS HA   1 1 
        1  2413 1 1 162 HIS HB2  H  -5.537   8.963  18.791 1.00 . A A . 162 HIS HB2  1 1 
        1  2414 1 1 162 HIS HB3  H  -5.120   7.506  19.684 1.00 . A A . 162 HIS HB3  1 1 
        1  2415 1 1 162 HIS HD1  H  -3.631  10.518  18.546 1.00 . A A . 162 HIS HD1  1 1 
        1  2416 1 1 162 HIS HD2  H  -2.394   6.559  18.797 1.00 . A A . 162 HIS HD2  1 1 
        1  2417 1 1 162 HIS HE1  H  -1.116  10.584  18.418 1.00 . A A . 162 HIS HE1  1 1 
        1  2418 1 1 162 HIS HE2  H  -0.388   8.164  18.517 1.00 . A A . 162 HIS HE2  1 1 
        1  2419 1 1 162 HIS N    N  -5.521   7.961  16.358 1.00 . A A . 162 HIS N    1 1 
        1  2420 1 1 162 HIS ND1  N  -3.067   9.713  18.560 1.00 . A A . 162 HIS ND1  1 1 
        1  2421 1 1 162 HIS NE2  N  -1.330   8.464  18.602 1.00 . A A . 162 HIS NE2  1 1 
        1  2422 1 1 162 HIS O    O  -7.829   7.324  17.925 1.00 . A A . 162 HIS O    1 1 
        1  2423 1 1 163 HIS C    C  -8.189   4.944  20.254 1.00 . A A . 163 HIS C    1 1 
        1  2424 1 1 163 HIS CA   C  -8.039   4.673  18.759 1.00 . A A . 163 HIS CA   1 1 
        1  2425 1 1 163 HIS CB   C  -7.977   3.164  18.488 1.00 . A A . 163 HIS CB   1 1 
        1  2426 1 1 163 HIS CD2  C -10.396   2.253  18.757 1.00 . A A . 163 HIS CD2  1 1 
        1  2427 1 1 163 HIS CE1  C -10.071   1.029  20.544 1.00 . A A . 163 HIS CE1  1 1 
        1  2428 1 1 163 HIS CG   C  -9.095   2.381  19.108 1.00 . A A . 163 HIS CG   1 1 
        1  2429 1 1 163 HIS H    H  -6.021   4.795  18.148 1.00 . A A . 163 HIS H    1 1 
        1  2430 1 1 163 HIS HA   H  -8.887   5.094  18.240 1.00 . A A . 163 HIS HA   1 1 
        1  2431 1 1 163 HIS HB2  H  -8.012   2.997  17.422 1.00 . A A . 163 HIS HB2  1 1 
        1  2432 1 1 163 HIS HB3  H  -7.046   2.777  18.876 1.00 . A A . 163 HIS HB3  1 1 
        1  2433 1 1 163 HIS HD1  H  -8.073   1.479  20.725 1.00 . A A . 163 HIS HD1  1 1 
        1  2434 1 1 163 HIS HD2  H -10.885   2.731  17.919 1.00 . A A . 163 HIS HD2  1 1 
        1  2435 1 1 163 HIS HE1  H -10.238   0.365  21.378 1.00 . A A . 163 HIS HE1  1 1 
        1  2436 1 1 163 HIS HE2  H -11.944   1.199  19.722 1.00 . A A . 163 HIS HE2  1 1 
        1  2437 1 1 163 HIS N    N  -6.838   5.325  18.261 1.00 . A A . 163 HIS N    1 1 
        1  2438 1 1 163 HIS ND1  N  -8.927   1.603  20.231 1.00 . A A . 163 HIS ND1  1 1 
        1  2439 1 1 163 HIS NE2  N -10.980   1.408  19.666 1.00 . A A . 163 HIS NE2  1 1 
        1  2440 1 1 163 HIS O    O  -9.219   5.457  20.695 1.00 . A A . 163 HIS O    1 1 
        1  2441 1 1 164 HIS C    C  -8.091   3.909  23.194 1.00 . A A . 164 HIS C    1 1 
        1  2442 1 1 164 HIS CA   C  -7.108   4.823  22.462 1.00 . A A . 164 HIS CA   1 1 
        1  2443 1 1 164 HIS CB   C  -7.379   6.303  22.792 1.00 . A A . 164 HIS CB   1 1 
        1  2444 1 1 164 HIS CD2  C  -8.554   6.687  25.076 1.00 . A A . 164 HIS CD2  1 1 
        1  2445 1 1 164 HIS CE1  C  -6.780   7.092  26.289 1.00 . A A . 164 HIS CE1  1 1 
        1  2446 1 1 164 HIS CG   C  -7.477   6.606  24.259 1.00 . A A . 164 HIS CG   1 1 
        1  2447 1 1 164 HIS H    H  -6.386   4.146  20.591 1.00 . A A . 164 HIS H    1 1 
        1  2448 1 1 164 HIS HA   H  -6.111   4.575  22.796 1.00 . A A . 164 HIS HA   1 1 
        1  2449 1 1 164 HIS HB2  H  -6.581   6.904  22.386 1.00 . A A . 164 HIS HB2  1 1 
        1  2450 1 1 164 HIS HB3  H  -8.311   6.597  22.329 1.00 . A A . 164 HIS HB3  1 1 
        1  2451 1 1 164 HIS HD1  H  -5.442   6.876  24.752 1.00 . A A . 164 HIS HD1  1 1 
        1  2452 1 1 164 HIS HD2  H  -9.586   6.543  24.789 1.00 . A A . 164 HIS HD2  1 1 
        1  2453 1 1 164 HIS HE1  H  -6.138   7.327  27.123 1.00 . A A . 164 HIS HE1  1 1 
        1  2454 1 1 164 HIS HE2  H  -8.607   6.821  27.170 1.00 . A A . 164 HIS HE2  1 1 
        1  2455 1 1 164 HIS N    N  -7.149   4.593  21.015 1.00 . A A . 164 HIS N    1 1 
        1  2456 1 1 164 HIS ND1  N  -6.382   6.867  25.051 1.00 . A A . 164 HIS ND1  1 1 
        1  2457 1 1 164 HIS NE2  N  -8.095   6.988  26.335 1.00 . A A . 164 HIS NE2  1 1 
        1  2458 1 1 164 HIS O    O  -9.302   4.128  23.165 1.00 . A A . 164 HIS O    1 1 
        1  2459 1 1 165 HIS C    C  -8.263   2.172  26.105 1.00 . A A . 165 HIS C    1 1 
        1  2460 1 1 165 HIS CA   C  -8.401   1.954  24.597 1.00 . A A . 165 HIS CA   1 1 
        1  2461 1 1 165 HIS CB   C  -8.100   0.488  24.201 1.00 . A A . 165 HIS CB   1 1 
        1  2462 1 1 165 HIS CD2  C  -6.308  -0.870  25.514 1.00 . A A . 165 HIS CD2  1 1 
        1  2463 1 1 165 HIS CE1  C  -4.546  -0.294  24.355 1.00 . A A . 165 HIS CE1  1 1 
        1  2464 1 1 165 HIS CG   C  -6.722  -0.020  24.540 1.00 . A A . 165 HIS CG   1 1 
        1  2465 1 1 165 HIS H    H  -6.582   2.777  23.866 1.00 . A A . 165 HIS H    1 1 
        1  2466 1 1 165 HIS HA   H  -9.424   2.173  24.325 1.00 . A A . 165 HIS HA   1 1 
        1  2467 1 1 165 HIS HB2  H  -8.808  -0.154  24.699 1.00 . A A . 165 HIS HB2  1 1 
        1  2468 1 1 165 HIS HB3  H  -8.234   0.387  23.132 1.00 . A A . 165 HIS HB3  1 1 
        1  2469 1 1 165 HIS HD1  H  -5.555   0.911  23.042 1.00 . A A . 165 HIS HD1  1 1 
        1  2470 1 1 165 HIS HD2  H  -6.934  -1.340  26.261 1.00 . A A . 165 HIS HD2  1 1 
        1  2471 1 1 165 HIS HE1  H  -3.528  -0.214  24.003 1.00 . A A . 165 HIS HE1  1 1 
        1  2472 1 1 165 HIS HE2  H  -4.416  -1.731  25.803 1.00 . A A . 165 HIS HE2  1 1 
        1  2473 1 1 165 HIS N    N  -7.562   2.891  23.860 1.00 . A A . 165 HIS N    1 1 
        1  2474 1 1 165 HIS ND1  N  -5.590   0.320  23.834 1.00 . A A . 165 HIS ND1  1 1 
        1  2475 1 1 165 HIS NE2  N  -4.952  -1.023  25.376 1.00 . A A . 165 HIS NE2  1 1 
        1  2476 1 1 165 HIS O    O  -7.541   1.456  26.794 1.00 . A A . 165 HIS O    1 1 
        1  2477 1 1 166 HIS C    C  -9.821   4.695  28.322 1.00 . A A . 166 HIS C    1 1 
        1  2478 1 1 166 HIS CA   C  -8.898   3.520  28.028 1.00 . A A . 166 HIS CA   1 1 
        1  2479 1 1 166 HIS CB   C  -7.465   3.863  28.453 1.00 . A A . 166 HIS CB   1 1 
        1  2480 1 1 166 HIS CD2  C  -7.483   4.731  30.900 1.00 . A A . 166 HIS CD2  1 1 
        1  2481 1 1 166 HIS CE1  C  -6.666   2.946  31.869 1.00 . A A . 166 HIS CE1  1 1 
        1  2482 1 1 166 HIS CG   C  -7.252   3.812  29.934 1.00 . A A . 166 HIS CG   1 1 
        1  2483 1 1 166 HIS H    H  -9.530   3.717  26.019 1.00 . A A . 166 HIS H    1 1 
        1  2484 1 1 166 HIS HA   H  -9.236   2.660  28.586 1.00 . A A . 166 HIS HA   1 1 
        1  2485 1 1 166 HIS HB2  H  -6.784   3.161  27.996 1.00 . A A . 166 HIS HB2  1 1 
        1  2486 1 1 166 HIS HB3  H  -7.227   4.861  28.115 1.00 . A A . 166 HIS HB3  1 1 
        1  2487 1 1 166 HIS HD1  H  -6.466   1.861  30.141 1.00 . A A . 166 HIS HD1  1 1 
        1  2488 1 1 166 HIS HD2  H  -7.884   5.725  30.758 1.00 . A A . 166 HIS HD2  1 1 
        1  2489 1 1 166 HIS HE1  H  -6.301   2.260  32.619 1.00 . A A . 166 HIS HE1  1 1 
        1  2490 1 1 166 HIS HE2  H  -7.303   4.543  32.985 1.00 . A A . 166 HIS HE2  1 1 
        1  2491 1 1 166 HIS N    N  -8.953   3.188  26.610 1.00 . A A . 166 HIS N    1 1 
        1  2492 1 1 166 HIS ND1  N  -6.739   2.706  30.575 1.00 . A A . 166 HIS ND1  1 1 
        1  2493 1 1 166 HIS NE2  N  -7.110   4.167  32.093 1.00 . A A . 166 HIS NE2  1 1 
        1  2494 1 1 166 HIS O    O  -9.336   5.845  28.337 1.00 . A A . 166 HIS O    1 1 
        1  2495 1 1 166 HIS OXT  O -11.026   4.466  28.522 1.00 . A A . 166 HIS OXT  1 1 
        2  2496 1 1   1 MET C    C   0.774  -8.607  20.258 1.00 . A A .   1 MET C    1 1 
        2  2497 1 1   1 MET CA   C  -0.436  -8.775  19.350 1.00 . A A .   1 MET CA   1 1 
        2  2498 1 1   1 MET CB   C  -1.301  -9.955  19.820 1.00 . A A .   1 MET CB   1 1 
        2  2499 1 1   1 MET CE   C  -2.900  -8.887  23.542 1.00 . A A .   1 MET CE   1 1 
        2  2500 1 1   1 MET CG   C  -2.278  -9.614  20.942 1.00 . A A .   1 MET CG   1 1 
        2  2501 1 1   1 MET H1   H   0.619  -9.813  17.890 1.00 . A A .   1 MET H1   1 1 
        2  2502 1 1   1 MET H2   H   0.535  -8.138  17.625 1.00 . A A .   1 MET H2   1 1 
        2  2503 1 1   1 MET H3   H  -0.816  -9.112  17.336 1.00 . A A .   1 MET H3   1 1 
        2  2504 1 1   1 MET HA   H  -1.026  -7.869  19.388 1.00 . A A .   1 MET HA   1 1 
        2  2505 1 1   1 MET HB2  H  -1.869 -10.325  18.980 1.00 . A A .   1 MET HB2  1 1 
        2  2506 1 1   1 MET HB3  H  -0.647 -10.740  20.172 1.00 . A A .   1 MET HB3  1 1 
        2  2507 1 1   1 MET HE1  H  -3.478  -9.796  23.597 1.00 . A A .   1 MET HE1  1 1 
        2  2508 1 1   1 MET HE2  H  -3.510  -8.097  23.128 1.00 . A A .   1 MET HE2  1 1 
        2  2509 1 1   1 MET HE3  H  -2.570  -8.608  24.531 1.00 . A A .   1 MET HE3  1 1 
        2  2510 1 1   1 MET HG2  H  -2.897  -8.790  20.619 1.00 . A A .   1 MET HG2  1 1 
        2  2511 1 1   1 MET HG3  H  -2.905 -10.475  21.125 1.00 . A A .   1 MET HG3  1 1 
        2  2512 1 1   1 MET N    N   0.006  -8.976  17.953 1.00 . A A .   1 MET N    1 1 
        2  2513 1 1   1 MET O    O   1.115  -9.511  21.021 1.00 . A A .   1 MET O    1 1 
        2  2514 1 1   1 MET SD   S  -1.475  -9.149  22.491 1.00 . A A .   1 MET SD   1 1 
        2  2515 1 1   2 ASP C    C   3.105  -5.743  20.671 1.00 . A A .   2 ASP C    1 1 
        2  2516 1 1   2 ASP CA   C   2.575  -7.133  21.009 1.00 . A A .   2 ASP CA   1 1 
        2  2517 1 1   2 ASP CB   C   3.704  -8.167  20.884 1.00 . A A .   2 ASP CB   1 1 
        2  2518 1 1   2 ASP CG   C   4.615  -8.162  22.096 1.00 . A A .   2 ASP CG   1 1 
        2  2519 1 1   2 ASP H    H   1.188  -6.823  19.427 1.00 . A A .   2 ASP H    1 1 
        2  2520 1 1   2 ASP HA   H   2.213  -7.129  22.027 1.00 . A A .   2 ASP HA   1 1 
        2  2521 1 1   2 ASP HB2  H   3.274  -9.152  20.784 1.00 . A A .   2 ASP HB2  1 1 
        2  2522 1 1   2 ASP HB3  H   4.295  -7.944  20.008 1.00 . A A .   2 ASP HB3  1 1 
        2  2523 1 1   2 ASP N    N   1.451  -7.466  20.135 1.00 . A A .   2 ASP N    1 1 
        2  2524 1 1   2 ASP O    O   2.585  -5.077  19.781 1.00 . A A .   2 ASP O    1 1 
        2  2525 1 1   2 ASP OD1  O   4.199  -8.677  23.152 1.00 . A A .   2 ASP OD1  1 1 
        2  2526 1 1   2 ASP OD2  O   5.730  -7.613  22.012 1.00 . A A .   2 ASP OD2  1 1 
        2  2527 1 1   3 PHE C    C   6.124  -4.233  20.513 1.00 . A A .   3 PHE C    1 1 
        2  2528 1 1   3 PHE CA   C   4.749  -4.020  21.139 1.00 . A A .   3 PHE CA   1 1 
        2  2529 1 1   3 PHE CB   C   4.865  -3.228  22.446 1.00 . A A .   3 PHE CB   1 1 
        2  2530 1 1   3 PHE CD1  C   4.842  -0.899  21.499 1.00 . A A .   3 PHE CD1  1 1 
        2  2531 1 1   3 PHE CD2  C   6.627  -1.520  22.951 1.00 . A A .   3 PHE CD2  1 1 
        2  2532 1 1   3 PHE CE1  C   5.381   0.366  21.372 1.00 . A A .   3 PHE CE1  1 1 
        2  2533 1 1   3 PHE CE2  C   7.173  -0.257  22.824 1.00 . A A .   3 PHE CE2  1 1 
        2  2534 1 1   3 PHE CG   C   5.459  -1.856  22.290 1.00 . A A .   3 PHE CG   1 1 
        2  2535 1 1   3 PHE CZ   C   6.548   0.686  22.035 1.00 . A A .   3 PHE CZ   1 1 
        2  2536 1 1   3 PHE H    H   4.466  -5.866  22.122 1.00 . A A .   3 PHE H    1 1 
        2  2537 1 1   3 PHE HA   H   4.127  -3.474  20.446 1.00 . A A .   3 PHE HA   1 1 
        2  2538 1 1   3 PHE HB2  H   3.881  -3.114  22.874 1.00 . A A .   3 PHE HB2  1 1 
        2  2539 1 1   3 PHE HB3  H   5.486  -3.781  23.135 1.00 . A A .   3 PHE HB3  1 1 
        2  2540 1 1   3 PHE HD1  H   3.930  -1.150  20.976 1.00 . A A .   3 PHE HD1  1 1 
        2  2541 1 1   3 PHE HD2  H   7.117  -2.258  23.569 1.00 . A A .   3 PHE HD2  1 1 
        2  2542 1 1   3 PHE HE1  H   4.890   1.104  20.752 1.00 . A A .   3 PHE HE1  1 1 
        2  2543 1 1   3 PHE HE2  H   8.087  -0.009  23.343 1.00 . A A .   3 PHE HE2  1 1 
        2  2544 1 1   3 PHE HZ   H   6.973   1.675  21.938 1.00 . A A .   3 PHE HZ   1 1 
        2  2545 1 1   3 PHE N    N   4.122  -5.305  21.395 1.00 . A A .   3 PHE N    1 1 
        2  2546 1 1   3 PHE O    O   6.588  -3.417  19.717 1.00 . A A .   3 PHE O    1 1 
        2  2547 1 1   4 GLU C    C   9.114  -4.631  20.547 1.00 . A A .   4 GLU C    1 1 
        2  2548 1 1   4 GLU CA   C   8.074  -5.745  20.371 1.00 . A A .   4 GLU CA   1 1 
        2  2549 1 1   4 GLU CB   C   7.951  -6.157  18.894 1.00 . A A .   4 GLU CB   1 1 
        2  2550 1 1   4 GLU CD   C   9.386  -8.243  19.065 1.00 . A A .   4 GLU CD   1 1 
        2  2551 1 1   4 GLU CG   C   9.157  -6.919  18.356 1.00 . A A .   4 GLU CG   1 1 
        2  2552 1 1   4 GLU H    H   6.325  -5.939  21.545 1.00 . A A .   4 GLU H    1 1 
        2  2553 1 1   4 GLU HA   H   8.400  -6.603  20.940 1.00 . A A .   4 GLU HA   1 1 
        2  2554 1 1   4 GLU HB2  H   7.078  -6.781  18.781 1.00 . A A .   4 GLU HB2  1 1 
        2  2555 1 1   4 GLU HB3  H   7.822  -5.265  18.297 1.00 . A A .   4 GLU HB3  1 1 
        2  2556 1 1   4 GLU HG2  H   9.002  -7.116  17.305 1.00 . A A .   4 GLU HG2  1 1 
        2  2557 1 1   4 GLU HG3  H  10.038  -6.307  18.478 1.00 . A A .   4 GLU HG3  1 1 
        2  2558 1 1   4 GLU N    N   6.762  -5.345  20.892 1.00 . A A .   4 GLU N    1 1 
        2  2559 1 1   4 GLU O    O  10.117  -4.582  19.831 1.00 . A A .   4 GLU O    1 1 
        2  2560 1 1   4 GLU OE1  O   9.757  -8.228  20.259 1.00 . A A .   4 GLU OE1  1 1 
        2  2561 1 1   4 GLU OE2  O   9.219  -9.302  18.423 1.00 . A A .   4 GLU OE2  1 1 
        2  2562 1 1   5 CYS C    C  10.000  -1.816  20.530 1.00 . A A .   5 CYS C    1 1 
        2  2563 1 1   5 CYS CA   C   9.765  -2.630  21.800 1.00 . A A .   5 CYS CA   1 1 
        2  2564 1 1   5 CYS CB   C  11.094  -3.117  22.376 1.00 . A A .   5 CYS CB   1 1 
        2  2565 1 1   5 CYS H    H   8.110  -3.911  22.114 1.00 . A A .   5 CYS H    1 1 
        2  2566 1 1   5 CYS HA   H   9.276  -2.000  22.530 1.00 . A A .   5 CYS HA   1 1 
        2  2567 1 1   5 CYS HB2  H  11.593  -3.732  21.642 1.00 . A A .   5 CYS HB2  1 1 
        2  2568 1 1   5 CYS HB3  H  11.715  -2.263  22.605 1.00 . A A .   5 CYS HB3  1 1 
        2  2569 1 1   5 CYS HG   H  11.450  -3.403  24.884 1.00 . A A .   5 CYS HG   1 1 
        2  2570 1 1   5 CYS N    N   8.886  -3.768  21.536 1.00 . A A .   5 CYS N    1 1 
        2  2571 1 1   5 CYS O    O  11.146  -1.542  20.166 1.00 . A A .   5 CYS O    1 1 
        2  2572 1 1   5 CYS SG   S  10.915  -4.093  23.885 1.00 . A A .   5 CYS SG   1 1 
        2  2573 1 1   6 GLN C    C   9.455  -1.525  17.471 1.00 . A A .   6 GLN C    1 1 
        2  2574 1 1   6 GLN CA   C   8.933  -0.677  18.627 1.00 . A A .   6 GLN CA   1 1 
        2  2575 1 1   6 GLN CB   C   9.769   0.596  18.773 1.00 . A A .   6 GLN CB   1 1 
        2  2576 1 1   6 GLN CD   C  10.068   2.832  19.907 1.00 . A A .   6 GLN CD   1 1 
        2  2577 1 1   6 GLN CG   C   9.232   1.572  19.808 1.00 . A A .   6 GLN CG   1 1 
        2  2578 1 1   6 GLN H    H   8.032  -1.697  20.227 1.00 . A A .   6 GLN H    1 1 
        2  2579 1 1   6 GLN HA   H   7.916  -0.395  18.400 1.00 . A A .   6 GLN HA   1 1 
        2  2580 1 1   6 GLN HB2  H  10.774   0.324  19.054 1.00 . A A .   6 GLN HB2  1 1 
        2  2581 1 1   6 GLN HB3  H   9.795   1.096  17.822 1.00 . A A .   6 GLN HB3  1 1 
        2  2582 1 1   6 GLN HE21 H   8.460   3.871  20.443 1.00 . A A .   6 GLN HE21 1 1 
        2  2583 1 1   6 GLN HE22 H   9.943   4.763  20.327 1.00 . A A .   6 GLN HE22 1 1 
        2  2584 1 1   6 GLN HG2  H   8.224   1.850  19.533 1.00 . A A .   6 GLN HG2  1 1 
        2  2585 1 1   6 GLN HG3  H   9.220   1.087  20.773 1.00 . A A .   6 GLN HG3  1 1 
        2  2586 1 1   6 GLN N    N   8.901  -1.441  19.870 1.00 . A A .   6 GLN N    1 1 
        2  2587 1 1   6 GLN NE2  N   9.432   3.932  20.262 1.00 . A A .   6 GLN NE2  1 1 
        2  2588 1 1   6 GLN O    O  10.643  -1.860  17.407 1.00 . A A .   6 GLN O    1 1 
        2  2589 1 1   6 GLN OE1  O  11.275   2.817  19.672 1.00 . A A .   6 GLN OE1  1 1 
        2  2590 1 1   7 PHE C    C   9.892  -1.883  14.525 1.00 . A A .   7 PHE C    1 1 
        2  2591 1 1   7 PHE CA   C   8.909  -2.660  15.392 1.00 . A A .   7 PHE CA   1 1 
        2  2592 1 1   7 PHE CB   C   7.660  -3.007  14.580 1.00 . A A .   7 PHE CB   1 1 
        2  2593 1 1   7 PHE CD1  C   6.795  -5.262  15.266 1.00 . A A .   7 PHE CD1  1 1 
        2  2594 1 1   7 PHE CD2  C   5.634  -3.324  16.029 1.00 . A A .   7 PHE CD2  1 1 
        2  2595 1 1   7 PHE CE1  C   5.889  -6.069  15.929 1.00 . A A .   7 PHE CE1  1 1 
        2  2596 1 1   7 PHE CE2  C   4.725  -4.126  16.692 1.00 . A A .   7 PHE CE2  1 1 
        2  2597 1 1   7 PHE CG   C   6.679  -3.882  15.309 1.00 . A A .   7 PHE CG   1 1 
        2  2598 1 1   7 PHE CZ   C   4.853  -5.501  16.642 1.00 . A A .   7 PHE CZ   1 1 
        2  2599 1 1   7 PHE H    H   7.617  -1.621  16.699 1.00 . A A .   7 PHE H    1 1 
        2  2600 1 1   7 PHE HA   H   9.379  -3.574  15.724 1.00 . A A .   7 PHE HA   1 1 
        2  2601 1 1   7 PHE HB2  H   7.150  -2.095  14.311 1.00 . A A .   7 PHE HB2  1 1 
        2  2602 1 1   7 PHE HB3  H   7.959  -3.523  13.680 1.00 . A A .   7 PHE HB3  1 1 
        2  2603 1 1   7 PHE HD1  H   7.605  -5.707  14.710 1.00 . A A .   7 PHE HD1  1 1 
        2  2604 1 1   7 PHE HD2  H   5.534  -2.250  16.069 1.00 . A A .   7 PHE HD2  1 1 
        2  2605 1 1   7 PHE HE1  H   5.990  -7.144  15.887 1.00 . A A .   7 PHE HE1  1 1 
        2  2606 1 1   7 PHE HE2  H   3.917  -3.678  17.251 1.00 . A A .   7 PHE HE2  1 1 
        2  2607 1 1   7 PHE HZ   H   4.143  -6.130  17.159 1.00 . A A .   7 PHE HZ   1 1 
        2  2608 1 1   7 PHE N    N   8.550  -1.885  16.570 1.00 . A A .   7 PHE N    1 1 
        2  2609 1 1   7 PHE O    O   9.861  -0.652  14.494 1.00 . A A .   7 PHE O    1 1 
        2  2610 1 1   8 VAL C    C  11.170  -0.992  12.011 1.00 . A A .   8 VAL C    1 1 
        2  2611 1 1   8 VAL CA   C  11.780  -2.004  12.985 1.00 . A A .   8 VAL CA   1 1 
        2  2612 1 1   8 VAL CB   C  12.581  -3.076  12.203 1.00 . A A .   8 VAL CB   1 1 
        2  2613 1 1   8 VAL CG1  C  11.660  -3.965  11.375 1.00 . A A .   8 VAL CG1  1 1 
        2  2614 1 1   8 VAL CG2  C  13.636  -2.423  11.323 1.00 . A A .   8 VAL CG2  1 1 
        2  2615 1 1   8 VAL H    H  10.739  -3.588  13.922 1.00 . A A .   8 VAL H    1 1 
        2  2616 1 1   8 VAL HA   H  12.473  -1.479  13.628 1.00 . A A .   8 VAL HA   1 1 
        2  2617 1 1   8 VAL HB   H  13.088  -3.704  12.922 1.00 . A A .   8 VAL HB   1 1 
        2  2618 1 1   8 VAL HG11 H  10.950  -4.452  12.027 1.00 . A A .   8 VAL HG11 1 1 
        2  2619 1 1   8 VAL HG12 H  12.247  -4.711  10.861 1.00 . A A .   8 VAL HG12 1 1 
        2  2620 1 1   8 VAL HG13 H  11.132  -3.360  10.653 1.00 . A A .   8 VAL HG13 1 1 
        2  2621 1 1   8 VAL HG21 H  14.204  -3.188  10.814 1.00 . A A .   8 VAL HG21 1 1 
        2  2622 1 1   8 VAL HG22 H  14.300  -1.829  11.935 1.00 . A A .   8 VAL HG22 1 1 
        2  2623 1 1   8 VAL HG23 H  13.155  -1.788  10.593 1.00 . A A .   8 VAL HG23 1 1 
        2  2624 1 1   8 VAL N    N  10.766  -2.611  13.839 1.00 . A A .   8 VAL N    1 1 
        2  2625 1 1   8 VAL O    O  10.260  -1.309  11.244 1.00 . A A .   8 VAL O    1 1 
        2  2626 1 1   9 CYS C    C  12.461   1.856  10.470 1.00 . A A .   9 CYS C    1 1 
        2  2627 1 1   9 CYS CA   C  11.241   1.286  11.179 1.00 . A A .   9 CYS CA   1 1 
        2  2628 1 1   9 CYS CB   C  10.495   2.382  11.943 1.00 . A A .   9 CYS CB   1 1 
        2  2629 1 1   9 CYS H    H  12.308   0.445  12.785 1.00 . A A .   9 CYS H    1 1 
        2  2630 1 1   9 CYS HA   H  10.581   0.852  10.444 1.00 . A A .   9 CYS HA   1 1 
        2  2631 1 1   9 CYS HB2  H  10.347   3.228  11.290 1.00 . A A .   9 CYS HB2  1 1 
        2  2632 1 1   9 CYS HB3  H   9.532   2.002  12.256 1.00 . A A .   9 CYS HB3  1 1 
        2  2633 1 1   9 CYS HG   H  10.560   3.825  14.047 1.00 . A A .   9 CYS HG   1 1 
        2  2634 1 1   9 CYS N    N  11.654   0.235  12.087 1.00 . A A .   9 CYS N    1 1 
        2  2635 1 1   9 CYS O    O  13.436   2.240  11.117 1.00 . A A .   9 CYS O    1 1 
        2  2636 1 1   9 CYS SG   S  11.359   2.973  13.421 1.00 . A A .   9 CYS SG   1 1 
        2  2637 1 1  10 GLU C    C  13.109   3.058   7.097 1.00 . A A .  10 GLU C    1 1 
        2  2638 1 1  10 GLU CA   C  13.557   2.355   8.372 1.00 . A A .  10 GLU CA   1 1 
        2  2639 1 1  10 GLU CB   C  14.480   1.180   8.036 1.00 . A A .  10 GLU CB   1 1 
        2  2640 1 1  10 GLU CD   C  14.720  -1.110   7.015 1.00 . A A .  10 GLU CD   1 1 
        2  2641 1 1  10 GLU CG   C  13.777   0.026   7.340 1.00 . A A .  10 GLU CG   1 1 
        2  2642 1 1  10 GLU H    H  11.609   1.585   8.681 1.00 . A A .  10 GLU H    1 1 
        2  2643 1 1  10 GLU HA   H  14.105   3.060   8.981 1.00 . A A .  10 GLU HA   1 1 
        2  2644 1 1  10 GLU HB2  H  15.269   1.532   7.389 1.00 . A A .  10 GLU HB2  1 1 
        2  2645 1 1  10 GLU HB3  H  14.916   0.808   8.950 1.00 . A A .  10 GLU HB3  1 1 
        2  2646 1 1  10 GLU HG2  H  12.997  -0.347   7.985 1.00 . A A .  10 GLU HG2  1 1 
        2  2647 1 1  10 GLU HG3  H  13.342   0.388   6.420 1.00 . A A .  10 GLU HG3  1 1 
        2  2648 1 1  10 GLU N    N  12.421   1.888   9.149 1.00 . A A .  10 GLU N    1 1 
        2  2649 1 1  10 GLU O    O  11.943   2.969   6.697 1.00 . A A .  10 GLU O    1 1 
        2  2650 1 1  10 GLU OE1  O  15.496  -0.978   6.046 1.00 . A A .  10 GLU OE1  1 1 
        2  2651 1 1  10 GLU OE2  O  14.695  -2.138   7.722 1.00 . A A .  10 GLU OE2  1 1 
        2  2652 1 1  11 LEU C    C  13.938   3.543   4.039 1.00 . A A .  11 LEU C    1 1 
        2  2653 1 1  11 LEU CA   C  13.764   4.476   5.230 1.00 . A A .  11 LEU CA   1 1 
        2  2654 1 1  11 LEU CB   C  14.692   5.689   5.102 1.00 . A A .  11 LEU CB   1 1 
        2  2655 1 1  11 LEU CD1  C  13.111   7.257   3.947 1.00 . A A .  11 LEU CD1  1 1 
        2  2656 1 1  11 LEU CD2  C  15.579   7.594   3.738 1.00 . A A .  11 LEU CD2  1 1 
        2  2657 1 1  11 LEU CG   C  14.465   6.568   3.870 1.00 . A A .  11 LEU CG   1 1 
        2  2658 1 1  11 LEU H    H  14.948   3.787   6.835 1.00 . A A .  11 LEU H    1 1 
        2  2659 1 1  11 LEU HA   H  12.739   4.816   5.263 1.00 . A A .  11 LEU HA   1 1 
        2  2660 1 1  11 LEU HB2  H  14.562   6.306   5.979 1.00 . A A .  11 LEU HB2  1 1 
        2  2661 1 1  11 LEU HB3  H  15.712   5.335   5.081 1.00 . A A .  11 LEU HB3  1 1 
        2  2662 1 1  11 LEU HD11 H  13.067   7.866   4.838 1.00 . A A .  11 LEU HD11 1 1 
        2  2663 1 1  11 LEU HD12 H  12.328   6.514   3.982 1.00 . A A .  11 LEU HD12 1 1 
        2  2664 1 1  11 LEU HD13 H  12.975   7.883   3.077 1.00 . A A .  11 LEU HD13 1 1 
        2  2665 1 1  11 LEU HD21 H  16.528   7.086   3.653 1.00 . A A .  11 LEU HD21 1 1 
        2  2666 1 1  11 LEU HD22 H  15.587   8.231   4.612 1.00 . A A .  11 LEU HD22 1 1 
        2  2667 1 1  11 LEU HD23 H  15.412   8.195   2.857 1.00 . A A .  11 LEU HD23 1 1 
        2  2668 1 1  11 LEU HG   H  14.473   5.947   2.986 1.00 . A A .  11 LEU HG   1 1 
        2  2669 1 1  11 LEU N    N  14.041   3.760   6.465 1.00 . A A .  11 LEU N    1 1 
        2  2670 1 1  11 LEU O    O  14.933   2.818   3.943 1.00 . A A .  11 LEU O    1 1 
        2  2671 1 1  12 LYS C    C  12.583   3.445   0.737 1.00 . A A .  12 LYS C    1 1 
        2  2672 1 1  12 LYS CA   C  12.983   2.678   1.987 1.00 . A A .  12 LYS CA   1 1 
        2  2673 1 1  12 LYS CB   C  12.036   1.498   2.218 1.00 . A A .  12 LYS CB   1 1 
        2  2674 1 1  12 LYS CD   C  11.103  -0.686   1.390 1.00 . A A .  12 LYS CD   1 1 
        2  2675 1 1  12 LYS CE   C   9.708  -0.327   1.875 1.00 . A A .  12 LYS CE   1 1 
        2  2676 1 1  12 LYS CG   C  11.913   0.551   1.032 1.00 . A A .  12 LYS CG   1 1 
        2  2677 1 1  12 LYS H    H  12.204   4.163   3.272 1.00 . A A .  12 LYS H    1 1 
        2  2678 1 1  12 LYS HA   H  13.989   2.307   1.866 1.00 . A A .  12 LYS HA   1 1 
        2  2679 1 1  12 LYS HB2  H  12.392   0.931   3.064 1.00 . A A .  12 LYS HB2  1 1 
        2  2680 1 1  12 LYS HB3  H  11.053   1.883   2.446 1.00 . A A .  12 LYS HB3  1 1 
        2  2681 1 1  12 LYS HD2  H  11.018  -1.314   0.516 1.00 . A A .  12 LYS HD2  1 1 
        2  2682 1 1  12 LYS HD3  H  11.618  -1.225   2.172 1.00 . A A .  12 LYS HD3  1 1 
        2  2683 1 1  12 LYS HE2  H   9.795   0.366   2.698 1.00 . A A .  12 LYS HE2  1 1 
        2  2684 1 1  12 LYS HE3  H   9.169   0.142   1.065 1.00 . A A .  12 LYS HE3  1 1 
        2  2685 1 1  12 LYS HG2  H  11.422   1.069   0.221 1.00 . A A .  12 LYS HG2  1 1 
        2  2686 1 1  12 LYS HG3  H  12.900   0.247   0.723 1.00 . A A .  12 LYS HG3  1 1 
        2  2687 1 1  12 LYS HZ1  H   8.796  -2.176   1.527 1.00 . A A .  12 LYS HZ1  1 1 
        2  2688 1 1  12 LYS HZ2  H   8.037  -1.244   2.721 1.00 . A A .  12 LYS HZ2  1 1 
        2  2689 1 1  12 LYS HZ3  H   9.498  -2.030   3.068 1.00 . A A .  12 LYS HZ3  1 1 
        2  2690 1 1  12 LYS N    N  12.966   3.553   3.146 1.00 . A A .  12 LYS N    1 1 
        2  2691 1 1  12 LYS NZ   N   8.955  -1.525   2.329 1.00 . A A .  12 LYS NZ   1 1 
        2  2692 1 1  12 LYS O    O  11.688   4.292   0.777 1.00 . A A .  12 LYS O    1 1 
        2  2693 1 1  13 GLU C    C  11.947   2.872  -2.397 1.00 . A A .  13 GLU C    1 1 
        2  2694 1 1  13 GLU CA   C  12.919   3.766  -1.637 1.00 . A A .  13 GLU CA   1 1 
        2  2695 1 1  13 GLU CB   C  14.169   4.045  -2.485 1.00 . A A .  13 GLU CB   1 1 
        2  2696 1 1  13 GLU CD   C  16.060   2.838  -1.325 1.00 . A A .  13 GLU CD   1 1 
        2  2697 1 1  13 GLU CG   C  15.168   2.900  -2.547 1.00 . A A .  13 GLU CG   1 1 
        2  2698 1 1  13 GLU H    H  14.013   2.527  -0.316 1.00 . A A .  13 GLU H    1 1 
        2  2699 1 1  13 GLU HA   H  12.426   4.705  -1.428 1.00 . A A .  13 GLU HA   1 1 
        2  2700 1 1  13 GLU HB2  H  13.857   4.269  -3.494 1.00 . A A .  13 GLU HB2  1 1 
        2  2701 1 1  13 GLU HB3  H  14.674   4.909  -2.078 1.00 . A A .  13 GLU HB3  1 1 
        2  2702 1 1  13 GLU HG2  H  14.625   1.972  -2.624 1.00 . A A .  13 GLU HG2  1 1 
        2  2703 1 1  13 GLU HG3  H  15.789   3.028  -3.423 1.00 . A A .  13 GLU HG3  1 1 
        2  2704 1 1  13 GLU N    N  13.262   3.165  -0.361 1.00 . A A .  13 GLU N    1 1 
        2  2705 1 1  13 GLU O    O  12.165   1.668  -2.535 1.00 . A A .  13 GLU O    1 1 
        2  2706 1 1  13 GLU OE1  O  17.014   3.642  -1.241 1.00 . A A .  13 GLU OE1  1 1 
        2  2707 1 1  13 GLU OE2  O  15.814   1.988  -0.446 1.00 . A A .  13 GLU OE2  1 1 
        2  2708 1 1  14 LEU C    C  10.300   2.539  -5.053 1.00 . A A .  14 LEU C    1 1 
        2  2709 1 1  14 LEU CA   C   9.850   2.742  -3.616 1.00 . A A .  14 LEU CA   1 1 
        2  2710 1 1  14 LEU CB   C   8.512   3.493  -3.609 1.00 . A A .  14 LEU CB   1 1 
        2  2711 1 1  14 LEU CD1  C   8.485   4.477  -1.287 1.00 . A A .  14 LEU CD1  1 1 
        2  2712 1 1  14 LEU CD2  C   6.340   4.019  -2.484 1.00 . A A .  14 LEU CD2  1 1 
        2  2713 1 1  14 LEU CG   C   7.774   3.557  -2.268 1.00 . A A .  14 LEU CG   1 1 
        2  2714 1 1  14 LEU H    H  10.740   4.429  -2.699 1.00 . A A .  14 LEU H    1 1 
        2  2715 1 1  14 LEU HA   H   9.716   1.777  -3.151 1.00 . A A .  14 LEU HA   1 1 
        2  2716 1 1  14 LEU HB2  H   8.695   4.505  -3.938 1.00 . A A .  14 LEU HB2  1 1 
        2  2717 1 1  14 LEU HB3  H   7.859   3.019  -4.327 1.00 . A A .  14 LEU HB3  1 1 
        2  2718 1 1  14 LEU HD11 H   8.530   5.475  -1.697 1.00 . A A .  14 LEU HD11 1 1 
        2  2719 1 1  14 LEU HD12 H   9.487   4.113  -1.113 1.00 . A A .  14 LEU HD12 1 1 
        2  2720 1 1  14 LEU HD13 H   7.941   4.496  -0.352 1.00 . A A .  14 LEU HD13 1 1 
        2  2721 1 1  14 LEU HD21 H   5.829   3.321  -3.132 1.00 . A A .  14 LEU HD21 1 1 
        2  2722 1 1  14 LEU HD22 H   6.343   4.998  -2.941 1.00 . A A .  14 LEU HD22 1 1 
        2  2723 1 1  14 LEU HD23 H   5.829   4.068  -1.533 1.00 . A A .  14 LEU HD23 1 1 
        2  2724 1 1  14 LEU HG   H   7.742   2.568  -1.836 1.00 . A A .  14 LEU HG   1 1 
        2  2725 1 1  14 LEU N    N  10.863   3.466  -2.865 1.00 . A A .  14 LEU N    1 1 
        2  2726 1 1  14 LEU O    O  10.687   3.494  -5.732 1.00 . A A .  14 LEU O    1 1 
        2  2727 1 1  15 ALA C    C   9.277   1.012  -7.712 1.00 . A A .  15 ALA C    1 1 
        2  2728 1 1  15 ALA CA   C  10.561   0.994  -6.893 1.00 . A A .  15 ALA CA   1 1 
        2  2729 1 1  15 ALA CB   C  11.246  -0.361  -7.005 1.00 . A A .  15 ALA CB   1 1 
        2  2730 1 1  15 ALA H    H  10.033   0.570  -4.893 1.00 . A A .  15 ALA H    1 1 
        2  2731 1 1  15 ALA HA   H  11.233   1.751  -7.268 1.00 . A A .  15 ALA HA   1 1 
        2  2732 1 1  15 ALA HB1  H  10.574  -1.133  -6.663 1.00 . A A .  15 ALA HB1  1 1 
        2  2733 1 1  15 ALA HB2  H  12.137  -0.364  -6.397 1.00 . A A .  15 ALA HB2  1 1 
        2  2734 1 1  15 ALA HB3  H  11.512  -0.545  -8.036 1.00 . A A .  15 ALA HB3  1 1 
        2  2735 1 1  15 ALA N    N  10.264   1.298  -5.506 1.00 . A A .  15 ALA N    1 1 
        2  2736 1 1  15 ALA O    O   8.221   0.606  -7.225 1.00 . A A .  15 ALA O    1 1 
        2  2737 1 1  16 PRO C    C   7.857   0.183 -10.438 1.00 . A A .  16 PRO C    1 1 
        2  2738 1 1  16 PRO CA   C   8.187   1.550  -9.849 1.00 . A A .  16 PRO CA   1 1 
        2  2739 1 1  16 PRO CB   C   8.621   2.523 -10.961 1.00 . A A .  16 PRO CB   1 1 
        2  2740 1 1  16 PRO CD   C  10.539   2.047  -9.603 1.00 . A A .  16 PRO CD   1 1 
        2  2741 1 1  16 PRO CG   C   9.957   3.054 -10.549 1.00 . A A .  16 PRO CG   1 1 
        2  2742 1 1  16 PRO HA   H   7.316   1.943  -9.343 1.00 . A A .  16 PRO HA   1 1 
        2  2743 1 1  16 PRO HB2  H   8.682   1.991 -11.899 1.00 . A A .  16 PRO HB2  1 1 
        2  2744 1 1  16 PRO HB3  H   7.892   3.317 -11.045 1.00 . A A .  16 PRO HB3  1 1 
        2  2745 1 1  16 PRO HD2  H  11.077   1.284 -10.146 1.00 . A A .  16 PRO HD2  1 1 
        2  2746 1 1  16 PRO HD3  H  11.181   2.529  -8.882 1.00 . A A .  16 PRO HD3  1 1 
        2  2747 1 1  16 PRO HG2  H  10.591   3.161 -11.416 1.00 . A A .  16 PRO HG2  1 1 
        2  2748 1 1  16 PRO HG3  H   9.836   4.007 -10.054 1.00 . A A .  16 PRO HG3  1 1 
        2  2749 1 1  16 PRO N    N   9.345   1.494  -8.959 1.00 . A A .  16 PRO N    1 1 
        2  2750 1 1  16 PRO O    O   8.723  -0.483 -11.006 1.00 . A A .  16 PRO O    1 1 
        2  2751 1 1  17 VAL C    C   4.758  -1.279 -11.469 1.00 . A A .  17 VAL C    1 1 
        2  2752 1 1  17 VAL CA   C   6.143  -1.491 -10.855 1.00 . A A .  17 VAL CA   1 1 
        2  2753 1 1  17 VAL CB   C   6.091  -2.616  -9.782 1.00 . A A .  17 VAL CB   1 1 
        2  2754 1 1  17 VAL CG1  C   5.234  -2.204  -8.593 1.00 . A A .  17 VAL CG1  1 1 
        2  2755 1 1  17 VAL CG2  C   5.589  -3.930 -10.364 1.00 . A A .  17 VAL CG2  1 1 
        2  2756 1 1  17 VAL H    H   5.997   0.290  -9.721 1.00 . A A .  17 VAL H    1 1 
        2  2757 1 1  17 VAL HA   H   6.835  -1.783 -11.632 1.00 . A A .  17 VAL HA   1 1 
        2  2758 1 1  17 VAL HB   H   7.097  -2.776  -9.423 1.00 . A A .  17 VAL HB   1 1 
        2  2759 1 1  17 VAL HG11 H   5.648  -1.314  -8.140 1.00 . A A .  17 VAL HG11 1 1 
        2  2760 1 1  17 VAL HG12 H   5.218  -3.002  -7.864 1.00 . A A .  17 VAL HG12 1 1 
        2  2761 1 1  17 VAL HG13 H   4.227  -2.002  -8.927 1.00 . A A .  17 VAL HG13 1 1 
        2  2762 1 1  17 VAL HG21 H   5.556  -4.679  -9.587 1.00 . A A .  17 VAL HG21 1 1 
        2  2763 1 1  17 VAL HG22 H   6.254  -4.253 -11.150 1.00 . A A .  17 VAL HG22 1 1 
        2  2764 1 1  17 VAL HG23 H   4.597  -3.787 -10.769 1.00 . A A .  17 VAL HG23 1 1 
        2  2765 1 1  17 VAL N    N   6.615  -0.244 -10.268 1.00 . A A .  17 VAL N    1 1 
        2  2766 1 1  17 VAL O    O   3.945  -0.536 -10.916 1.00 . A A .  17 VAL O    1 1 
        2  2767 1 1  18 PRO C    C   2.054  -2.386 -12.405 1.00 . A A .  18 PRO C    1 1 
        2  2768 1 1  18 PRO CA   C   3.166  -1.814 -13.280 1.00 . A A .  18 PRO CA   1 1 
        2  2769 1 1  18 PRO CB   C   3.325  -2.647 -14.556 1.00 . A A .  18 PRO CB   1 1 
        2  2770 1 1  18 PRO CD   C   5.428  -2.702 -13.430 1.00 . A A .  18 PRO CD   1 1 
        2  2771 1 1  18 PRO CG   C   4.795  -2.724 -14.790 1.00 . A A .  18 PRO CG   1 1 
        2  2772 1 1  18 PRO HA   H   2.924  -0.792 -13.541 1.00 . A A .  18 PRO HA   1 1 
        2  2773 1 1  18 PRO HB2  H   2.899  -3.626 -14.403 1.00 . A A .  18 PRO HB2  1 1 
        2  2774 1 1  18 PRO HB3  H   2.822  -2.154 -15.375 1.00 . A A .  18 PRO HB3  1 1 
        2  2775 1 1  18 PRO HD2  H   5.514  -3.705 -13.038 1.00 . A A .  18 PRO HD2  1 1 
        2  2776 1 1  18 PRO HD3  H   6.397  -2.228 -13.471 1.00 . A A .  18 PRO HD3  1 1 
        2  2777 1 1  18 PRO HG2  H   5.038  -3.644 -15.303 1.00 . A A .  18 PRO HG2  1 1 
        2  2778 1 1  18 PRO HG3  H   5.122  -1.874 -15.370 1.00 . A A .  18 PRO HG3  1 1 
        2  2779 1 1  18 PRO N    N   4.480  -1.902 -12.632 1.00 . A A .  18 PRO N    1 1 
        2  2780 1 1  18 PRO O    O   2.096  -3.550 -11.994 1.00 . A A .  18 PRO O    1 1 
        2  2781 1 1  19 ALA C    C  -1.334  -1.311 -11.724 1.00 . A A .  19 ALA C    1 1 
        2  2782 1 1  19 ALA CA   C  -0.034  -1.945 -11.257 1.00 . A A .  19 ALA CA   1 1 
        2  2783 1 1  19 ALA CB   C   0.281  -1.522  -9.828 1.00 . A A .  19 ALA CB   1 1 
        2  2784 1 1  19 ALA H    H   1.047  -0.667 -12.544 1.00 . A A .  19 ALA H    1 1 
        2  2785 1 1  19 ALA HA   H  -0.133  -3.020 -11.282 1.00 . A A .  19 ALA HA   1 1 
        2  2786 1 1  19 ALA HB1  H   1.204  -1.984  -9.512 1.00 . A A .  19 ALA HB1  1 1 
        2  2787 1 1  19 ALA HB2  H  -0.521  -1.835  -9.176 1.00 . A A .  19 ALA HB2  1 1 
        2  2788 1 1  19 ALA HB3  H   0.383  -0.449  -9.786 1.00 . A A .  19 ALA HB3  1 1 
        2  2789 1 1  19 ALA N    N   1.056  -1.562 -12.134 1.00 . A A .  19 ALA N    1 1 
        2  2790 1 1  19 ALA O    O  -1.342  -0.516 -12.665 1.00 . A A .  19 ALA O    1 1 
        2  2791 1 1  20 LEU C    C  -4.151  -0.228 -10.158 1.00 . A A .  20 LEU C    1 1 
        2  2792 1 1  20 LEU CA   C  -3.718  -1.061 -11.355 1.00 . A A .  20 LEU CA   1 1 
        2  2793 1 1  20 LEU CB   C  -4.776  -2.116 -11.679 1.00 . A A .  20 LEU CB   1 1 
        2  2794 1 1  20 LEU CD1  C  -5.695  -3.862 -13.220 1.00 . A A .  20 LEU CD1  1 1 
        2  2795 1 1  20 LEU CD2  C  -4.275  -2.031 -14.141 1.00 . A A .  20 LEU CD2  1 1 
        2  2796 1 1  20 LEU CG   C  -4.522  -2.937 -12.946 1.00 . A A .  20 LEU CG   1 1 
        2  2797 1 1  20 LEU H    H  -2.373  -2.381 -10.395 1.00 . A A .  20 LEU H    1 1 
        2  2798 1 1  20 LEU HA   H  -3.598  -0.408 -12.207 1.00 . A A .  20 LEU HA   1 1 
        2  2799 1 1  20 LEU HB2  H  -4.841  -2.797 -10.842 1.00 . A A .  20 LEU HB2  1 1 
        2  2800 1 1  20 LEU HB3  H  -5.727  -1.618 -11.786 1.00 . A A .  20 LEU HB3  1 1 
        2  2801 1 1  20 LEU HD11 H  -5.820  -4.542 -12.391 1.00 . A A .  20 LEU HD11 1 1 
        2  2802 1 1  20 LEU HD12 H  -5.506  -4.424 -14.123 1.00 . A A .  20 LEU HD12 1 1 
        2  2803 1 1  20 LEU HD13 H  -6.593  -3.274 -13.343 1.00 . A A .  20 LEU HD13 1 1 
        2  2804 1 1  20 LEU HD21 H  -5.134  -1.394 -14.295 1.00 . A A .  20 LEU HD21 1 1 
        2  2805 1 1  20 LEU HD22 H  -4.109  -2.632 -15.023 1.00 . A A .  20 LEU HD22 1 1 
        2  2806 1 1  20 LEU HD23 H  -3.403  -1.419 -13.955 1.00 . A A .  20 LEU HD23 1 1 
        2  2807 1 1  20 LEU HG   H  -3.643  -3.548 -12.801 1.00 . A A .  20 LEU HG   1 1 
        2  2808 1 1  20 LEU N    N  -2.431  -1.678 -11.081 1.00 . A A .  20 LEU N    1 1 
        2  2809 1 1  20 LEU O    O  -4.148  -0.712  -9.019 1.00 . A A .  20 LEU O    1 1 
        2  2810 1 1  21 LEU C    C  -6.138   2.692  -9.617 1.00 . A A .  21 LEU C    1 1 
        2  2811 1 1  21 LEU CA   C  -4.827   1.961  -9.349 1.00 . A A .  21 LEU CA   1 1 
        2  2812 1 1  21 LEU CB   C  -3.710   3.003  -9.160 1.00 . A A .  21 LEU CB   1 1 
        2  2813 1 1  21 LEU CD1  C  -1.540   1.865  -9.732 1.00 . A A .  21 LEU CD1  1 1 
        2  2814 1 1  21 LEU CD2  C  -1.604   3.605  -7.943 1.00 . A A .  21 LEU CD2  1 1 
        2  2815 1 1  21 LEU CG   C  -2.374   2.482  -8.621 1.00 . A A .  21 LEU CG   1 1 
        2  2816 1 1  21 LEU H    H  -4.572   1.324 -11.352 1.00 . A A .  21 LEU H    1 1 
        2  2817 1 1  21 LEU HA   H  -4.928   1.394  -8.436 1.00 . A A .  21 LEU HA   1 1 
        2  2818 1 1  21 LEU HB2  H  -3.524   3.466 -10.117 1.00 . A A .  21 LEU HB2  1 1 
        2  2819 1 1  21 LEU HB3  H  -4.072   3.761  -8.481 1.00 . A A .  21 LEU HB3  1 1 
        2  2820 1 1  21 LEU HD11 H  -0.605   1.509  -9.325 1.00 . A A .  21 LEU HD11 1 1 
        2  2821 1 1  21 LEU HD12 H  -1.343   2.609 -10.490 1.00 . A A .  21 LEU HD12 1 1 
        2  2822 1 1  21 LEU HD13 H  -2.079   1.038 -10.170 1.00 . A A .  21 LEU HD13 1 1 
        2  2823 1 1  21 LEU HD21 H  -0.706   3.206  -7.496 1.00 . A A .  21 LEU HD21 1 1 
        2  2824 1 1  21 LEU HD22 H  -2.220   4.053  -7.176 1.00 . A A .  21 LEU HD22 1 1 
        2  2825 1 1  21 LEU HD23 H  -1.340   4.353  -8.676 1.00 . A A .  21 LEU HD23 1 1 
        2  2826 1 1  21 LEU HG   H  -2.566   1.716  -7.883 1.00 . A A .  21 LEU HG   1 1 
        2  2827 1 1  21 LEU N    N  -4.506   1.024 -10.415 1.00 . A A .  21 LEU N    1 1 
        2  2828 1 1  21 LEU O    O  -6.702   2.626 -10.718 1.00 . A A .  21 LEU O    1 1 
        2  2829 1 1  22 ILE C    C  -7.945   4.968  -7.323 1.00 . A A .  22 ILE C    1 1 
        2  2830 1 1  22 ILE CA   C  -7.787   4.224  -8.649 1.00 . A A .  22 ILE CA   1 1 
        2  2831 1 1  22 ILE CB   C  -9.068   3.405  -8.962 1.00 . A A .  22 ILE CB   1 1 
        2  2832 1 1  22 ILE CD1  C -10.249   5.389 -10.044 1.00 . A A .  22 ILE CD1  1 1 
        2  2833 1 1  22 ILE CG1  C -10.305   4.309  -8.984 1.00 . A A .  22 ILE CG1  1 1 
        2  2834 1 1  22 ILE CG2  C  -9.257   2.270  -7.961 1.00 . A A .  22 ILE CG2  1 1 
        2  2835 1 1  22 ILE H    H  -6.120   3.331  -7.732 1.00 . A A .  22 ILE H    1 1 
        2  2836 1 1  22 ILE HA   H  -7.638   4.948  -9.440 1.00 . A A .  22 ILE HA   1 1 
        2  2837 1 1  22 ILE HB   H  -8.945   2.962  -9.940 1.00 . A A .  22 ILE HB   1 1 
        2  2838 1 1  22 ILE HD11 H -11.152   5.980 -10.005 1.00 . A A .  22 ILE HD11 1 1 
        2  2839 1 1  22 ILE HD12 H -10.160   4.932 -11.019 1.00 . A A .  22 ILE HD12 1 1 
        2  2840 1 1  22 ILE HD13 H  -9.395   6.025  -9.865 1.00 . A A .  22 ILE HD13 1 1 
        2  2841 1 1  22 ILE HG12 H -11.179   3.706  -9.172 1.00 . A A .  22 ILE HG12 1 1 
        2  2842 1 1  22 ILE HG13 H -10.407   4.793  -8.024 1.00 . A A .  22 ILE HG13 1 1 
        2  2843 1 1  22 ILE HG21 H -10.127   1.692  -8.235 1.00 . A A .  22 ILE HG21 1 1 
        2  2844 1 1  22 ILE HG22 H  -9.396   2.682  -6.973 1.00 . A A .  22 ILE HG22 1 1 
        2  2845 1 1  22 ILE HG23 H  -8.385   1.633  -7.968 1.00 . A A .  22 ILE HG23 1 1 
        2  2846 1 1  22 ILE N    N  -6.601   3.386  -8.583 1.00 . A A .  22 ILE N    1 1 
        2  2847 1 1  22 ILE O    O  -7.818   4.371  -6.250 1.00 . A A .  22 ILE O    1 1 
        2  2848 1 1  23 ARG C    C  -9.768   7.222  -5.770 1.00 . A A .  23 ARG C    1 1 
        2  2849 1 1  23 ARG CA   C  -8.313   7.079  -6.190 1.00 . A A .  23 ARG CA   1 1 
        2  2850 1 1  23 ARG CB   C  -7.644   8.462  -6.334 1.00 . A A .  23 ARG CB   1 1 
        2  2851 1 1  23 ARG CD   C  -7.542   8.754  -8.848 1.00 . A A .  23 ARG CD   1 1 
        2  2852 1 1  23 ARG CG   C  -8.076   9.301  -7.532 1.00 . A A .  23 ARG CG   1 1 
        2  2853 1 1  23 ARG CZ   C  -5.310   8.369  -9.827 1.00 . A A .  23 ARG CZ   1 1 
        2  2854 1 1  23 ARG H    H  -8.298   6.689  -8.271 1.00 . A A .  23 ARG H    1 1 
        2  2855 1 1  23 ARG HA   H  -7.800   6.541  -5.407 1.00 . A A .  23 ARG HA   1 1 
        2  2856 1 1  23 ARG HB2  H  -7.856   9.034  -5.444 1.00 . A A .  23 ARG HB2  1 1 
        2  2857 1 1  23 ARG HB3  H  -6.575   8.316  -6.398 1.00 . A A .  23 ARG HB3  1 1 
        2  2858 1 1  23 ARG HD2  H  -8.102   7.868  -9.106 1.00 . A A .  23 ARG HD2  1 1 
        2  2859 1 1  23 ARG HD3  H  -7.682   9.502  -9.616 1.00 . A A .  23 ARG HD3  1 1 
        2  2860 1 1  23 ARG HE   H  -5.753   8.177  -7.882 1.00 . A A .  23 ARG HE   1 1 
        2  2861 1 1  23 ARG HG2  H  -9.153   9.318  -7.575 1.00 . A A .  23 ARG HG2  1 1 
        2  2862 1 1  23 ARG HG3  H  -7.706  10.306  -7.397 1.00 . A A .  23 ARG HG3  1 1 
        2  2863 1 1  23 ARG HH11 H  -6.716   8.974 -11.157 1.00 . A A .  23 ARG HH11 1 1 
        2  2864 1 1  23 ARG HH12 H  -5.144   8.666 -11.824 1.00 . A A .  23 ARG HH12 1 1 
        2  2865 1 1  23 ARG HH21 H  -3.698   7.768  -8.757 1.00 . A A .  23 ARG HH21 1 1 
        2  2866 1 1  23 ARG HH22 H  -3.432   7.971 -10.467 1.00 . A A .  23 ARG HH22 1 1 
        2  2867 1 1  23 ARG N    N  -8.189   6.269  -7.394 1.00 . A A .  23 ARG N    1 1 
        2  2868 1 1  23 ARG NE   N  -6.122   8.410  -8.775 1.00 . A A .  23 ARG NE   1 1 
        2  2869 1 1  23 ARG NH1  N  -5.762   8.694 -11.034 1.00 . A A .  23 ARG NH1  1 1 
        2  2870 1 1  23 ARG NH2  N  -4.047   8.007  -9.673 1.00 . A A .  23 ARG NH2  1 1 
        2  2871 1 1  23 ARG O    O -10.587   7.820  -6.467 1.00 . A A .  23 ARG O    1 1 
        2  2872 1 1  24 THR C    C -11.385   7.529  -2.794 1.00 . A A .  24 THR C    1 1 
        2  2873 1 1  24 THR CA   C -11.406   6.682  -4.062 1.00 . A A .  24 THR CA   1 1 
        2  2874 1 1  24 THR CB   C -11.879   5.252  -3.733 1.00 . A A .  24 THR CB   1 1 
        2  2875 1 1  24 THR CG2  C -13.371   5.207  -3.438 1.00 . A A .  24 THR CG2  1 1 
        2  2876 1 1  24 THR H    H  -9.362   6.185  -4.121 1.00 . A A .  24 THR H    1 1 
        2  2877 1 1  24 THR HA   H -12.080   7.121  -4.785 1.00 . A A .  24 THR HA   1 1 
        2  2878 1 1  24 THR HB   H -11.343   4.902  -2.861 1.00 . A A .  24 THR HB   1 1 
        2  2879 1 1  24 THR HG1  H -10.880   4.772  -5.360 1.00 . A A .  24 THR HG1  1 1 
        2  2880 1 1  24 THR HG21 H -13.591   5.837  -2.591 1.00 . A A .  24 THR HG21 1 1 
        2  2881 1 1  24 THR HG22 H -13.661   4.189  -3.216 1.00 . A A .  24 THR HG22 1 1 
        2  2882 1 1  24 THR HG23 H -13.918   5.557  -4.301 1.00 . A A .  24 THR HG23 1 1 
        2  2883 1 1  24 THR N    N -10.074   6.645  -4.627 1.00 . A A .  24 THR N    1 1 
        2  2884 1 1  24 THR O    O -10.329   7.732  -2.197 1.00 . A A .  24 THR O    1 1 
        2  2885 1 1  24 THR OG1  O -11.590   4.388  -4.839 1.00 . A A .  24 THR OG1  1 1 
        2  2886 1 1  25 GLN C    C -13.510   8.097  -0.179 1.00 . A A .  25 GLN C    1 1 
        2  2887 1 1  25 GLN CA   C -12.606   8.814  -1.164 1.00 . A A .  25 GLN CA   1 1 
        2  2888 1 1  25 GLN CB   C -13.157  10.213  -1.435 1.00 . A A .  25 GLN CB   1 1 
        2  2889 1 1  25 GLN CD   C -11.011  11.306  -2.245 1.00 . A A .  25 GLN CD   1 1 
        2  2890 1 1  25 GLN CG   C -12.454  10.955  -2.563 1.00 . A A .  25 GLN CG   1 1 
        2  2891 1 1  25 GLN H    H -13.340   7.902  -2.921 1.00 . A A .  25 GLN H    1 1 
        2  2892 1 1  25 GLN HA   H -11.614   8.892  -0.746 1.00 . A A .  25 GLN HA   1 1 
        2  2893 1 1  25 GLN HB2  H -14.202  10.128  -1.687 1.00 . A A .  25 GLN HB2  1 1 
        2  2894 1 1  25 GLN HB3  H -13.060  10.799  -0.532 1.00 . A A .  25 GLN HB3  1 1 
        2  2895 1 1  25 GLN HE21 H -11.443  11.504  -0.318 1.00 . A A .  25 GLN HE21 1 1 
        2  2896 1 1  25 GLN HE22 H  -9.796  11.783  -0.753 1.00 . A A .  25 GLN HE22 1 1 
        2  2897 1 1  25 GLN HG2  H -12.467  10.334  -3.447 1.00 . A A .  25 GLN HG2  1 1 
        2  2898 1 1  25 GLN HG3  H -12.994  11.869  -2.762 1.00 . A A .  25 GLN HG3  1 1 
        2  2899 1 1  25 GLN N    N -12.527   8.047  -2.393 1.00 . A A .  25 GLN N    1 1 
        2  2900 1 1  25 GLN NE2  N -10.721  11.556  -0.978 1.00 . A A .  25 GLN NE2  1 1 
        2  2901 1 1  25 GLN O    O -14.547   7.560  -0.566 1.00 . A A .  25 GLN O    1 1 
        2  2902 1 1  25 GLN OE1  O -10.167  11.366  -3.136 1.00 . A A .  25 GLN OE1  1 1 
        2  2903 1 1  26 THR C    C -14.110   8.456   3.269 1.00 . A A .  26 THR C    1 1 
        2  2904 1 1  26 THR CA   C -13.945   7.478   2.111 1.00 . A A .  26 THR CA   1 1 
        2  2905 1 1  26 THR CB   C -13.360   6.135   2.612 1.00 . A A .  26 THR CB   1 1 
        2  2906 1 1  26 THR CG2  C -12.017   6.335   3.294 1.00 . A A .  26 THR CG2  1 1 
        2  2907 1 1  26 THR H    H -12.259   8.480   1.329 1.00 . A A .  26 THR H    1 1 
        2  2908 1 1  26 THR HA   H -14.919   7.285   1.681 1.00 . A A .  26 THR HA   1 1 
        2  2909 1 1  26 THR HB   H -13.218   5.487   1.759 1.00 . A A .  26 THR HB   1 1 
        2  2910 1 1  26 THR HG1  H -15.177   5.666   3.245 1.00 . A A .  26 THR HG1  1 1 
        2  2911 1 1  26 THR HG21 H -11.314   6.752   2.590 1.00 . A A .  26 THR HG21 1 1 
        2  2912 1 1  26 THR HG22 H -11.650   5.385   3.655 1.00 . A A .  26 THR HG22 1 1 
        2  2913 1 1  26 THR HG23 H -12.136   7.014   4.125 1.00 . A A .  26 THR HG23 1 1 
        2  2914 1 1  26 THR N    N -13.120   8.076   1.080 1.00 . A A .  26 THR N    1 1 
        2  2915 1 1  26 THR O    O -13.271   9.342   3.476 1.00 . A A .  26 THR O    1 1 
        2  2916 1 1  26 THR OG1  O -14.264   5.501   3.525 1.00 . A A .  26 THR OG1  1 1 
        2  2917 1 1  27 ALA C    C -14.865   8.679   6.393 1.00 . A A .  27 ALA C    1 1 
        2  2918 1 1  27 ALA CA   C -15.491   9.201   5.108 1.00 . A A .  27 ALA CA   1 1 
        2  2919 1 1  27 ALA CB   C -16.993   9.366   5.281 1.00 . A A .  27 ALA CB   1 1 
        2  2920 1 1  27 ALA H    H -15.840   7.595   3.775 1.00 . A A .  27 ALA H    1 1 
        2  2921 1 1  27 ALA HA   H -15.069  10.169   4.881 1.00 . A A .  27 ALA HA   1 1 
        2  2922 1 1  27 ALA HB1  H -17.437   8.410   5.515 1.00 . A A .  27 ALA HB1  1 1 
        2  2923 1 1  27 ALA HB2  H -17.420   9.748   4.366 1.00 . A A .  27 ALA HB2  1 1 
        2  2924 1 1  27 ALA HB3  H -17.187  10.061   6.086 1.00 . A A .  27 ALA HB3  1 1 
        2  2925 1 1  27 ALA N    N -15.206   8.319   3.995 1.00 . A A .  27 ALA N    1 1 
        2  2926 1 1  27 ALA O    O -14.317   7.576   6.436 1.00 . A A .  27 ALA O    1 1 
        2  2927 1 1  28 MET C    C -15.287   7.992   9.313 1.00 . A A .  28 MET C    1 1 
        2  2928 1 1  28 MET CA   C -14.444   9.115   8.732 1.00 . A A .  28 MET CA   1 1 
        2  2929 1 1  28 MET CB   C -14.433  10.332   9.661 1.00 . A A .  28 MET CB   1 1 
        2  2930 1 1  28 MET CE   C -17.351  13.216  10.437 1.00 . A A .  28 MET CE   1 1 
        2  2931 1 1  28 MET CG   C -15.765  11.065   9.729 1.00 . A A .  28 MET CG   1 1 
        2  2932 1 1  28 MET H    H -15.372  10.348   7.328 1.00 . A A .  28 MET H    1 1 
        2  2933 1 1  28 MET HA   H -13.432   8.760   8.605 1.00 . A A .  28 MET HA   1 1 
        2  2934 1 1  28 MET HB2  H -14.176  10.005  10.658 1.00 . A A .  28 MET HB2  1 1 
        2  2935 1 1  28 MET HB3  H -13.680  11.027   9.316 1.00 . A A .  28 MET HB3  1 1 
        2  2936 1 1  28 MET HE1  H -17.454  14.174  10.926 1.00 . A A .  28 MET HE1  1 1 
        2  2937 1 1  28 MET HE2  H -18.016  12.502  10.900 1.00 . A A .  28 MET HE2  1 1 
        2  2938 1 1  28 MET HE3  H -17.601  13.316   9.392 1.00 . A A .  28 MET HE3  1 1 
        2  2939 1 1  28 MET HG2  H -16.114  11.245   8.723 1.00 . A A .  28 MET HG2  1 1 
        2  2940 1 1  28 MET HG3  H -16.477  10.436  10.245 1.00 . A A .  28 MET HG3  1 1 
        2  2941 1 1  28 MET N    N -14.948   9.485   7.434 1.00 . A A .  28 MET N    1 1 
        2  2942 1 1  28 MET O    O -16.516   8.019   9.232 1.00 . A A .  28 MET O    1 1 
        2  2943 1 1  28 MET SD   S -15.658  12.643  10.595 1.00 . A A .  28 MET SD   1 1 
        2  2944 1 1  29 SER C    C -15.776   4.863   9.384 1.00 . A A .  29 SER C    1 1 
        2  2945 1 1  29 SER CA   C -15.219   5.811  10.451 1.00 . A A .  29 SER CA   1 1 
        2  2946 1 1  29 SER CB   C -16.328   6.204  11.436 1.00 . A A .  29 SER CB   1 1 
        2  2947 1 1  29 SER H    H -13.619   7.065   9.843 1.00 . A A .  29 SER H    1 1 
        2  2948 1 1  29 SER HA   H -14.448   5.287  10.997 1.00 . A A .  29 SER HA   1 1 
        2  2949 1 1  29 SER HB2  H -17.115   6.715  10.904 1.00 . A A .  29 SER HB2  1 1 
        2  2950 1 1  29 SER HB3  H -16.728   5.312  11.897 1.00 . A A .  29 SER HB3  1 1 
        2  2951 1 1  29 SER HG   H -15.334   6.533  13.096 1.00 . A A .  29 SER HG   1 1 
        2  2952 1 1  29 SER N    N -14.598   6.998   9.852 1.00 . A A .  29 SER N    1 1 
        2  2953 1 1  29 SER O    O -16.383   3.841   9.706 1.00 . A A .  29 SER O    1 1 
        2  2954 1 1  29 SER OG   O -15.834   7.061  12.455 1.00 . A A .  29 SER OG   1 1 
        2  2955 1 1  30 GLU C    C -14.986   3.566   6.353 1.00 . A A .  30 GLU C    1 1 
        2  2956 1 1  30 GLU CA   C -16.075   4.416   7.012 1.00 . A A .  30 GLU CA   1 1 
        2  2957 1 1  30 GLU CB   C -16.683   5.392   6.003 1.00 . A A .  30 GLU CB   1 1 
        2  2958 1 1  30 GLU CD   C -17.780   5.763   3.780 1.00 . A A .  30 GLU CD   1 1 
        2  2959 1 1  30 GLU CG   C -17.353   4.741   4.807 1.00 . A A .  30 GLU CG   1 1 
        2  2960 1 1  30 GLU H    H -14.965   5.965   7.931 1.00 . A A .  30 GLU H    1 1 
        2  2961 1 1  30 GLU HA   H -16.850   3.769   7.395 1.00 . A A .  30 GLU HA   1 1 
        2  2962 1 1  30 GLU HB2  H -17.421   5.993   6.509 1.00 . A A .  30 GLU HB2  1 1 
        2  2963 1 1  30 GLU HB3  H -15.900   6.042   5.636 1.00 . A A .  30 GLU HB3  1 1 
        2  2964 1 1  30 GLU HG2  H -16.658   4.054   4.346 1.00 . A A .  30 GLU HG2  1 1 
        2  2965 1 1  30 GLU HG3  H -18.225   4.202   5.145 1.00 . A A .  30 GLU HG3  1 1 
        2  2966 1 1  30 GLU N    N -15.528   5.183   8.124 1.00 . A A .  30 GLU N    1 1 
        2  2967 1 1  30 GLU O    O -15.266   2.745   5.478 1.00 . A A .  30 GLU O    1 1 
        2  2968 1 1  30 GLU OE1  O -16.909   6.258   3.033 1.00 . A A .  30 GLU OE1  1 1 
        2  2969 1 1  30 GLU OE2  O -18.983   6.096   3.727 1.00 . A A .  30 GLU OE2  1 1 
        2  2970 1 1  31 LEU C    C -12.741   1.629   6.011 1.00 . A A .  31 LEU C    1 1 
        2  2971 1 1  31 LEU CA   C -12.571   3.137   6.216 1.00 . A A .  31 LEU CA   1 1 
        2  2972 1 1  31 LEU CB   C -11.344   3.433   7.097 1.00 . A A .  31 LEU CB   1 1 
        2  2973 1 1  31 LEU CD1  C  -8.886   3.905   7.210 1.00 . A A .  31 LEU CD1  1 1 
        2  2974 1 1  31 LEU CD2  C  -9.650   1.629   6.560 1.00 . A A .  31 LEU CD2  1 1 
        2  2975 1 1  31 LEU CG   C  -9.967   3.119   6.486 1.00 . A A .  31 LEU CG   1 1 
        2  2976 1 1  31 LEU H    H -13.642   4.296   7.624 1.00 . A A .  31 LEU H    1 1 
        2  2977 1 1  31 LEU HA   H -12.426   3.602   5.252 1.00 . A A .  31 LEU HA   1 1 
        2  2978 1 1  31 LEU HB2  H -11.363   4.482   7.355 1.00 . A A .  31 LEU HB2  1 1 
        2  2979 1 1  31 LEU HB3  H -11.444   2.859   8.006 1.00 . A A .  31 LEU HB3  1 1 
        2  2980 1 1  31 LEU HD11 H  -8.872   3.623   8.253 1.00 . A A .  31 LEU HD11 1 1 
        2  2981 1 1  31 LEU HD12 H  -9.091   4.961   7.126 1.00 . A A .  31 LEU HD12 1 1 
        2  2982 1 1  31 LEU HD13 H  -7.925   3.688   6.767 1.00 . A A .  31 LEU HD13 1 1 
        2  2983 1 1  31 LEU HD21 H  -9.611   1.320   7.594 1.00 . A A .  31 LEU HD21 1 1 
        2  2984 1 1  31 LEU HD22 H  -8.696   1.439   6.090 1.00 . A A .  31 LEU HD22 1 1 
        2  2985 1 1  31 LEU HD23 H -10.421   1.072   6.047 1.00 . A A .  31 LEU HD23 1 1 
        2  2986 1 1  31 LEU HG   H  -9.960   3.416   5.448 1.00 . A A .  31 LEU HG   1 1 
        2  2987 1 1  31 LEU N    N -13.756   3.742   6.827 1.00 . A A .  31 LEU N    1 1 
        2  2988 1 1  31 LEU O    O -12.655   1.134   4.885 1.00 . A A .  31 LEU O    1 1 
        2  2989 1 1  32 GLY C    C -14.147  -1.046   6.106 1.00 . A A .  32 GLY C    1 1 
        2  2990 1 1  32 GLY CA   C -13.065  -0.539   7.039 1.00 . A A .  32 GLY CA   1 1 
        2  2991 1 1  32 GLY H    H -13.163   1.372   7.947 1.00 . A A .  32 GLY H    1 1 
        2  2992 1 1  32 GLY HA2  H -12.110  -0.914   6.700 1.00 . A A .  32 GLY HA2  1 1 
        2  2993 1 1  32 GLY HA3  H -13.256  -0.919   8.032 1.00 . A A .  32 GLY HA3  1 1 
        2  2994 1 1  32 GLY N    N -13.003   0.911   7.097 1.00 . A A .  32 GLY N    1 1 
        2  2995 1 1  32 GLY O    O -13.898  -1.921   5.273 1.00 . A A .  32 GLY O    1 1 
        2  2996 1 1  33 SER C    C -16.260  -0.623   3.950 1.00 . A A .  33 SER C    1 1 
        2  2997 1 1  33 SER CA   C -16.481  -0.913   5.435 1.00 . A A .  33 SER CA   1 1 
        2  2998 1 1  33 SER CB   C -17.743  -0.208   5.925 1.00 . A A .  33 SER CB   1 1 
        2  2999 1 1  33 SER H    H -15.458   0.250   6.878 1.00 . A A .  33 SER H    1 1 
        2  3000 1 1  33 SER HA   H -16.599  -1.978   5.569 1.00 . A A .  33 SER HA   1 1 
        2  3001 1 1  33 SER HB2  H -17.680   0.845   5.691 1.00 . A A .  33 SER HB2  1 1 
        2  3002 1 1  33 SER HB3  H -18.606  -0.633   5.434 1.00 . A A .  33 SER HB3  1 1 
        2  3003 1 1  33 SER HG   H -17.207  -0.949   7.668 1.00 . A A .  33 SER HG   1 1 
        2  3004 1 1  33 SER N    N -15.341  -0.481   6.231 1.00 . A A .  33 SER N    1 1 
        2  3005 1 1  33 SER O    O -16.662  -1.406   3.089 1.00 . A A .  33 SER O    1 1 
        2  3006 1 1  33 SER OG   O -17.895  -0.353   7.328 1.00 . A A .  33 SER OG   1 1 
        2  3007 1 1  34 LEU C    C -14.432  -0.081   1.595 1.00 . A A .  34 LEU C    1 1 
        2  3008 1 1  34 LEU CA   C -15.365   0.912   2.288 1.00 . A A .  34 LEU CA   1 1 
        2  3009 1 1  34 LEU CB   C -14.764   2.328   2.273 1.00 . A A .  34 LEU CB   1 1 
        2  3010 1 1  34 LEU CD1  C -14.045   2.579  -0.141 1.00 . A A .  34 LEU CD1  1 1 
        2  3011 1 1  34 LEU CD2  C -16.384   3.136   0.532 1.00 . A A .  34 LEU CD2  1 1 
        2  3012 1 1  34 LEU CG   C -14.928   3.127   0.970 1.00 . A A .  34 LEU CG   1 1 
        2  3013 1 1  34 LEU H    H -15.279   1.063   4.398 1.00 . A A .  34 LEU H    1 1 
        2  3014 1 1  34 LEU HA   H -16.313   0.922   1.771 1.00 . A A .  34 LEU HA   1 1 
        2  3015 1 1  34 LEU HB2  H -15.222   2.894   3.070 1.00 . A A .  34 LEU HB2  1 1 
        2  3016 1 1  34 LEU HB3  H -13.708   2.243   2.481 1.00 . A A .  34 LEU HB3  1 1 
        2  3017 1 1  34 LEU HD11 H -14.291   1.541  -0.317 1.00 . A A .  34 LEU HD11 1 1 
        2  3018 1 1  34 LEU HD12 H -13.007   2.660   0.149 1.00 . A A .  34 LEU HD12 1 1 
        2  3019 1 1  34 LEU HD13 H -14.211   3.146  -1.045 1.00 . A A .  34 LEU HD13 1 1 
        2  3020 1 1  34 LEU HD21 H -16.481   3.700  -0.383 1.00 . A A .  34 LEU HD21 1 1 
        2  3021 1 1  34 LEU HD22 H -16.989   3.590   1.302 1.00 . A A .  34 LEU HD22 1 1 
        2  3022 1 1  34 LEU HD23 H -16.715   2.121   0.366 1.00 . A A .  34 LEU HD23 1 1 
        2  3023 1 1  34 LEU HG   H -14.633   4.150   1.150 1.00 . A A .  34 LEU HG   1 1 
        2  3024 1 1  34 LEU N    N -15.607   0.496   3.662 1.00 . A A .  34 LEU N    1 1 
        2  3025 1 1  34 LEU O    O -14.699  -0.520   0.477 1.00 . A A .  34 LEU O    1 1 
        2  3026 1 1  35 PHE C    C -12.936  -2.729   1.406 1.00 . A A .  35 PHE C    1 1 
        2  3027 1 1  35 PHE CA   C -12.355  -1.351   1.710 1.00 . A A .  35 PHE CA   1 1 
        2  3028 1 1  35 PHE CB   C -11.141  -1.477   2.638 1.00 . A A .  35 PHE CB   1 1 
        2  3029 1 1  35 PHE CD1  C -10.294   0.866   2.969 1.00 . A A .  35 PHE CD1  1 1 
        2  3030 1 1  35 PHE CD2  C  -8.972  -0.652   1.695 1.00 . A A .  35 PHE CD2  1 1 
        2  3031 1 1  35 PHE CE1  C  -9.352   1.856   2.774 1.00 . A A .  35 PHE CE1  1 1 
        2  3032 1 1  35 PHE CE2  C  -8.025   0.333   1.495 1.00 . A A .  35 PHE CE2  1 1 
        2  3033 1 1  35 PHE CG   C -10.115  -0.398   2.433 1.00 . A A .  35 PHE CG   1 1 
        2  3034 1 1  35 PHE CZ   C  -8.216   1.590   2.035 1.00 . A A .  35 PHE CZ   1 1 
        2  3035 1 1  35 PHE H    H -13.224  -0.102   3.189 1.00 . A A .  35 PHE H    1 1 
        2  3036 1 1  35 PHE HA   H -12.025  -0.913   0.780 1.00 . A A .  35 PHE HA   1 1 
        2  3037 1 1  35 PHE HB2  H -11.473  -1.428   3.665 1.00 . A A .  35 PHE HB2  1 1 
        2  3038 1 1  35 PHE HB3  H -10.662  -2.430   2.465 1.00 . A A .  35 PHE HB3  1 1 
        2  3039 1 1  35 PHE HD1  H -11.183   1.075   3.547 1.00 . A A .  35 PHE HD1  1 1 
        2  3040 1 1  35 PHE HD2  H  -8.821  -1.634   1.273 1.00 . A A .  35 PHE HD2  1 1 
        2  3041 1 1  35 PHE HE1  H  -9.504   2.837   3.198 1.00 . A A .  35 PHE HE1  1 1 
        2  3042 1 1  35 PHE HE2  H  -7.138   0.122   0.918 1.00 . A A .  35 PHE HE2  1 1 
        2  3043 1 1  35 PHE HZ   H  -7.478   2.361   1.880 1.00 . A A .  35 PHE HZ   1 1 
        2  3044 1 1  35 PHE N    N -13.353  -0.448   2.278 1.00 . A A .  35 PHE N    1 1 
        2  3045 1 1  35 PHE O    O -12.624  -3.313   0.369 1.00 . A A .  35 PHE O    1 1 
        2  3046 1 1  36 GLU C    C -15.155  -4.645   0.792 1.00 . A A .  36 GLU C    1 1 
        2  3047 1 1  36 GLU CA   C -14.390  -4.559   2.108 1.00 . A A .  36 GLU CA   1 1 
        2  3048 1 1  36 GLU CB   C -15.327  -4.908   3.263 1.00 . A A .  36 GLU CB   1 1 
        2  3049 1 1  36 GLU CD   C -15.538  -5.691   5.645 1.00 . A A .  36 GLU CD   1 1 
        2  3050 1 1  36 GLU CG   C -14.618  -5.122   4.587 1.00 . A A .  36 GLU CG   1 1 
        2  3051 1 1  36 GLU H    H -14.021  -2.713   3.091 1.00 . A A .  36 GLU H    1 1 
        2  3052 1 1  36 GLU HA   H -13.586  -5.280   2.083 1.00 . A A .  36 GLU HA   1 1 
        2  3053 1 1  36 GLU HB2  H -16.039  -4.105   3.387 1.00 . A A .  36 GLU HB2  1 1 
        2  3054 1 1  36 GLU HB3  H -15.861  -5.814   3.013 1.00 . A A .  36 GLU HB3  1 1 
        2  3055 1 1  36 GLU HG2  H -13.800  -5.809   4.434 1.00 . A A .  36 GLU HG2  1 1 
        2  3056 1 1  36 GLU HG3  H -14.236  -4.174   4.935 1.00 . A A .  36 GLU HG3  1 1 
        2  3057 1 1  36 GLU N    N -13.790  -3.236   2.294 1.00 . A A .  36 GLU N    1 1 
        2  3058 1 1  36 GLU O    O -15.035  -5.627   0.057 1.00 . A A .  36 GLU O    1 1 
        2  3059 1 1  36 GLU OE1  O -15.635  -6.935   5.750 1.00 . A A .  36 GLU OE1  1 1 
        2  3060 1 1  36 GLU OE2  O -16.172  -4.904   6.375 1.00 . A A .  36 GLU OE2  1 1 
        2  3061 1 1  37 ALA C    C -15.799  -3.241  -1.920 1.00 . A A .  37 ALA C    1 1 
        2  3062 1 1  37 ALA CA   C -16.701  -3.587  -0.743 1.00 . A A .  37 ALA CA   1 1 
        2  3063 1 1  37 ALA CB   C -17.840  -2.588  -0.636 1.00 . A A .  37 ALA CB   1 1 
        2  3064 1 1  37 ALA H    H -16.007  -2.866   1.122 1.00 . A A .  37 ALA H    1 1 
        2  3065 1 1  37 ALA HA   H -17.125  -4.569  -0.901 1.00 . A A .  37 ALA HA   1 1 
        2  3066 1 1  37 ALA HB1  H -17.439  -1.605  -0.437 1.00 . A A .  37 ALA HB1  1 1 
        2  3067 1 1  37 ALA HB2  H -18.500  -2.878   0.169 1.00 . A A .  37 ALA HB2  1 1 
        2  3068 1 1  37 ALA HB3  H -18.391  -2.571  -1.564 1.00 . A A .  37 ALA HB3  1 1 
        2  3069 1 1  37 ALA N    N -15.939  -3.620   0.495 1.00 . A A .  37 ALA N    1 1 
        2  3070 1 1  37 ALA O    O -15.973  -3.763  -3.022 1.00 . A A .  37 ALA O    1 1 
        2  3071 1 1  38 GLY C    C -13.190  -2.994  -3.434 1.00 . A A .  38 GLY C    1 1 
        2  3072 1 1  38 GLY CA   C -13.931  -1.894  -2.700 1.00 . A A .  38 GLY CA   1 1 
        2  3073 1 1  38 GLY H    H -14.698  -2.059  -0.737 1.00 . A A .  38 GLY H    1 1 
        2  3074 1 1  38 GLY HA2  H -14.515  -1.337  -3.416 1.00 . A A .  38 GLY HA2  1 1 
        2  3075 1 1  38 GLY HA3  H -13.208  -1.228  -2.252 1.00 . A A .  38 GLY HA3  1 1 
        2  3076 1 1  38 GLY N    N -14.817  -2.380  -1.659 1.00 . A A .  38 GLY N    1 1 
        2  3077 1 1  38 GLY O    O -13.268  -3.082  -4.656 1.00 . A A .  38 GLY O    1 1 
        2  3078 1 1  39 TYR C    C -12.521  -6.050  -3.791 1.00 . A A .  39 TYR C    1 1 
        2  3079 1 1  39 TYR CA   C -11.662  -4.873  -3.339 1.00 . A A .  39 TYR CA   1 1 
        2  3080 1 1  39 TYR CB   C -10.528  -5.354  -2.421 1.00 . A A .  39 TYR CB   1 1 
        2  3081 1 1  39 TYR CD1  C -11.579  -6.022  -0.213 1.00 . A A .  39 TYR CD1  1 1 
        2  3082 1 1  39 TYR CD2  C -10.654  -7.735  -1.585 1.00 . A A .  39 TYR CD2  1 1 
        2  3083 1 1  39 TYR CE1  C -11.936  -6.967   0.730 1.00 . A A .  39 TYR CE1  1 1 
        2  3084 1 1  39 TYR CE2  C -11.009  -8.684  -0.649 1.00 . A A .  39 TYR CE2  1 1 
        2  3085 1 1  39 TYR CG   C -10.934  -6.387  -1.386 1.00 . A A .  39 TYR CG   1 1 
        2  3086 1 1  39 TYR CZ   C -11.650  -8.296   0.505 1.00 . A A .  39 TYR CZ   1 1 
        2  3087 1 1  39 TYR H    H -12.506  -3.783  -1.720 1.00 . A A .  39 TYR H    1 1 
        2  3088 1 1  39 TYR HA   H -11.223  -4.425  -4.220 1.00 . A A .  39 TYR HA   1 1 
        2  3089 1 1  39 TYR HB2  H  -9.756  -5.796  -3.031 1.00 . A A .  39 TYR HB2  1 1 
        2  3090 1 1  39 TYR HB3  H -10.114  -4.503  -1.898 1.00 . A A .  39 TYR HB3  1 1 
        2  3091 1 1  39 TYR HD1  H -11.805  -4.980  -0.042 1.00 . A A .  39 TYR HD1  1 1 
        2  3092 1 1  39 TYR HD2  H -10.151  -8.037  -2.490 1.00 . A A .  39 TYR HD2  1 1 
        2  3093 1 1  39 TYR HE1  H -12.439  -6.662   1.637 1.00 . A A .  39 TYR HE1  1 1 
        2  3094 1 1  39 TYR HE2  H -10.785  -9.726  -0.825 1.00 . A A .  39 TYR HE2  1 1 
        2  3095 1 1  39 TYR HH   H -11.225  -9.799   1.636 1.00 . A A .  39 TYR HH   1 1 
        2  3096 1 1  39 TYR N    N -12.479  -3.846  -2.699 1.00 . A A .  39 TYR N    1 1 
        2  3097 1 1  39 TYR O    O -12.088  -6.867  -4.603 1.00 . A A .  39 TYR O    1 1 
        2  3098 1 1  39 TYR OH   O -11.997  -9.241   1.442 1.00 . A A .  39 TYR OH   1 1 
        2  3099 1 1  40 HIS C    C -15.123  -6.973  -5.080 1.00 . A A .  40 HIS C    1 1 
        2  3100 1 1  40 HIS CA   C -14.645  -7.200  -3.653 1.00 . A A .  40 HIS CA   1 1 
        2  3101 1 1  40 HIS CB   C -15.840  -7.284  -2.703 1.00 . A A .  40 HIS CB   1 1 
        2  3102 1 1  40 HIS CD2  C -16.432  -9.792  -2.379 1.00 . A A .  40 HIS CD2  1 1 
        2  3103 1 1  40 HIS CE1  C -18.278  -9.848  -3.554 1.00 . A A .  40 HIS CE1  1 1 
        2  3104 1 1  40 HIS CG   C -16.643  -8.543  -2.862 1.00 . A A .  40 HIS CG   1 1 
        2  3105 1 1  40 HIS H    H -14.027  -5.462  -2.613 1.00 . A A .  40 HIS H    1 1 
        2  3106 1 1  40 HIS HA   H -14.097  -8.131  -3.614 1.00 . A A .  40 HIS HA   1 1 
        2  3107 1 1  40 HIS HB2  H -15.484  -7.243  -1.684 1.00 . A A .  40 HIS HB2  1 1 
        2  3108 1 1  40 HIS HB3  H -16.494  -6.444  -2.885 1.00 . A A .  40 HIS HB3  1 1 
        2  3109 1 1  40 HIS HD1  H -18.236  -7.865  -4.083 1.00 . A A .  40 HIS HD1  1 1 
        2  3110 1 1  40 HIS HD2  H -15.605 -10.106  -1.758 1.00 . A A .  40 HIS HD2  1 1 
        2  3111 1 1  40 HIS HE1  H -19.179 -10.196  -4.038 1.00 . A A .  40 HIS HE1  1 1 
        2  3112 1 1  40 HIS HE2  H -17.472 -11.573  -2.799 1.00 . A A .  40 HIS HE2  1 1 
        2  3113 1 1  40 HIS N    N -13.737  -6.133  -3.265 1.00 . A A .  40 HIS N    1 1 
        2  3114 1 1  40 HIS ND1  N -17.808  -8.614  -3.595 1.00 . A A .  40 HIS ND1  1 1 
        2  3115 1 1  40 HIS NE2  N -17.463 -10.582  -2.824 1.00 . A A .  40 HIS NE2  1 1 
        2  3116 1 1  40 HIS O    O -15.145  -7.898  -5.891 1.00 . A A .  40 HIS O    1 1 
        2  3117 1 1  41 ASP C    C -14.926  -4.415  -7.356 1.00 . A A .  41 ASP C    1 1 
        2  3118 1 1  41 ASP CA   C -15.915  -5.388  -6.736 1.00 . A A .  41 ASP CA   1 1 
        2  3119 1 1  41 ASP CB   C -17.327  -4.795  -6.743 1.00 . A A .  41 ASP CB   1 1 
        2  3120 1 1  41 ASP CG   C -17.819  -4.491  -8.147 1.00 . A A .  41 ASP CG   1 1 
        2  3121 1 1  41 ASP H    H -15.478  -5.038  -4.695 1.00 . A A .  41 ASP H    1 1 
        2  3122 1 1  41 ASP HA   H -15.915  -6.296  -7.323 1.00 . A A .  41 ASP HA   1 1 
        2  3123 1 1  41 ASP HB2  H -18.008  -5.498  -6.286 1.00 . A A .  41 ASP HB2  1 1 
        2  3124 1 1  41 ASP HB3  H -17.328  -3.876  -6.174 1.00 . A A .  41 ASP HB3  1 1 
        2  3125 1 1  41 ASP N    N -15.496  -5.737  -5.388 1.00 . A A .  41 ASP N    1 1 
        2  3126 1 1  41 ASP O    O -15.152  -3.209  -7.394 1.00 . A A .  41 ASP O    1 1 
        2  3127 1 1  41 ASP OD1  O -17.796  -5.406  -9.001 1.00 . A A .  41 ASP OD1  1 1 
        2  3128 1 1  41 ASP OD2  O -18.236  -3.340  -8.406 1.00 . A A .  41 ASP OD2  1 1 
        2  3129 1 1  42 ILE C    C -11.957  -4.961  -9.431 1.00 . A A .  42 ILE C    1 1 
        2  3130 1 1  42 ILE CA   C -12.768  -4.134  -8.431 1.00 . A A .  42 ILE CA   1 1 
        2  3131 1 1  42 ILE CB   C -11.817  -3.515  -7.372 1.00 . A A .  42 ILE CB   1 1 
        2  3132 1 1  42 ILE CD1  C -10.064  -1.696  -7.007 1.00 . A A .  42 ILE CD1  1 1 
        2  3133 1 1  42 ILE CG1  C -10.933  -2.435  -8.004 1.00 . A A .  42 ILE CG1  1 1 
        2  3134 1 1  42 ILE CG2  C -10.959  -4.592  -6.724 1.00 . A A .  42 ILE CG2  1 1 
        2  3135 1 1  42 ILE H    H -13.662  -5.911  -7.702 1.00 . A A .  42 ILE H    1 1 
        2  3136 1 1  42 ILE HA   H -13.257  -3.328  -8.958 1.00 . A A .  42 ILE HA   1 1 
        2  3137 1 1  42 ILE HB   H -12.423  -3.064  -6.601 1.00 . A A .  42 ILE HB   1 1 
        2  3138 1 1  42 ILE HD11 H -10.691  -1.194  -6.287 1.00 . A A .  42 ILE HD11 1 1 
        2  3139 1 1  42 ILE HD12 H  -9.458  -0.969  -7.526 1.00 . A A .  42 ILE HD12 1 1 
        2  3140 1 1  42 ILE HD13 H  -9.423  -2.400  -6.496 1.00 . A A .  42 ILE HD13 1 1 
        2  3141 1 1  42 ILE HG12 H -10.282  -2.892  -8.735 1.00 . A A .  42 ILE HG12 1 1 
        2  3142 1 1  42 ILE HG13 H -11.562  -1.709  -8.497 1.00 . A A .  42 ILE HG13 1 1 
        2  3143 1 1  42 ILE HG21 H -10.383  -5.101  -7.482 1.00 . A A .  42 ILE HG21 1 1 
        2  3144 1 1  42 ILE HG22 H -11.597  -5.304  -6.220 1.00 . A A .  42 ILE HG22 1 1 
        2  3145 1 1  42 ILE HG23 H -10.291  -4.138  -6.008 1.00 . A A .  42 ILE HG23 1 1 
        2  3146 1 1  42 ILE N    N -13.802  -4.949  -7.804 1.00 . A A .  42 ILE N    1 1 
        2  3147 1 1  42 ILE O    O -11.364  -4.423 -10.366 1.00 . A A .  42 ILE O    1 1 
        2  3148 1 1  43 LEU C    C -11.969  -7.644 -11.300 1.00 . A A .  43 LEU C    1 1 
        2  3149 1 1  43 LEU CA   C -11.175  -7.179 -10.080 1.00 . A A .  43 LEU CA   1 1 
        2  3150 1 1  43 LEU CB   C -10.734  -8.394  -9.258 1.00 . A A .  43 LEU CB   1 1 
        2  3151 1 1  43 LEU CD1  C  -9.589  -9.346  -7.242 1.00 . A A .  43 LEU CD1  1 1 
        2  3152 1 1  43 LEU CD2  C  -8.605  -7.374  -8.413 1.00 . A A .  43 LEU CD2  1 1 
        2  3153 1 1  43 LEU CG   C  -9.896  -8.075  -8.018 1.00 . A A .  43 LEU CG   1 1 
        2  3154 1 1  43 LEU H    H -12.502  -6.653  -8.523 1.00 . A A .  43 LEU H    1 1 
        2  3155 1 1  43 LEU HA   H -10.298  -6.646 -10.415 1.00 . A A .  43 LEU HA   1 1 
        2  3156 1 1  43 LEU HB2  H -11.618  -8.930  -8.942 1.00 . A A .  43 LEU HB2  1 1 
        2  3157 1 1  43 LEU HB3  H -10.153  -9.041  -9.900 1.00 . A A .  43 LEU HB3  1 1 
        2  3158 1 1  43 LEU HD11 H -10.513  -9.815  -6.938 1.00 . A A .  43 LEU HD11 1 1 
        2  3159 1 1  43 LEU HD12 H  -9.005  -9.100  -6.367 1.00 . A A .  43 LEU HD12 1 1 
        2  3160 1 1  43 LEU HD13 H  -9.031 -10.025  -7.868 1.00 . A A .  43 LEU HD13 1 1 
        2  3161 1 1  43 LEU HD21 H  -8.840  -6.458  -8.935 1.00 . A A .  43 LEU HD21 1 1 
        2  3162 1 1  43 LEU HD22 H  -8.029  -8.019  -9.058 1.00 . A A .  43 LEU HD22 1 1 
        2  3163 1 1  43 LEU HD23 H  -8.033  -7.146  -7.526 1.00 . A A .  43 LEU HD23 1 1 
        2  3164 1 1  43 LEU HG   H -10.455  -7.413  -7.372 1.00 . A A .  43 LEU HG   1 1 
        2  3165 1 1  43 LEU N    N -11.963  -6.277  -9.247 1.00 . A A .  43 LEU N    1 1 
        2  3166 1 1  43 LEU O    O -11.630  -8.652 -11.915 1.00 . A A .  43 LEU O    1 1 
        2  3167 1 1  44 GLN C    C -13.099  -7.417 -14.068 1.00 . A A .  44 GLN C    1 1 
        2  3168 1 1  44 GLN CA   C -13.884  -7.249 -12.768 1.00 . A A .  44 GLN CA   1 1 
        2  3169 1 1  44 GLN CB   C -14.964  -6.180 -12.952 1.00 . A A .  44 GLN CB   1 1 
        2  3170 1 1  44 GLN CD   C -16.779  -7.740 -13.757 1.00 . A A .  44 GLN CD   1 1 
        2  3171 1 1  44 GLN CG   C -15.963  -6.497 -14.052 1.00 . A A .  44 GLN CG   1 1 
        2  3172 1 1  44 GLN H    H -13.182  -6.065 -11.159 1.00 . A A .  44 GLN H    1 1 
        2  3173 1 1  44 GLN HA   H -14.358  -8.188 -12.527 1.00 . A A .  44 GLN HA   1 1 
        2  3174 1 1  44 GLN HB2  H -15.507  -6.071 -12.026 1.00 . A A .  44 GLN HB2  1 1 
        2  3175 1 1  44 GLN HB3  H -14.485  -5.240 -13.189 1.00 . A A .  44 GLN HB3  1 1 
        2  3176 1 1  44 GLN HE21 H -15.436  -8.884 -14.669 1.00 . A A .  44 GLN HE21 1 1 
        2  3177 1 1  44 GLN HE22 H -16.807  -9.711 -14.005 1.00 . A A .  44 GLN HE22 1 1 
        2  3178 1 1  44 GLN HG2  H -16.636  -5.660 -14.159 1.00 . A A .  44 GLN HG2  1 1 
        2  3179 1 1  44 GLN HG3  H -15.425  -6.648 -14.977 1.00 . A A .  44 GLN HG3  1 1 
        2  3180 1 1  44 GLN N    N -13.005  -6.891 -11.654 1.00 . A A .  44 GLN N    1 1 
        2  3181 1 1  44 GLN NE2  N -16.291  -8.890 -14.186 1.00 . A A .  44 GLN NE2  1 1 
        2  3182 1 1  44 GLN O    O -13.196  -8.450 -14.731 1.00 . A A .  44 GLN O    1 1 
        2  3183 1 1  44 GLN OE1  O -17.839  -7.665 -13.139 1.00 . A A .  44 GLN OE1  1 1 
        2  3184 1 1  45 LEU C    C -10.435  -7.474 -15.572 1.00 . A A .  45 LEU C    1 1 
        2  3185 1 1  45 LEU CA   C -11.548  -6.430 -15.656 1.00 . A A .  45 LEU CA   1 1 
        2  3186 1 1  45 LEU CB   C -10.971  -5.035 -15.955 1.00 . A A .  45 LEU CB   1 1 
        2  3187 1 1  45 LEU CD1  C  -8.587  -4.830 -15.165 1.00 . A A .  45 LEU CD1  1 1 
        2  3188 1 1  45 LEU CD2  C -10.180  -2.941 -14.816 1.00 . A A .  45 LEU CD2  1 1 
        2  3189 1 1  45 LEU CG   C -10.033  -4.452 -14.888 1.00 . A A .  45 LEU CG   1 1 
        2  3190 1 1  45 LEU H    H -12.290  -5.601 -13.848 1.00 . A A .  45 LEU H    1 1 
        2  3191 1 1  45 LEU HA   H -12.216  -6.708 -16.458 1.00 . A A .  45 LEU HA   1 1 
        2  3192 1 1  45 LEU HB2  H -10.424  -5.090 -16.884 1.00 . A A .  45 LEU HB2  1 1 
        2  3193 1 1  45 LEU HB3  H -11.795  -4.350 -16.087 1.00 . A A .  45 LEU HB3  1 1 
        2  3194 1 1  45 LEU HD11 H  -8.287  -4.427 -16.121 1.00 . A A .  45 LEU HD11 1 1 
        2  3195 1 1  45 LEU HD12 H  -8.494  -5.906 -15.185 1.00 . A A .  45 LEU HD12 1 1 
        2  3196 1 1  45 LEU HD13 H  -7.953  -4.428 -14.390 1.00 . A A .  45 LEU HD13 1 1 
        2  3197 1 1  45 LEU HD21 H  -9.943  -2.510 -15.777 1.00 . A A .  45 LEU HD21 1 1 
        2  3198 1 1  45 LEU HD22 H  -9.505  -2.551 -14.070 1.00 . A A .  45 LEU HD22 1 1 
        2  3199 1 1  45 LEU HD23 H -11.196  -2.689 -14.549 1.00 . A A .  45 LEU HD23 1 1 
        2  3200 1 1  45 LEU HG   H -10.304  -4.858 -13.925 1.00 . A A .  45 LEU HG   1 1 
        2  3201 1 1  45 LEU N    N -12.328  -6.399 -14.424 1.00 . A A .  45 LEU N    1 1 
        2  3202 1 1  45 LEU O    O -10.104  -8.129 -16.559 1.00 . A A .  45 LEU O    1 1 
        2  3203 1 1  46 LEU C    C  -9.251  -9.998 -14.359 1.00 . A A .  46 LEU C    1 1 
        2  3204 1 1  46 LEU CA   C  -8.781  -8.564 -14.154 1.00 . A A .  46 LEU CA   1 1 
        2  3205 1 1  46 LEU CB   C  -8.234  -8.375 -12.735 1.00 . A A .  46 LEU CB   1 1 
        2  3206 1 1  46 LEU CD1  C  -6.235  -8.110 -11.247 1.00 . A A .  46 LEU CD1  1 1 
        2  3207 1 1  46 LEU CD2  C  -6.550 -10.227 -12.514 1.00 . A A .  46 LEU CD2  1 1 
        2  3208 1 1  46 LEU CG   C  -6.755  -8.722 -12.538 1.00 . A A .  46 LEU CG   1 1 
        2  3209 1 1  46 LEU H    H -10.244  -7.137 -13.617 1.00 . A A .  46 LEU H    1 1 
        2  3210 1 1  46 LEU HA   H  -8.004  -8.338 -14.870 1.00 . A A .  46 LEU HA   1 1 
        2  3211 1 1  46 LEU HB2  H  -8.386  -7.346 -12.450 1.00 . A A .  46 LEU HB2  1 1 
        2  3212 1 1  46 LEU HB3  H  -8.813  -8.999 -12.069 1.00 . A A .  46 LEU HB3  1 1 
        2  3213 1 1  46 LEU HD11 H  -6.318  -7.034 -11.298 1.00 . A A .  46 LEU HD11 1 1 
        2  3214 1 1  46 LEU HD12 H  -5.200  -8.385 -11.109 1.00 . A A .  46 LEU HD12 1 1 
        2  3215 1 1  46 LEU HD13 H  -6.819  -8.476 -10.416 1.00 . A A .  46 LEU HD13 1 1 
        2  3216 1 1  46 LEU HD21 H  -6.886 -10.651 -13.450 1.00 . A A .  46 LEU HD21 1 1 
        2  3217 1 1  46 LEU HD22 H  -7.119 -10.653 -11.701 1.00 . A A .  46 LEU HD22 1 1 
        2  3218 1 1  46 LEU HD23 H  -5.503 -10.445 -12.376 1.00 . A A .  46 LEU HD23 1 1 
        2  3219 1 1  46 LEU HG   H  -6.181  -8.315 -13.358 1.00 . A A .  46 LEU HG   1 1 
        2  3220 1 1  46 LEU N    N  -9.889  -7.644 -14.374 1.00 . A A .  46 LEU N    1 1 
        2  3221 1 1  46 LEU O    O  -8.643 -10.769 -15.106 1.00 . A A .  46 LEU O    1 1 
        2  3222 1 1  47 ALA C    C -11.492 -11.873 -15.231 1.00 . A A .  47 ALA C    1 1 
        2  3223 1 1  47 ALA CA   C -10.951 -11.658 -13.822 1.00 . A A .  47 ALA CA   1 1 
        2  3224 1 1  47 ALA CB   C -12.062 -11.829 -12.799 1.00 . A A .  47 ALA CB   1 1 
        2  3225 1 1  47 ALA H    H -10.759  -9.678 -13.088 1.00 . A A .  47 ALA H    1 1 
        2  3226 1 1  47 ALA HA   H -10.188 -12.394 -13.621 1.00 . A A .  47 ALA HA   1 1 
        2  3227 1 1  47 ALA HB1  H -12.840 -11.104 -12.989 1.00 . A A .  47 ALA HB1  1 1 
        2  3228 1 1  47 ALA HB2  H -11.665 -11.679 -11.806 1.00 . A A .  47 ALA HB2  1 1 
        2  3229 1 1  47 ALA HB3  H -12.472 -12.824 -12.877 1.00 . A A .  47 ALA HB3  1 1 
        2  3230 1 1  47 ALA N    N -10.347 -10.338 -13.693 1.00 . A A .  47 ALA N    1 1 
        2  3231 1 1  47 ALA O    O -11.526 -12.996 -15.733 1.00 . A A .  47 ALA O    1 1 
        2  3232 1 1  48 GLY C    C -11.367 -11.252 -18.225 1.00 . A A .  48 GLY C    1 1 
        2  3233 1 1  48 GLY CA   C -12.431 -10.856 -17.217 1.00 . A A .  48 GLY CA   1 1 
        2  3234 1 1  48 GLY H    H -11.882  -9.920 -15.402 1.00 . A A .  48 GLY H    1 1 
        2  3235 1 1  48 GLY HA2  H -13.229 -11.584 -17.246 1.00 . A A .  48 GLY HA2  1 1 
        2  3236 1 1  48 GLY HA3  H -12.828  -9.891 -17.491 1.00 . A A .  48 GLY HA3  1 1 
        2  3237 1 1  48 GLY N    N -11.914 -10.784 -15.865 1.00 . A A .  48 GLY N    1 1 
        2  3238 1 1  48 GLY O    O -11.619 -12.070 -19.113 1.00 . A A .  48 GLY O    1 1 
        2  3239 1 1  49 GLN C    C  -8.447 -12.341 -18.634 1.00 . A A .  49 GLN C    1 1 
        2  3240 1 1  49 GLN CA   C  -9.065 -10.990 -18.980 1.00 . A A .  49 GLN CA   1 1 
        2  3241 1 1  49 GLN CB   C  -7.989  -9.901 -18.914 1.00 . A A .  49 GLN CB   1 1 
        2  3242 1 1  49 GLN CD   C  -7.373  -7.482 -19.320 1.00 . A A .  49 GLN CD   1 1 
        2  3243 1 1  49 GLN CG   C  -8.491  -8.508 -19.269 1.00 . A A .  49 GLN CG   1 1 
        2  3244 1 1  49 GLN H    H -10.038 -10.030 -17.355 1.00 . A A .  49 GLN H    1 1 
        2  3245 1 1  49 GLN HA   H  -9.457 -11.035 -19.986 1.00 . A A .  49 GLN HA   1 1 
        2  3246 1 1  49 GLN HB2  H  -7.588  -9.869 -17.911 1.00 . A A .  49 GLN HB2  1 1 
        2  3247 1 1  49 GLN HB3  H  -7.193 -10.159 -19.599 1.00 . A A .  49 GLN HB3  1 1 
        2  3248 1 1  49 GLN HE21 H  -8.387  -6.398 -20.639 1.00 . A A .  49 GLN HE21 1 1 
        2  3249 1 1  49 GLN HE22 H  -6.835  -5.784 -20.193 1.00 . A A .  49 GLN HE22 1 1 
        2  3250 1 1  49 GLN HG2  H  -8.968  -8.547 -20.237 1.00 . A A .  49 GLN HG2  1 1 
        2  3251 1 1  49 GLN HG3  H  -9.209  -8.198 -18.525 1.00 . A A .  49 GLN HG3  1 1 
        2  3252 1 1  49 GLN N    N -10.174 -10.681 -18.081 1.00 . A A .  49 GLN N    1 1 
        2  3253 1 1  49 GLN NE2  N  -7.551  -6.449 -20.129 1.00 . A A .  49 GLN NE2  1 1 
        2  3254 1 1  49 GLN O    O  -7.715 -12.924 -19.436 1.00 . A A .  49 GLN O    1 1 
        2  3255 1 1  49 GLN OE1  O  -6.362  -7.607 -18.628 1.00 . A A .  49 GLN OE1  1 1 
        2  3256 1 1  50 GLY C    C  -6.732 -13.968 -16.602 1.00 . A A .  50 GLY C    1 1 
        2  3257 1 1  50 GLY CA   C  -8.186 -14.099 -16.999 1.00 . A A .  50 GLY CA   1 1 
        2  3258 1 1  50 GLY H    H  -9.343 -12.332 -16.846 1.00 . A A .  50 GLY H    1 1 
        2  3259 1 1  50 GLY HA2  H  -8.753 -14.456 -16.151 1.00 . A A .  50 GLY HA2  1 1 
        2  3260 1 1  50 GLY HA3  H  -8.268 -14.815 -17.803 1.00 . A A .  50 GLY HA3  1 1 
        2  3261 1 1  50 GLY N    N  -8.741 -12.834 -17.437 1.00 . A A .  50 GLY N    1 1 
        2  3262 1 1  50 GLY O    O  -5.918 -14.849 -16.882 1.00 . A A .  50 GLY O    1 1 
        2  3263 1 1  51 LYS C    C  -4.869 -12.857 -14.044 1.00 . A A .  51 LYS C    1 1 
        2  3264 1 1  51 LYS CA   C  -5.042 -12.584 -15.534 1.00 . A A .  51 LYS CA   1 1 
        2  3265 1 1  51 LYS CB   C  -4.681 -11.135 -15.854 1.00 . A A .  51 LYS CB   1 1 
        2  3266 1 1  51 LYS CD   C  -3.085 -11.466 -17.765 1.00 . A A .  51 LYS CD   1 1 
        2  3267 1 1  51 LYS CE   C  -2.706 -11.018 -19.168 1.00 . A A .  51 LYS CE   1 1 
        2  3268 1 1  51 LYS CG   C  -4.417 -10.875 -17.330 1.00 . A A .  51 LYS CG   1 1 
        2  3269 1 1  51 LYS H    H  -7.113 -12.212 -15.742 1.00 . A A .  51 LYS H    1 1 
        2  3270 1 1  51 LYS HA   H  -4.386 -13.240 -16.086 1.00 . A A .  51 LYS HA   1 1 
        2  3271 1 1  51 LYS HB2  H  -5.493 -10.498 -15.539 1.00 . A A .  51 LYS HB2  1 1 
        2  3272 1 1  51 LYS HB3  H  -3.792 -10.867 -15.299 1.00 . A A .  51 LYS HB3  1 1 
        2  3273 1 1  51 LYS HD2  H  -2.317 -11.146 -17.076 1.00 . A A .  51 LYS HD2  1 1 
        2  3274 1 1  51 LYS HD3  H  -3.159 -12.543 -17.748 1.00 . A A .  51 LYS HD3  1 1 
        2  3275 1 1  51 LYS HE2  H  -3.390 -11.468 -19.873 1.00 . A A .  51 LYS HE2  1 1 
        2  3276 1 1  51 LYS HE3  H  -2.788  -9.943 -19.223 1.00 . A A .  51 LYS HE3  1 1 
        2  3277 1 1  51 LYS HG2  H  -5.208 -11.325 -17.910 1.00 . A A .  51 LYS HG2  1 1 
        2  3278 1 1  51 LYS HG3  H  -4.404  -9.808 -17.500 1.00 . A A .  51 LYS HG3  1 1 
        2  3279 1 1  51 LYS HZ1  H  -1.248 -12.454 -19.611 1.00 . A A .  51 LYS HZ1  1 1 
        2  3280 1 1  51 LYS HZ2  H  -0.654 -11.098 -18.775 1.00 . A A .  51 LYS HZ2  1 1 
        2  3281 1 1  51 LYS HZ3  H  -1.036 -10.978 -20.425 1.00 . A A .  51 LYS HZ3  1 1 
        2  3282 1 1  51 LYS N    N  -6.407 -12.862 -15.955 1.00 . A A .  51 LYS N    1 1 
        2  3283 1 1  51 LYS NZ   N  -1.317 -11.415 -19.520 1.00 . A A .  51 LYS NZ   1 1 
        2  3284 1 1  51 LYS O    O  -5.792 -13.333 -13.380 1.00 . A A .  51 LYS O    1 1 
        2  3285 1 1  52 SER C    C  -2.399 -11.725 -11.618 1.00 . A A .  52 SER C    1 1 
        2  3286 1 1  52 SER CA   C  -3.394 -12.774 -12.116 1.00 . A A .  52 SER CA   1 1 
        2  3287 1 1  52 SER CB   C  -2.841 -14.187 -11.900 1.00 . A A .  52 SER CB   1 1 
        2  3288 1 1  52 SER H    H  -2.982 -12.209 -14.104 1.00 . A A .  52 SER H    1 1 
        2  3289 1 1  52 SER HA   H  -4.317 -12.669 -11.567 1.00 . A A .  52 SER HA   1 1 
        2  3290 1 1  52 SER HB2  H  -1.908 -14.292 -12.433 1.00 . A A .  52 SER HB2  1 1 
        2  3291 1 1  52 SER HB3  H  -2.672 -14.350 -10.845 1.00 . A A .  52 SER HB3  1 1 
        2  3292 1 1  52 SER HG   H  -4.610 -14.751 -12.539 1.00 . A A .  52 SER HG   1 1 
        2  3293 1 1  52 SER N    N  -3.683 -12.571 -13.525 1.00 . A A .  52 SER N    1 1 
        2  3294 1 1  52 SER O    O  -1.548 -11.261 -12.380 1.00 . A A .  52 SER O    1 1 
        2  3295 1 1  52 SER OG   O  -3.753 -15.166 -12.376 1.00 . A A .  52 SER OG   1 1 
        2  3296 1 1  53 PRO C    C  -0.204 -10.959  -9.517 1.00 . A A .  53 PRO C    1 1 
        2  3297 1 1  53 PRO CA   C  -1.590 -10.351  -9.729 1.00 . A A .  53 PRO CA   1 1 
        2  3298 1 1  53 PRO CB   C  -2.239 -10.019  -8.377 1.00 . A A .  53 PRO CB   1 1 
        2  3299 1 1  53 PRO CD   C  -3.566 -11.721  -9.404 1.00 . A A .  53 PRO CD   1 1 
        2  3300 1 1  53 PRO CG   C  -3.627 -10.563  -8.452 1.00 . A A .  53 PRO CG   1 1 
        2  3301 1 1  53 PRO HA   H  -1.499  -9.452 -10.322 1.00 . A A .  53 PRO HA   1 1 
        2  3302 1 1  53 PRO HB2  H  -1.676 -10.485  -7.582 1.00 . A A .  53 PRO HB2  1 1 
        2  3303 1 1  53 PRO HB3  H  -2.244  -8.948  -8.235 1.00 . A A .  53 PRO HB3  1 1 
        2  3304 1 1  53 PRO HD2  H  -3.288 -12.626  -8.884 1.00 . A A .  53 PRO HD2  1 1 
        2  3305 1 1  53 PRO HD3  H  -4.511 -11.846  -9.911 1.00 . A A .  53 PRO HD3  1 1 
        2  3306 1 1  53 PRO HG2  H  -3.943 -10.898  -7.475 1.00 . A A .  53 PRO HG2  1 1 
        2  3307 1 1  53 PRO HG3  H  -4.300  -9.805  -8.825 1.00 . A A .  53 PRO HG3  1 1 
        2  3308 1 1  53 PRO N    N  -2.517 -11.308 -10.344 1.00 . A A .  53 PRO N    1 1 
        2  3309 1 1  53 PRO O    O  -0.071 -12.169  -9.336 1.00 . A A .  53 PRO O    1 1 
        2  3310 1 1  54 SER C    C   2.732 -10.258  -7.993 1.00 . A A .  54 SER C    1 1 
        2  3311 1 1  54 SER CA   C   2.193 -10.588  -9.383 1.00 . A A .  54 SER CA   1 1 
        2  3312 1 1  54 SER CB   C   3.077  -9.964 -10.468 1.00 . A A .  54 SER CB   1 1 
        2  3313 1 1  54 SER H    H   0.651  -9.157  -9.641 1.00 . A A .  54 SER H    1 1 
        2  3314 1 1  54 SER HA   H   2.190 -11.661  -9.506 1.00 . A A .  54 SER HA   1 1 
        2  3315 1 1  54 SER HB2  H   2.649 -10.167 -11.438 1.00 . A A .  54 SER HB2  1 1 
        2  3316 1 1  54 SER HB3  H   3.125  -8.896 -10.315 1.00 . A A .  54 SER HB3  1 1 
        2  3317 1 1  54 SER HG   H   4.533 -10.976  -9.610 1.00 . A A .  54 SER HG   1 1 
        2  3318 1 1  54 SER N    N   0.820 -10.119  -9.530 1.00 . A A .  54 SER N    1 1 
        2  3319 1 1  54 SER O    O   3.876 -10.573  -7.661 1.00 . A A .  54 SER O    1 1 
        2  3320 1 1  54 SER OG   O   4.395 -10.487 -10.437 1.00 . A A .  54 SER OG   1 1 
        2  3321 1 1  55 GLY C    C   1.120  -9.017  -4.948 1.00 . A A .  55 GLY C    1 1 
        2  3322 1 1  55 GLY CA   C   2.309  -9.266  -5.842 1.00 . A A .  55 GLY CA   1 1 
        2  3323 1 1  55 GLY H    H   0.991  -9.425  -7.481 1.00 . A A .  55 GLY H    1 1 
        2  3324 1 1  55 GLY HA2  H   2.904 -10.066  -5.425 1.00 . A A .  55 GLY HA2  1 1 
        2  3325 1 1  55 GLY HA3  H   2.906  -8.369  -5.890 1.00 . A A .  55 GLY HA3  1 1 
        2  3326 1 1  55 GLY N    N   1.900  -9.631  -7.179 1.00 . A A .  55 GLY N    1 1 
        2  3327 1 1  55 GLY O    O  -0.021  -9.091  -5.409 1.00 . A A .  55 GLY O    1 1 
        2  3328 1 1  56 PRO C    C  -0.381  -7.096  -2.952 1.00 . A A .  56 PRO C    1 1 
        2  3329 1 1  56 PRO CA   C   0.266  -8.461  -2.720 1.00 . A A .  56 PRO CA   1 1 
        2  3330 1 1  56 PRO CB   C   0.969  -8.501  -1.363 1.00 . A A .  56 PRO CB   1 1 
        2  3331 1 1  56 PRO CD   C   2.678  -8.622  -3.034 1.00 . A A .  56 PRO CD   1 1 
        2  3332 1 1  56 PRO CG   C   2.380  -8.116  -1.650 1.00 . A A .  56 PRO CG   1 1 
        2  3333 1 1  56 PRO HA   H  -0.491  -9.231  -2.762 1.00 . A A .  56 PRO HA   1 1 
        2  3334 1 1  56 PRO HB2  H   0.497  -7.800  -0.691 1.00 . A A .  56 PRO HB2  1 1 
        2  3335 1 1  56 PRO HB3  H   0.909  -9.498  -0.952 1.00 . A A .  56 PRO HB3  1 1 
        2  3336 1 1  56 PRO HD2  H   3.303  -7.920  -3.567 1.00 . A A .  56 PRO HD2  1 1 
        2  3337 1 1  56 PRO HD3  H   3.154  -9.591  -2.985 1.00 . A A .  56 PRO HD3  1 1 
        2  3338 1 1  56 PRO HG2  H   2.482  -7.040  -1.615 1.00 . A A .  56 PRO HG2  1 1 
        2  3339 1 1  56 PRO HG3  H   3.041  -8.579  -0.932 1.00 . A A .  56 PRO HG3  1 1 
        2  3340 1 1  56 PRO N    N   1.349  -8.724  -3.664 1.00 . A A .  56 PRO N    1 1 
        2  3341 1 1  56 PRO O    O   0.260  -6.175  -3.466 1.00 . A A .  56 PRO O    1 1 
        2  3342 1 1  57 PRO C    C  -1.883  -4.656  -1.684 1.00 . A A .  57 PRO C    1 1 
        2  3343 1 1  57 PRO CA   C  -2.383  -5.686  -2.692 1.00 . A A .  57 PRO CA   1 1 
        2  3344 1 1  57 PRO CB   C  -3.840  -6.064  -2.388 1.00 . A A .  57 PRO CB   1 1 
        2  3345 1 1  57 PRO CD   C  -2.516  -8.020  -2.052 1.00 . A A .  57 PRO CD   1 1 
        2  3346 1 1  57 PRO CG   C  -3.888  -7.554  -2.432 1.00 . A A .  57 PRO CG   1 1 
        2  3347 1 1  57 PRO HA   H  -2.313  -5.276  -3.689 1.00 . A A .  57 PRO HA   1 1 
        2  3348 1 1  57 PRO HB2  H  -4.112  -5.691  -1.411 1.00 . A A .  57 PRO HB2  1 1 
        2  3349 1 1  57 PRO HB3  H  -4.488  -5.629  -3.134 1.00 . A A .  57 PRO HB3  1 1 
        2  3350 1 1  57 PRO HD2  H  -2.423  -8.094  -0.978 1.00 . A A .  57 PRO HD2  1 1 
        2  3351 1 1  57 PRO HD3  H  -2.290  -8.966  -2.521 1.00 . A A .  57 PRO HD3  1 1 
        2  3352 1 1  57 PRO HG2  H  -4.618  -7.920  -1.725 1.00 . A A .  57 PRO HG2  1 1 
        2  3353 1 1  57 PRO HG3  H  -4.133  -7.885  -3.430 1.00 . A A .  57 PRO HG3  1 1 
        2  3354 1 1  57 PRO N    N  -1.660  -6.953  -2.583 1.00 . A A .  57 PRO N    1 1 
        2  3355 1 1  57 PRO O    O  -1.371  -5.007  -0.613 1.00 . A A .  57 PRO O    1 1 
        2  3356 1 1  58 PHE C    C  -2.779  -1.512  -0.655 1.00 . A A .  58 PHE C    1 1 
        2  3357 1 1  58 PHE CA   C  -1.589  -2.321  -1.142 1.00 . A A .  58 PHE CA   1 1 
        2  3358 1 1  58 PHE CB   C  -0.620  -1.393  -1.883 1.00 . A A .  58 PHE CB   1 1 
        2  3359 1 1  58 PHE CD1  C   1.712  -2.312  -1.785 1.00 . A A .  58 PHE CD1  1 1 
        2  3360 1 1  58 PHE CD2  C   0.500  -2.520  -3.826 1.00 . A A .  58 PHE CD2  1 1 
        2  3361 1 1  58 PHE CE1  C   2.796  -2.948  -2.360 1.00 . A A .  58 PHE CE1  1 1 
        2  3362 1 1  58 PHE CE2  C   1.580  -3.155  -4.408 1.00 . A A .  58 PHE CE2  1 1 
        2  3363 1 1  58 PHE CG   C   0.553  -2.092  -2.510 1.00 . A A .  58 PHE CG   1 1 
        2  3364 1 1  58 PHE CZ   C   2.730  -3.370  -3.674 1.00 . A A .  58 PHE CZ   1 1 
        2  3365 1 1  58 PHE H    H  -2.470  -3.155  -2.872 1.00 . A A .  58 PHE H    1 1 
        2  3366 1 1  58 PHE HA   H  -1.084  -2.762  -0.293 1.00 . A A .  58 PHE HA   1 1 
        2  3367 1 1  58 PHE HB2  H  -1.156  -0.884  -2.669 1.00 . A A .  58 PHE HB2  1 1 
        2  3368 1 1  58 PHE HB3  H  -0.237  -0.660  -1.187 1.00 . A A .  58 PHE HB3  1 1 
        2  3369 1 1  58 PHE HD1  H   1.764  -1.983  -0.757 1.00 . A A .  58 PHE HD1  1 1 
        2  3370 1 1  58 PHE HD2  H  -0.398  -2.353  -4.400 1.00 . A A .  58 PHE HD2  1 1 
        2  3371 1 1  58 PHE HE1  H   3.694  -3.114  -1.783 1.00 . A A .  58 PHE HE1  1 1 
        2  3372 1 1  58 PHE HE2  H   1.525  -3.485  -5.435 1.00 . A A .  58 PHE HE2  1 1 
        2  3373 1 1  58 PHE HZ   H   3.576  -3.866  -4.127 1.00 . A A .  58 PHE HZ   1 1 
        2  3374 1 1  58 PHE N    N  -2.039  -3.387  -2.015 1.00 . A A .  58 PHE N    1 1 
        2  3375 1 1  58 PHE O    O  -3.927  -1.822  -0.978 1.00 . A A .  58 PHE O    1 1 
        2  3376 1 1  59 ALA C    C  -2.777   1.826   0.713 1.00 . A A .  59 ALA C    1 1 
        2  3377 1 1  59 ALA CA   C  -3.481   0.497   0.496 1.00 . A A .  59 ALA CA   1 1 
        2  3378 1 1  59 ALA CB   C  -4.249   0.085   1.745 1.00 . A A .  59 ALA CB   1 1 
        2  3379 1 1  59 ALA H    H  -1.596  -0.438   0.530 1.00 . A A .  59 ALA H    1 1 
        2  3380 1 1  59 ALA HA   H  -4.180   0.590  -0.324 1.00 . A A .  59 ALA HA   1 1 
        2  3381 1 1  59 ALA HB1  H  -3.560  -0.026   2.570 1.00 . A A .  59 ALA HB1  1 1 
        2  3382 1 1  59 ALA HB2  H  -4.750  -0.855   1.563 1.00 . A A .  59 ALA HB2  1 1 
        2  3383 1 1  59 ALA HB3  H  -4.979   0.843   1.984 1.00 . A A .  59 ALA HB3  1 1 
        2  3384 1 1  59 ALA N    N  -2.497  -0.503   0.146 1.00 . A A .  59 ALA N    1 1 
        2  3385 1 1  59 ALA O    O  -2.077   2.005   1.705 1.00 . A A .  59 ALA O    1 1 
        2  3386 1 1  60 ARG C    C  -3.356   5.087   0.278 1.00 . A A .  60 ARG C    1 1 
        2  3387 1 1  60 ARG CA   C  -2.326   4.054  -0.134 1.00 . A A .  60 ARG CA   1 1 
        2  3388 1 1  60 ARG CB   C  -1.674   4.418  -1.481 1.00 . A A .  60 ARG CB   1 1 
        2  3389 1 1  60 ARG CD   C  -1.978   6.883  -1.927 1.00 . A A .  60 ARG CD   1 1 
        2  3390 1 1  60 ARG CG   C  -1.001   5.789  -1.522 1.00 . A A .  60 ARG CG   1 1 
        2  3391 1 1  60 ARG CZ   C  -2.051   9.341  -2.075 1.00 . A A .  60 ARG CZ   1 1 
        2  3392 1 1  60 ARG H    H  -3.533   2.542  -0.993 1.00 . A A .  60 ARG H    1 1 
        2  3393 1 1  60 ARG HA   H  -1.559   4.003   0.627 1.00 . A A .  60 ARG HA   1 1 
        2  3394 1 1  60 ARG HB2  H  -0.928   3.676  -1.714 1.00 . A A .  60 ARG HB2  1 1 
        2  3395 1 1  60 ARG HB3  H  -2.436   4.397  -2.247 1.00 . A A .  60 ARG HB3  1 1 
        2  3396 1 1  60 ARG HD2  H  -2.351   6.664  -2.916 1.00 . A A .  60 ARG HD2  1 1 
        2  3397 1 1  60 ARG HD3  H  -2.799   6.887  -1.228 1.00 . A A .  60 ARG HD3  1 1 
        2  3398 1 1  60 ARG HE   H  -0.383   8.256  -1.843 1.00 . A A .  60 ARG HE   1 1 
        2  3399 1 1  60 ARG HG2  H  -0.609   6.018  -0.544 1.00 . A A .  60 ARG HG2  1 1 
        2  3400 1 1  60 ARG HG3  H  -0.191   5.760  -2.238 1.00 . A A .  60 ARG HG3  1 1 
        2  3401 1 1  60 ARG HH11 H  -3.845   8.420  -2.234 1.00 . A A .  60 ARG HH11 1 1 
        2  3402 1 1  60 ARG HH12 H  -3.900  10.157  -2.308 1.00 . A A .  60 ARG HH12 1 1 
        2  3403 1 1  60 ARG HH21 H  -0.423  10.552  -1.944 1.00 . A A .  60 ARG HH21 1 1 
        2  3404 1 1  60 ARG HH22 H  -1.946  11.365  -2.177 1.00 . A A .  60 ARG HH22 1 1 
        2  3405 1 1  60 ARG N    N  -2.955   2.746  -0.220 1.00 . A A .  60 ARG N    1 1 
        2  3406 1 1  60 ARG NE   N  -1.362   8.209  -1.940 1.00 . A A .  60 ARG NE   1 1 
        2  3407 1 1  60 ARG NH1  N  -3.369   9.299  -2.219 1.00 . A A .  60 ARG NH1  1 1 
        2  3408 1 1  60 ARG NH2  N  -1.427  10.510  -2.062 1.00 . A A .  60 ARG NH2  1 1 
        2  3409 1 1  60 ARG O    O  -4.377   5.256  -0.384 1.00 . A A .  60 ARG O    1 1 
        2  3410 1 1  61 TYR C    C  -3.360   8.077   2.194 1.00 . A A .  61 TYR C    1 1 
        2  3411 1 1  61 TYR CA   C  -4.031   6.742   1.888 1.00 . A A .  61 TYR CA   1 1 
        2  3412 1 1  61 TYR CB   C  -4.767   6.186   3.117 1.00 . A A .  61 TYR CB   1 1 
        2  3413 1 1  61 TYR CD1  C  -3.416   4.218   3.951 1.00 . A A .  61 TYR CD1  1 1 
        2  3414 1 1  61 TYR CD2  C  -3.523   6.168   5.316 1.00 . A A .  61 TYR CD2  1 1 
        2  3415 1 1  61 TYR CE1  C  -2.616   3.598   4.890 1.00 . A A .  61 TYR CE1  1 1 
        2  3416 1 1  61 TYR CE2  C  -2.727   5.553   6.261 1.00 . A A .  61 TYR CE2  1 1 
        2  3417 1 1  61 TYR CG   C  -3.880   5.515   4.146 1.00 . A A .  61 TYR CG   1 1 
        2  3418 1 1  61 TYR CZ   C  -2.277   4.268   6.043 1.00 . A A .  61 TYR CZ   1 1 
        2  3419 1 1  61 TYR H    H  -2.237   5.632   1.844 1.00 . A A .  61 TYR H    1 1 
        2  3420 1 1  61 TYR HA   H  -4.761   6.912   1.112 1.00 . A A .  61 TYR HA   1 1 
        2  3421 1 1  61 TYR HB2  H  -5.279   6.996   3.611 1.00 . A A .  61 TYR HB2  1 1 
        2  3422 1 1  61 TYR HB3  H  -5.496   5.461   2.785 1.00 . A A .  61 TYR HB3  1 1 
        2  3423 1 1  61 TYR HD1  H  -3.682   3.695   3.045 1.00 . A A .  61 TYR HD1  1 1 
        2  3424 1 1  61 TYR HD2  H  -3.875   7.174   5.484 1.00 . A A .  61 TYR HD2  1 1 
        2  3425 1 1  61 TYR HE1  H  -2.263   2.592   4.719 1.00 . A A .  61 TYR HE1  1 1 
        2  3426 1 1  61 TYR HE2  H  -2.460   6.077   7.166 1.00 . A A .  61 TYR HE2  1 1 
        2  3427 1 1  61 TYR HH   H  -2.012   3.456   7.763 1.00 . A A .  61 TYR HH   1 1 
        2  3428 1 1  61 TYR N    N  -3.092   5.775   1.370 1.00 . A A .  61 TYR N    1 1 
        2  3429 1 1  61 TYR O    O  -2.215   8.140   2.672 1.00 . A A .  61 TYR O    1 1 
        2  3430 1 1  61 TYR OH   O  -1.482   3.655   6.981 1.00 . A A .  61 TYR OH   1 1 
        2  3431 1 1  62 PHE C    C  -4.572  11.251   2.985 1.00 . A A .  62 PHE C    1 1 
        2  3432 1 1  62 PHE CA   C  -3.618  10.496   2.066 1.00 . A A .  62 PHE CA   1 1 
        2  3433 1 1  62 PHE CB   C  -3.502  11.209   0.714 1.00 . A A .  62 PHE CB   1 1 
        2  3434 1 1  62 PHE CD1  C  -1.814  13.043   1.041 1.00 . A A .  62 PHE CD1  1 1 
        2  3435 1 1  62 PHE CD2  C  -4.087  13.653   0.660 1.00 . A A .  62 PHE CD2  1 1 
        2  3436 1 1  62 PHE CE1  C  -1.468  14.377   1.126 1.00 . A A .  62 PHE CE1  1 1 
        2  3437 1 1  62 PHE CE2  C  -3.745  14.989   0.744 1.00 . A A .  62 PHE CE2  1 1 
        2  3438 1 1  62 PHE CG   C  -3.126  12.663   0.808 1.00 . A A .  62 PHE CG   1 1 
        2  3439 1 1  62 PHE CZ   C  -2.434  15.351   0.978 1.00 . A A .  62 PHE CZ   1 1 
        2  3440 1 1  62 PHE H    H  -4.971   8.997   1.471 1.00 . A A .  62 PHE H    1 1 
        2  3441 1 1  62 PHE HA   H  -2.643  10.455   2.530 1.00 . A A .  62 PHE HA   1 1 
        2  3442 1 1  62 PHE HB2  H  -2.746  10.714   0.123 1.00 . A A .  62 PHE HB2  1 1 
        2  3443 1 1  62 PHE HB3  H  -4.451  11.142   0.200 1.00 . A A .  62 PHE HB3  1 1 
        2  3444 1 1  62 PHE HD1  H  -1.055  12.283   1.158 1.00 . A A .  62 PHE HD1  1 1 
        2  3445 1 1  62 PHE HD2  H  -5.113  13.372   0.479 1.00 . A A .  62 PHE HD2  1 1 
        2  3446 1 1  62 PHE HE1  H  -0.442  14.658   1.310 1.00 . A A .  62 PHE HE1  1 1 
        2  3447 1 1  62 PHE HE2  H  -4.503  15.750   0.628 1.00 . A A .  62 PHE HE2  1 1 
        2  3448 1 1  62 PHE HZ   H  -2.164  16.395   1.043 1.00 . A A .  62 PHE HZ   1 1 
        2  3449 1 1  62 PHE N    N  -4.080   9.137   1.865 1.00 . A A .  62 PHE N    1 1 
        2  3450 1 1  62 PHE O    O  -5.802  11.105   2.882 1.00 . A A .  62 PHE O    1 1 
        2  3451 1 1  63 GLY C    C  -5.209  12.169   6.024 1.00 . A A .  63 GLY C    1 1 
        2  3452 1 1  63 GLY CA   C  -4.782  12.885   4.761 1.00 . A A .  63 GLY CA   1 1 
        2  3453 1 1  63 GLY H    H  -3.016  12.072   3.934 1.00 . A A .  63 GLY H    1 1 
        2  3454 1 1  63 GLY HA2  H  -4.192  13.749   5.033 1.00 . A A .  63 GLY HA2  1 1 
        2  3455 1 1  63 GLY HA3  H  -5.663  13.218   4.233 1.00 . A A .  63 GLY HA3  1 1 
        2  3456 1 1  63 GLY N    N  -3.995  12.049   3.878 1.00 . A A .  63 GLY N    1 1 
        2  3457 1 1  63 GLY O    O  -6.315  11.639   6.097 1.00 . A A .  63 GLY O    1 1 
        2  3458 1 1  64 MET C    C  -4.743  12.546   9.416 1.00 . A A .  64 MET C    1 1 
        2  3459 1 1  64 MET CA   C  -4.655  11.513   8.295 1.00 . A A .  64 MET CA   1 1 
        2  3460 1 1  64 MET CB   C  -3.637  10.416   8.643 1.00 . A A .  64 MET CB   1 1 
        2  3461 1 1  64 MET CE   C  -1.482   8.178   8.392 1.00 . A A .  64 MET CE   1 1 
        2  3462 1 1  64 MET CG   C  -2.185  10.860   8.561 1.00 . A A .  64 MET CG   1 1 
        2  3463 1 1  64 MET H    H  -3.473  12.601   6.911 1.00 . A A .  64 MET H    1 1 
        2  3464 1 1  64 MET HA   H  -5.628  11.055   8.185 1.00 . A A .  64 MET HA   1 1 
        2  3465 1 1  64 MET HB2  H  -3.828  10.073   9.648 1.00 . A A .  64 MET HB2  1 1 
        2  3466 1 1  64 MET HB3  H  -3.775   9.588   7.961 1.00 . A A .  64 MET HB3  1 1 
        2  3467 1 1  64 MET HE1  H  -1.312   8.328   7.337 1.00 . A A .  64 MET HE1  1 1 
        2  3468 1 1  64 MET HE2  H  -2.525   7.950   8.559 1.00 . A A .  64 MET HE2  1 1 
        2  3469 1 1  64 MET HE3  H  -0.872   7.357   8.741 1.00 . A A .  64 MET HE3  1 1 
        2  3470 1 1  64 MET HG2  H  -1.925  10.996   7.522 1.00 . A A .  64 MET HG2  1 1 
        2  3471 1 1  64 MET HG3  H  -2.082  11.801   9.082 1.00 . A A .  64 MET HG3  1 1 
        2  3472 1 1  64 MET N    N  -4.339  12.154   7.025 1.00 . A A .  64 MET N    1 1 
        2  3473 1 1  64 MET O    O  -3.739  12.902  10.039 1.00 . A A .  64 MET O    1 1 
        2  3474 1 1  64 MET SD   S  -1.045   9.664   9.292 1.00 . A A .  64 MET SD   1 1 
        2  3475 1 1  65 SER C    C  -7.722  14.283  10.769 1.00 . A A .  65 SER C    1 1 
        2  3476 1 1  65 SER CA   C  -6.222  14.011  10.689 1.00 . A A .  65 SER CA   1 1 
        2  3477 1 1  65 SER CB   C  -5.460  15.314  10.417 1.00 . A A .  65 SER CB   1 1 
        2  3478 1 1  65 SER H    H  -6.708  12.723   9.091 1.00 . A A .  65 SER H    1 1 
        2  3479 1 1  65 SER HA   H  -5.890  13.596  11.629 1.00 . A A .  65 SER HA   1 1 
        2  3480 1 1  65 SER HB2  H  -4.405  15.098  10.338 1.00 . A A .  65 SER HB2  1 1 
        2  3481 1 1  65 SER HB3  H  -5.809  15.743   9.489 1.00 . A A .  65 SER HB3  1 1 
        2  3482 1 1  65 SER HG   H  -6.052  17.067  11.086 1.00 . A A .  65 SER HG   1 1 
        2  3483 1 1  65 SER N    N  -5.955  13.035   9.647 1.00 . A A .  65 SER N    1 1 
        2  3484 1 1  65 SER O    O  -8.360  13.983  11.781 1.00 . A A .  65 SER O    1 1 
        2  3485 1 1  65 SER OG   O  -5.655  16.259  11.458 1.00 . A A .  65 SER OG   1 1 
        2  3486 1 1  66 ALA C    C -10.094  15.589   8.214 1.00 . A A .  66 ALA C    1 1 
        2  3487 1 1  66 ALA CA   C  -9.699  15.164   9.626 1.00 . A A .  66 ALA CA   1 1 
        2  3488 1 1  66 ALA CB   C -10.029  16.276  10.613 1.00 . A A .  66 ALA CB   1 1 
        2  3489 1 1  66 ALA H    H  -7.719  15.014   8.903 1.00 . A A .  66 ALA H    1 1 
        2  3490 1 1  66 ALA HA   H -10.264  14.286   9.903 1.00 . A A .  66 ALA HA   1 1 
        2  3491 1 1  66 ALA HB1  H -11.087  16.485  10.581 1.00 . A A .  66 ALA HB1  1 1 
        2  3492 1 1  66 ALA HB2  H  -9.479  17.166  10.347 1.00 . A A .  66 ALA HB2  1 1 
        2  3493 1 1  66 ALA HB3  H  -9.752  15.966  11.609 1.00 . A A .  66 ALA HB3  1 1 
        2  3494 1 1  66 ALA N    N  -8.279  14.832   9.688 1.00 . A A .  66 ALA N    1 1 
        2  3495 1 1  66 ALA O    O  -9.233  15.866   7.374 1.00 . A A .  66 ALA O    1 1 
        2  3496 1 1  67 GLY C    C -12.392  14.989   5.800 1.00 . A A .  67 GLY C    1 1 
        2  3497 1 1  67 GLY CA   C -11.888  16.109   6.678 1.00 . A A .  67 GLY CA   1 1 
        2  3498 1 1  67 GLY H    H -12.032  15.313   8.632 1.00 . A A .  67 GLY H    1 1 
        2  3499 1 1  67 GLY HA2  H -12.696  16.806   6.855 1.00 . A A .  67 GLY HA2  1 1 
        2  3500 1 1  67 GLY HA3  H -11.088  16.623   6.165 1.00 . A A .  67 GLY HA3  1 1 
        2  3501 1 1  67 GLY N    N -11.394  15.631   7.953 1.00 . A A .  67 GLY N    1 1 
        2  3502 1 1  67 GLY O    O -13.568  14.625   5.847 1.00 . A A .  67 GLY O    1 1 
        2  3503 1 1  68 THR C    C -10.616  12.468   3.861 1.00 . A A .  68 THR C    1 1 
        2  3504 1 1  68 THR CA   C -11.841  13.350   4.096 1.00 . A A .  68 THR CA   1 1 
        2  3505 1 1  68 THR CB   C -12.372  13.885   2.745 1.00 . A A .  68 THR CB   1 1 
        2  3506 1 1  68 THR CG2  C -12.841  12.748   1.847 1.00 . A A .  68 THR CG2  1 1 
        2  3507 1 1  68 THR H    H -10.578  14.776   5.015 1.00 . A A .  68 THR H    1 1 
        2  3508 1 1  68 THR HA   H -12.618  12.760   4.563 1.00 . A A .  68 THR HA   1 1 
        2  3509 1 1  68 THR HB   H -11.576  14.418   2.244 1.00 . A A .  68 THR HB   1 1 
        2  3510 1 1  68 THR HG1  H -13.672  14.796   3.922 1.00 . A A .  68 THR HG1  1 1 
        2  3511 1 1  68 THR HG21 H -13.638  12.207   2.334 1.00 . A A .  68 THR HG21 1 1 
        2  3512 1 1  68 THR HG22 H -12.016  12.077   1.653 1.00 . A A .  68 THR HG22 1 1 
        2  3513 1 1  68 THR HG23 H -13.199  13.154   0.911 1.00 . A A .  68 THR HG23 1 1 
        2  3514 1 1  68 THR N    N -11.501  14.440   4.997 1.00 . A A .  68 THR N    1 1 
        2  3515 1 1  68 THR O    O  -9.501  12.967   3.724 1.00 . A A .  68 THR O    1 1 
        2  3516 1 1  68 THR OG1  O -13.463  14.784   2.976 1.00 . A A .  68 THR OG1  1 1 
        2  3517 1 1  69 PHE C    C  -9.559   9.845   2.216 1.00 . A A .  69 PHE C    1 1 
        2  3518 1 1  69 PHE CA   C  -9.722  10.226   3.681 1.00 . A A .  69 PHE CA   1 1 
        2  3519 1 1  69 PHE CB   C  -9.993   8.987   4.530 1.00 . A A .  69 PHE CB   1 1 
        2  3520 1 1  69 PHE CD1  C  -8.144   9.113   6.214 1.00 . A A .  69 PHE CD1  1 1 
        2  3521 1 1  69 PHE CD2  C  -8.287   7.175   4.836 1.00 . A A .  69 PHE CD2  1 1 
        2  3522 1 1  69 PHE CE1  C  -7.036   8.586   6.847 1.00 . A A .  69 PHE CE1  1 1 
        2  3523 1 1  69 PHE CE2  C  -7.181   6.642   5.466 1.00 . A A .  69 PHE CE2  1 1 
        2  3524 1 1  69 PHE CG   C  -8.781   8.414   5.202 1.00 . A A .  69 PHE CG   1 1 
        2  3525 1 1  69 PHE CZ   C  -6.553   7.349   6.472 1.00 . A A .  69 PHE CZ   1 1 
        2  3526 1 1  69 PHE H    H -11.741  10.814   3.895 1.00 . A A .  69 PHE H    1 1 
        2  3527 1 1  69 PHE HA   H  -8.821  10.706   4.026 1.00 . A A .  69 PHE HA   1 1 
        2  3528 1 1  69 PHE HB2  H -10.697   9.244   5.297 1.00 . A A .  69 PHE HB2  1 1 
        2  3529 1 1  69 PHE HB3  H -10.418   8.218   3.902 1.00 . A A .  69 PHE HB3  1 1 
        2  3530 1 1  69 PHE HD1  H  -8.521  10.080   6.507 1.00 . A A .  69 PHE HD1  1 1 
        2  3531 1 1  69 PHE HD2  H  -8.776   6.621   4.047 1.00 . A A .  69 PHE HD2  1 1 
        2  3532 1 1  69 PHE HE1  H  -6.547   9.141   7.634 1.00 . A A .  69 PHE HE1  1 1 
        2  3533 1 1  69 PHE HE2  H  -6.804   5.673   5.171 1.00 . A A .  69 PHE HE2  1 1 
        2  3534 1 1  69 PHE HZ   H  -5.687   6.935   6.968 1.00 . A A .  69 PHE HZ   1 1 
        2  3535 1 1  69 PHE N    N -10.823  11.161   3.829 1.00 . A A .  69 PHE N    1 1 
        2  3536 1 1  69 PHE O    O -10.510   9.393   1.573 1.00 . A A .  69 PHE O    1 1 
        2  3537 1 1  70 GLU C    C  -7.483   8.348   0.176 1.00 . A A .  70 GLU C    1 1 
        2  3538 1 1  70 GLU CA   C  -8.100   9.734   0.284 1.00 . A A .  70 GLU CA   1 1 
        2  3539 1 1  70 GLU CB   C  -7.172  10.781  -0.339 1.00 . A A .  70 GLU CB   1 1 
        2  3540 1 1  70 GLU CD   C  -6.074  11.666  -2.433 1.00 . A A .  70 GLU CD   1 1 
        2  3541 1 1  70 GLU CG   C  -6.963  10.597  -1.833 1.00 . A A .  70 GLU CG   1 1 
        2  3542 1 1  70 GLU H    H  -7.636  10.399   2.253 1.00 . A A .  70 GLU H    1 1 
        2  3543 1 1  70 GLU HA   H  -9.044   9.739  -0.243 1.00 . A A .  70 GLU HA   1 1 
        2  3544 1 1  70 GLU HB2  H  -7.593  11.763  -0.176 1.00 . A A .  70 GLU HB2  1 1 
        2  3545 1 1  70 GLU HB3  H  -6.209  10.728   0.147 1.00 . A A .  70 GLU HB3  1 1 
        2  3546 1 1  70 GLU HG2  H  -6.507   9.633  -2.005 1.00 . A A .  70 GLU HG2  1 1 
        2  3547 1 1  70 GLU HG3  H  -7.925  10.633  -2.325 1.00 . A A .  70 GLU HG3  1 1 
        2  3548 1 1  70 GLU N    N  -8.364  10.047   1.685 1.00 . A A .  70 GLU N    1 1 
        2  3549 1 1  70 GLU O    O  -6.389   8.116   0.685 1.00 . A A .  70 GLU O    1 1 
        2  3550 1 1  70 GLU OE1  O  -6.572  12.777  -2.703 1.00 . A A .  70 GLU OE1  1 1 
        2  3551 1 1  70 GLU OE2  O  -4.872  11.399  -2.642 1.00 . A A .  70 GLU OE2  1 1 
        2  3552 1 1  71 VAL C    C  -7.535   5.520  -1.928 1.00 . A A .  71 VAL C    1 1 
        2  3553 1 1  71 VAL CA   C  -7.746   6.037  -0.503 1.00 . A A .  71 VAL CA   1 1 
        2  3554 1 1  71 VAL CB   C  -8.739   5.114   0.252 1.00 . A A .  71 VAL CB   1 1 
        2  3555 1 1  71 VAL CG1  C  -8.841   5.527   1.710 1.00 . A A .  71 VAL CG1  1 1 
        2  3556 1 1  71 VAL CG2  C -10.122   5.121  -0.389 1.00 . A A .  71 VAL CG2  1 1 
        2  3557 1 1  71 VAL H    H  -9.001   7.684  -0.958 1.00 . A A .  71 VAL H    1 1 
        2  3558 1 1  71 VAL HA   H  -6.798   5.990   0.016 1.00 . A A .  71 VAL HA   1 1 
        2  3559 1 1  71 VAL HB   H  -8.356   4.104   0.214 1.00 . A A .  71 VAL HB   1 1 
        2  3560 1 1  71 VAL HG11 H  -9.520   4.864   2.226 1.00 . A A .  71 VAL HG11 1 1 
        2  3561 1 1  71 VAL HG12 H  -9.214   6.540   1.771 1.00 . A A .  71 VAL HG12 1 1 
        2  3562 1 1  71 VAL HG13 H  -7.866   5.475   2.169 1.00 . A A .  71 VAL HG13 1 1 
        2  3563 1 1  71 VAL HG21 H -10.511   6.129  -0.397 1.00 . A A .  71 VAL HG21 1 1 
        2  3564 1 1  71 VAL HG22 H -10.785   4.486   0.180 1.00 . A A .  71 VAL HG22 1 1 
        2  3565 1 1  71 VAL HG23 H -10.054   4.753  -1.403 1.00 . A A .  71 VAL HG23 1 1 
        2  3566 1 1  71 VAL N    N  -8.182   7.426  -0.475 1.00 . A A .  71 VAL N    1 1 
        2  3567 1 1  71 VAL O    O  -8.424   5.584  -2.776 1.00 . A A .  71 VAL O    1 1 
        2  3568 1 1  72 GLU C    C  -5.527   2.964  -3.127 1.00 . A A .  72 GLU C    1 1 
        2  3569 1 1  72 GLU CA   C  -6.029   4.361  -3.440 1.00 . A A .  72 GLU CA   1 1 
        2  3570 1 1  72 GLU CB   C  -4.976   5.136  -4.238 1.00 . A A .  72 GLU CB   1 1 
        2  3571 1 1  72 GLU CD   C  -4.469   7.215  -5.574 1.00 . A A .  72 GLU CD   1 1 
        2  3572 1 1  72 GLU CG   C  -5.377   6.566  -4.551 1.00 . A A .  72 GLU CG   1 1 
        2  3573 1 1  72 GLU H    H  -5.630   5.110  -1.506 1.00 . A A .  72 GLU H    1 1 
        2  3574 1 1  72 GLU HA   H  -6.940   4.290  -4.016 1.00 . A A .  72 GLU HA   1 1 
        2  3575 1 1  72 GLU HB2  H  -4.056   5.158  -3.672 1.00 . A A .  72 GLU HB2  1 1 
        2  3576 1 1  72 GLU HB3  H  -4.800   4.624  -5.172 1.00 . A A .  72 GLU HB3  1 1 
        2  3577 1 1  72 GLU HG2  H  -6.385   6.566  -4.938 1.00 . A A .  72 GLU HG2  1 1 
        2  3578 1 1  72 GLU HG3  H  -5.341   7.144  -3.639 1.00 . A A .  72 GLU HG3  1 1 
        2  3579 1 1  72 GLU N    N  -6.337   5.029  -2.188 1.00 . A A .  72 GLU N    1 1 
        2  3580 1 1  72 GLU O    O  -4.463   2.809  -2.530 1.00 . A A .  72 GLU O    1 1 
        2  3581 1 1  72 GLU OE1  O  -4.747   7.091  -6.784 1.00 . A A .  72 GLU OE1  1 1 
        2  3582 1 1  72 GLU OE2  O  -3.483   7.864  -5.174 1.00 . A A .  72 GLU OE2  1 1 
        2  3583 1 1  73 PHE C    C  -4.684   0.137  -3.810 1.00 . A A .  73 PHE C    1 1 
        2  3584 1 1  73 PHE CA   C  -5.969   0.587  -3.118 1.00 . A A .  73 PHE CA   1 1 
        2  3585 1 1  73 PHE CB   C  -7.130  -0.343  -3.480 1.00 . A A .  73 PHE CB   1 1 
        2  3586 1 1  73 PHE CD1  C  -7.335  -1.925  -1.546 1.00 . A A .  73 PHE CD1  1 1 
        2  3587 1 1  73 PHE CD2  C  -6.623  -2.798  -3.649 1.00 . A A .  73 PHE CD2  1 1 
        2  3588 1 1  73 PHE CE1  C  -7.250  -3.187  -0.989 1.00 . A A .  73 PHE CE1  1 1 
        2  3589 1 1  73 PHE CE2  C  -6.535  -4.060  -3.098 1.00 . A A .  73 PHE CE2  1 1 
        2  3590 1 1  73 PHE CG   C  -7.023  -1.717  -2.880 1.00 . A A .  73 PHE CG   1 1 
        2  3591 1 1  73 PHE CZ   C  -6.850  -4.257  -1.765 1.00 . A A .  73 PHE CZ   1 1 
        2  3592 1 1  73 PHE H    H  -7.107   2.130  -4.018 1.00 . A A .  73 PHE H    1 1 
        2  3593 1 1  73 PHE HA   H  -5.817   0.563  -2.049 1.00 . A A .  73 PHE HA   1 1 
        2  3594 1 1  73 PHE HB2  H  -8.053   0.098  -3.132 1.00 . A A .  73 PHE HB2  1 1 
        2  3595 1 1  73 PHE HB3  H  -7.172  -0.451  -4.553 1.00 . A A .  73 PHE HB3  1 1 
        2  3596 1 1  73 PHE HD1  H  -7.650  -1.090  -0.938 1.00 . A A .  73 PHE HD1  1 1 
        2  3597 1 1  73 PHE HD2  H  -6.375  -2.646  -4.689 1.00 . A A .  73 PHE HD2  1 1 
        2  3598 1 1  73 PHE HE1  H  -7.496  -3.336   0.051 1.00 . A A .  73 PHE HE1  1 1 
        2  3599 1 1  73 PHE HE2  H  -6.221  -4.896  -3.707 1.00 . A A .  73 PHE HE2  1 1 
        2  3600 1 1  73 PHE HZ   H  -6.783  -5.244  -1.332 1.00 . A A .  73 PHE HZ   1 1 
        2  3601 1 1  73 PHE N    N  -6.301   1.954  -3.493 1.00 . A A .  73 PHE N    1 1 
        2  3602 1 1  73 PHE O    O  -3.678  -0.107  -3.155 1.00 . A A .  73 PHE O    1 1 
        2  3603 1 1  74 GLY C    C  -3.089  -1.699  -5.724 1.00 . A A .  74 GLY C    1 1 
        2  3604 1 1  74 GLY CA   C  -3.515  -0.247  -5.895 1.00 . A A .  74 GLY CA   1 1 
        2  3605 1 1  74 GLY H    H  -5.532   0.326  -5.608 1.00 . A A .  74 GLY H    1 1 
        2  3606 1 1  74 GLY HA2  H  -3.708  -0.069  -6.941 1.00 . A A .  74 GLY HA2  1 1 
        2  3607 1 1  74 GLY HA3  H  -2.702   0.391  -5.579 1.00 . A A .  74 GLY HA3  1 1 
        2  3608 1 1  74 GLY N    N  -4.703   0.108  -5.138 1.00 . A A .  74 GLY N    1 1 
        2  3609 1 1  74 GLY O    O  -2.777  -2.151  -4.618 1.00 . A A .  74 GLY O    1 1 
        2  3610 1 1  75 PHE C    C  -1.685  -4.057  -8.028 1.00 . A A .  75 PHE C    1 1 
        2  3611 1 1  75 PHE CA   C  -2.548  -3.799  -6.797 1.00 . A A .  75 PHE CA   1 1 
        2  3612 1 1  75 PHE CB   C  -3.680  -4.831  -6.683 1.00 . A A .  75 PHE CB   1 1 
        2  3613 1 1  75 PHE CD1  C  -5.001  -4.958  -8.821 1.00 . A A .  75 PHE CD1  1 1 
        2  3614 1 1  75 PHE CD2  C  -5.948  -3.799  -6.965 1.00 . A A .  75 PHE CD2  1 1 
        2  3615 1 1  75 PHE CE1  C  -6.127  -4.676  -9.572 1.00 . A A .  75 PHE CE1  1 1 
        2  3616 1 1  75 PHE CE2  C  -7.074  -3.513  -7.711 1.00 . A A .  75 PHE CE2  1 1 
        2  3617 1 1  75 PHE CG   C  -4.898  -4.521  -7.510 1.00 . A A .  75 PHE CG   1 1 
        2  3618 1 1  75 PHE CZ   C  -7.165  -3.953  -9.015 1.00 . A A .  75 PHE CZ   1 1 
        2  3619 1 1  75 PHE H    H  -3.411  -2.059  -7.665 1.00 . A A .  75 PHE H    1 1 
        2  3620 1 1  75 PHE HA   H  -1.917  -3.882  -5.923 1.00 . A A .  75 PHE HA   1 1 
        2  3621 1 1  75 PHE HB2  H  -3.308  -5.793  -6.997 1.00 . A A .  75 PHE HB2  1 1 
        2  3622 1 1  75 PHE HB3  H  -3.989  -4.897  -5.649 1.00 . A A .  75 PHE HB3  1 1 
        2  3623 1 1  75 PHE HD1  H  -4.190  -5.523  -9.259 1.00 . A A .  75 PHE HD1  1 1 
        2  3624 1 1  75 PHE HD2  H  -5.878  -3.455  -5.944 1.00 . A A .  75 PHE HD2  1 1 
        2  3625 1 1  75 PHE HE1  H  -6.197  -5.021 -10.591 1.00 . A A .  75 PHE HE1  1 1 
        2  3626 1 1  75 PHE HE2  H  -7.884  -2.948  -7.272 1.00 . A A .  75 PHE HE2  1 1 
        2  3627 1 1  75 PHE HZ   H  -8.045  -3.732  -9.600 1.00 . A A .  75 PHE HZ   1 1 
        2  3628 1 1  75 PHE N    N  -3.072  -2.439  -6.818 1.00 . A A .  75 PHE N    1 1 
        2  3629 1 1  75 PHE O    O  -2.000  -3.587  -9.122 1.00 . A A .  75 PHE O    1 1 
        2  3630 1 1  76 PRO C    C   0.054  -6.209  -9.824 1.00 . A A .  76 PRO C    1 1 
        2  3631 1 1  76 PRO CA   C   0.394  -5.028  -8.920 1.00 . A A .  76 PRO CA   1 1 
        2  3632 1 1  76 PRO CB   C   1.674  -5.300  -8.135 1.00 . A A .  76 PRO CB   1 1 
        2  3633 1 1  76 PRO CD   C  -0.203  -5.508  -6.621 1.00 . A A .  76 PRO CD   1 1 
        2  3634 1 1  76 PRO CG   C   1.219  -5.959  -6.873 1.00 . A A .  76 PRO CG   1 1 
        2  3635 1 1  76 PRO HA   H   0.524  -4.141  -9.523 1.00 . A A .  76 PRO HA   1 1 
        2  3636 1 1  76 PRO HB2  H   2.320  -5.950  -8.709 1.00 . A A .  76 PRO HB2  1 1 
        2  3637 1 1  76 PRO HB3  H   2.182  -4.369  -7.931 1.00 . A A .  76 PRO HB3  1 1 
        2  3638 1 1  76 PRO HD2  H  -0.841  -6.362  -6.448 1.00 . A A .  76 PRO HD2  1 1 
        2  3639 1 1  76 PRO HD3  H  -0.239  -4.835  -5.777 1.00 . A A .  76 PRO HD3  1 1 
        2  3640 1 1  76 PRO HG2  H   1.251  -7.032  -6.994 1.00 . A A .  76 PRO HG2  1 1 
        2  3641 1 1  76 PRO HG3  H   1.857  -5.658  -6.055 1.00 . A A .  76 PRO HG3  1 1 
        2  3642 1 1  76 PRO N    N  -0.586  -4.812  -7.862 1.00 . A A .  76 PRO N    1 1 
        2  3643 1 1  76 PRO O    O  -0.406  -7.260  -9.367 1.00 . A A .  76 PRO O    1 1 
        2  3644 1 1  77 VAL C    C   1.283  -7.570 -12.749 1.00 . A A .  77 VAL C    1 1 
        2  3645 1 1  77 VAL CA   C   0.006  -7.060 -12.095 1.00 . A A .  77 VAL CA   1 1 
        2  3646 1 1  77 VAL CB   C  -0.959  -6.528 -13.178 1.00 . A A .  77 VAL CB   1 1 
        2  3647 1 1  77 VAL CG1  C  -2.292  -6.132 -12.555 1.00 . A A .  77 VAL CG1  1 1 
        2  3648 1 1  77 VAL CG2  C  -0.341  -5.349 -13.921 1.00 . A A .  77 VAL CG2  1 1 
        2  3649 1 1  77 VAL H    H   0.743  -5.206 -11.404 1.00 . A A .  77 VAL H    1 1 
        2  3650 1 1  77 VAL HA   H  -0.477  -7.883 -11.585 1.00 . A A .  77 VAL HA   1 1 
        2  3651 1 1  77 VAL HB   H  -1.142  -7.320 -13.890 1.00 . A A .  77 VAL HB   1 1 
        2  3652 1 1  77 VAL HG11 H  -2.962  -5.782 -13.327 1.00 . A A .  77 VAL HG11 1 1 
        2  3653 1 1  77 VAL HG12 H  -2.132  -5.344 -11.833 1.00 . A A .  77 VAL HG12 1 1 
        2  3654 1 1  77 VAL HG13 H  -2.726  -6.989 -12.062 1.00 . A A .  77 VAL HG13 1 1 
        2  3655 1 1  77 VAL HG21 H  -1.042  -4.978 -14.654 1.00 . A A .  77 VAL HG21 1 1 
        2  3656 1 1  77 VAL HG22 H   0.561  -5.673 -14.420 1.00 . A A .  77 VAL HG22 1 1 
        2  3657 1 1  77 VAL HG23 H  -0.103  -4.564 -13.219 1.00 . A A .  77 VAL HG23 1 1 
        2  3658 1 1  77 VAL N    N   0.313  -6.039 -11.109 1.00 . A A .  77 VAL N    1 1 
        2  3659 1 1  77 VAL O    O   2.380  -7.111 -12.420 1.00 . A A .  77 VAL O    1 1 
        2  3660 1 1  78 GLU C    C   2.794  -8.176 -15.459 1.00 . A A .  78 GLU C    1 1 
        2  3661 1 1  78 GLU CA   C   2.303  -9.090 -14.336 1.00 . A A .  78 GLU CA   1 1 
        2  3662 1 1  78 GLU CB   C   1.995 -10.507 -14.846 1.00 . A A .  78 GLU CB   1 1 
        2  3663 1 1  78 GLU CD   C   0.074  -9.994 -16.417 1.00 . A A .  78 GLU CD   1 1 
        2  3664 1 1  78 GLU CG   C   0.532 -10.754 -15.195 1.00 . A A .  78 GLU CG   1 1 
        2  3665 1 1  78 GLU H    H   0.249  -8.845 -13.893 1.00 . A A .  78 GLU H    1 1 
        2  3666 1 1  78 GLU HA   H   3.091  -9.160 -13.600 1.00 . A A .  78 GLU HA   1 1 
        2  3667 1 1  78 GLU HB2  H   2.584 -10.692 -15.732 1.00 . A A .  78 GLU HB2  1 1 
        2  3668 1 1  78 GLU HB3  H   2.282 -11.217 -14.084 1.00 . A A .  78 GLU HB3  1 1 
        2  3669 1 1  78 GLU HG2  H   0.394 -11.809 -15.380 1.00 . A A .  78 GLU HG2  1 1 
        2  3670 1 1  78 GLU HG3  H  -0.079 -10.456 -14.354 1.00 . A A .  78 GLU HG3  1 1 
        2  3671 1 1  78 GLU N    N   1.146  -8.520 -13.662 1.00 . A A .  78 GLU N    1 1 
        2  3672 1 1  78 GLU O    O   3.994  -8.107 -15.729 1.00 . A A .  78 GLU O    1 1 
        2  3673 1 1  78 GLU OE1  O   0.217 -10.523 -17.538 1.00 . A A .  78 GLU OE1  1 1 
        2  3674 1 1  78 GLU OE2  O  -0.422  -8.861 -16.262 1.00 . A A .  78 GLU OE2  1 1 
        2  3675 1 1  79 GLY C    C   1.364  -6.556 -18.335 1.00 . A A .  79 GLY C    1 1 
        2  3676 1 1  79 GLY CA   C   2.252  -6.500 -17.107 1.00 . A A .  79 GLY CA   1 1 
        2  3677 1 1  79 GLY H    H   0.921  -7.603 -15.881 1.00 . A A .  79 GLY H    1 1 
        2  3678 1 1  79 GLY HA2  H   2.198  -5.507 -16.683 1.00 . A A .  79 GLY HA2  1 1 
        2  3679 1 1  79 GLY HA3  H   3.271  -6.695 -17.406 1.00 . A A .  79 GLY HA3  1 1 
        2  3680 1 1  79 GLY N    N   1.872  -7.462 -16.092 1.00 . A A .  79 GLY N    1 1 
        2  3681 1 1  79 GLY O    O   1.484  -5.718 -19.230 1.00 . A A .  79 GLY O    1 1 
        2  3682 1 1  80 GLY C    C  -1.805  -7.199 -19.248 1.00 . A A .  80 GLY C    1 1 
        2  3683 1 1  80 GLY CA   C  -0.401  -7.691 -19.527 1.00 . A A .  80 GLY CA   1 1 
        2  3684 1 1  80 GLY H    H   0.406  -8.167 -17.629 1.00 . A A .  80 GLY H    1 1 
        2  3685 1 1  80 GLY HA2  H   0.008  -7.132 -20.356 1.00 . A A .  80 GLY HA2  1 1 
        2  3686 1 1  80 GLY HA3  H  -0.444  -8.736 -19.797 1.00 . A A .  80 GLY HA3  1 1 
        2  3687 1 1  80 GLY N    N   0.474  -7.537 -18.384 1.00 . A A .  80 GLY N    1 1 
        2  3688 1 1  80 GLY O    O  -2.593  -6.995 -20.171 1.00 . A A .  80 GLY O    1 1 
        2  3689 1 1  81 VAL C    C  -3.530  -5.018 -17.937 1.00 . A A .  81 VAL C    1 1 
        2  3690 1 1  81 VAL CA   C  -3.429  -6.498 -17.579 1.00 . A A .  81 VAL CA   1 1 
        2  3691 1 1  81 VAL CB   C  -3.687  -6.656 -16.063 1.00 . A A .  81 VAL CB   1 1 
        2  3692 1 1  81 VAL CG1  C  -5.149  -6.412 -15.730 1.00 . A A .  81 VAL CG1  1 1 
        2  3693 1 1  81 VAL CG2  C  -3.254  -8.025 -15.572 1.00 . A A .  81 VAL CG2  1 1 
        2  3694 1 1  81 VAL H    H  -1.471  -7.251 -17.278 1.00 . A A .  81 VAL H    1 1 
        2  3695 1 1  81 VAL HA   H  -4.189  -7.043 -18.117 1.00 . A A .  81 VAL HA   1 1 
        2  3696 1 1  81 VAL HB   H  -3.103  -5.911 -15.548 1.00 . A A .  81 VAL HB   1 1 
        2  3697 1 1  81 VAL HG11 H  -5.301  -6.530 -14.667 1.00 . A A .  81 VAL HG11 1 1 
        2  3698 1 1  81 VAL HG12 H  -5.764  -7.123 -16.263 1.00 . A A .  81 VAL HG12 1 1 
        2  3699 1 1  81 VAL HG13 H  -5.422  -5.410 -16.023 1.00 . A A .  81 VAL HG13 1 1 
        2  3700 1 1  81 VAL HG21 H  -3.451  -8.108 -14.514 1.00 . A A .  81 VAL HG21 1 1 
        2  3701 1 1  81 VAL HG22 H  -2.196  -8.157 -15.752 1.00 . A A .  81 VAL HG22 1 1 
        2  3702 1 1  81 VAL HG23 H  -3.805  -8.790 -16.101 1.00 . A A .  81 VAL HG23 1 1 
        2  3703 1 1  81 VAL N    N  -2.126  -7.020 -17.972 1.00 . A A .  81 VAL N    1 1 
        2  3704 1 1  81 VAL O    O  -2.528  -4.301 -17.952 1.00 . A A .  81 VAL O    1 1 
        2  3705 1 1  82 GLU C    C  -6.238  -2.673 -17.882 1.00 . A A .  82 GLU C    1 1 
        2  3706 1 1  82 GLU CA   C  -4.991  -3.184 -18.577 1.00 . A A .  82 GLU CA   1 1 
        2  3707 1 1  82 GLU CB   C  -5.134  -3.033 -20.092 1.00 . A A .  82 GLU CB   1 1 
        2  3708 1 1  82 GLU CD   C  -3.139  -1.544 -20.486 1.00 . A A .  82 GLU CD   1 1 
        2  3709 1 1  82 GLU CG   C  -3.809  -2.862 -20.815 1.00 . A A .  82 GLU CG   1 1 
        2  3710 1 1  82 GLU H    H  -5.496  -5.194 -18.174 1.00 . A A .  82 GLU H    1 1 
        2  3711 1 1  82 GLU HA   H  -4.145  -2.601 -18.245 1.00 . A A .  82 GLU HA   1 1 
        2  3712 1 1  82 GLU HB2  H  -5.621  -3.913 -20.484 1.00 . A A .  82 GLU HB2  1 1 
        2  3713 1 1  82 GLU HB3  H  -5.749  -2.169 -20.300 1.00 . A A .  82 GLU HB3  1 1 
        2  3714 1 1  82 GLU HG2  H  -3.149  -3.667 -20.528 1.00 . A A .  82 GLU HG2  1 1 
        2  3715 1 1  82 GLU HG3  H  -3.986  -2.904 -21.880 1.00 . A A .  82 GLU HG3  1 1 
        2  3716 1 1  82 GLU N    N  -4.740  -4.572 -18.222 1.00 . A A .  82 GLU N    1 1 
        2  3717 1 1  82 GLU O    O  -7.230  -3.392 -17.765 1.00 . A A .  82 GLU O    1 1 
        2  3718 1 1  82 GLU OE1  O  -2.469  -1.453 -19.436 1.00 . A A .  82 GLU OE1  1 1 
        2  3719 1 1  82 GLU OE2  O  -3.288  -0.585 -21.269 1.00 . A A .  82 GLU OE2  1 1 
        2  3720 1 1  83 GLY C    C  -8.474  -0.632 -17.692 1.00 . A A .  83 GLY C    1 1 
        2  3721 1 1  83 GLY CA   C  -7.302  -0.824 -16.753 1.00 . A A .  83 GLY CA   1 1 
        2  3722 1 1  83 GLY H    H  -5.331  -0.934 -17.501 1.00 . A A .  83 GLY H    1 1 
        2  3723 1 1  83 GLY HA2  H  -7.611  -1.451 -15.929 1.00 . A A .  83 GLY HA2  1 1 
        2  3724 1 1  83 GLY HA3  H  -7.001   0.139 -16.366 1.00 . A A .  83 GLY HA3  1 1 
        2  3725 1 1  83 GLY N    N  -6.170  -1.438 -17.407 1.00 . A A .  83 GLY N    1 1 
        2  3726 1 1  83 GLY O    O  -8.293  -0.435 -18.896 1.00 . A A .  83 GLY O    1 1 
        2  3727 1 1  84 SER C    C -12.021  -0.033 -17.044 1.00 . A A .  84 SER C    1 1 
        2  3728 1 1  84 SER CA   C -10.892  -0.559 -17.927 1.00 . A A .  84 SER CA   1 1 
        2  3729 1 1  84 SER CB   C -11.288  -1.906 -18.545 1.00 . A A .  84 SER CB   1 1 
        2  3730 1 1  84 SER H    H  -9.748  -0.834 -16.177 1.00 . A A .  84 SER H    1 1 
        2  3731 1 1  84 SER HA   H -10.702   0.153 -18.717 1.00 . A A .  84 SER HA   1 1 
        2  3732 1 1  84 SER HB2  H -11.545  -2.598 -17.757 1.00 . A A .  84 SER HB2  1 1 
        2  3733 1 1  84 SER HB3  H -12.139  -1.766 -19.193 1.00 . A A .  84 SER HB3  1 1 
        2  3734 1 1  84 SER HG   H  -9.452  -1.869 -19.244 1.00 . A A .  84 SER HG   1 1 
        2  3735 1 1  84 SER N    N  -9.675  -0.701 -17.146 1.00 . A A .  84 SER N    1 1 
        2  3736 1 1  84 SER O    O -12.427  -0.686 -16.078 1.00 . A A .  84 SER O    1 1 
        2  3737 1 1  84 SER OG   O -10.219  -2.456 -19.303 1.00 . A A .  84 SER OG   1 1 
        2  3738 1 1  85 GLY C    C -13.146   2.482 -15.377 1.00 . A A .  85 GLY C    1 1 
        2  3739 1 1  85 GLY CA   C -13.600   1.736 -16.612 1.00 . A A .  85 GLY CA   1 1 
        2  3740 1 1  85 GLY H    H -12.085   1.669 -18.094 1.00 . A A .  85 GLY H    1 1 
        2  3741 1 1  85 GLY HA2  H -14.132   2.420 -17.255 1.00 . A A .  85 GLY HA2  1 1 
        2  3742 1 1  85 GLY HA3  H -14.270   0.943 -16.314 1.00 . A A .  85 GLY HA3  1 1 
        2  3743 1 1  85 GLY N    N -12.496   1.162 -17.353 1.00 . A A .  85 GLY N    1 1 
        2  3744 1 1  85 GLY O    O -12.558   3.561 -15.476 1.00 . A A .  85 GLY O    1 1 
        2  3745 1 1  86 ARG C    C -11.586   2.398 -12.628 1.00 . A A .  86 ARG C    1 1 
        2  3746 1 1  86 ARG CA   C -13.070   2.550 -12.947 1.00 . A A .  86 ARG CA   1 1 
        2  3747 1 1  86 ARG CB   C -13.911   1.990 -11.789 1.00 . A A .  86 ARG CB   1 1 
        2  3748 1 1  86 ARG CD   C -14.312  -0.024 -10.315 1.00 . A A .  86 ARG CD   1 1 
        2  3749 1 1  86 ARG CG   C -13.924   0.469 -11.704 1.00 . A A .  86 ARG CG   1 1 
        2  3750 1 1  86 ARG CZ   C -16.549  -0.165  -9.283 1.00 . A A .  86 ARG CZ   1 1 
        2  3751 1 1  86 ARG H    H -13.866   1.039 -14.201 1.00 . A A .  86 ARG H    1 1 
        2  3752 1 1  86 ARG HA   H -13.287   3.603 -13.049 1.00 . A A .  86 ARG HA   1 1 
        2  3753 1 1  86 ARG HB2  H -13.521   2.376 -10.859 1.00 . A A .  86 ARG HB2  1 1 
        2  3754 1 1  86 ARG HB3  H -14.931   2.330 -11.907 1.00 . A A .  86 ARG HB3  1 1 
        2  3755 1 1  86 ARG HD2  H -14.413  -1.098 -10.347 1.00 . A A .  86 ARG HD2  1 1 
        2  3756 1 1  86 ARG HD3  H -13.526   0.239  -9.622 1.00 . A A .  86 ARG HD3  1 1 
        2  3757 1 1  86 ARG HE   H -15.681   1.527  -9.924 1.00 . A A .  86 ARG HE   1 1 
        2  3758 1 1  86 ARG HG2  H -14.637   0.086 -12.418 1.00 . A A .  86 ARG HG2  1 1 
        2  3759 1 1  86 ARG HG3  H -12.938   0.097 -11.945 1.00 . A A .  86 ARG HG3  1 1 
        2  3760 1 1  86 ARG HH11 H -15.625  -1.952  -9.524 1.00 . A A .  86 ARG HH11 1 1 
        2  3761 1 1  86 ARG HH12 H -17.181  -2.030  -8.761 1.00 . A A .  86 ARG HH12 1 1 
        2  3762 1 1  86 ARG HH21 H -17.722   1.442  -8.895 1.00 . A A .  86 ARG HH21 1 1 
        2  3763 1 1  86 ARG HH22 H -18.376  -0.092  -8.398 1.00 . A A .  86 ARG HH22 1 1 
        2  3764 1 1  86 ARG N    N -13.417   1.910 -14.211 1.00 . A A .  86 ARG N    1 1 
        2  3765 1 1  86 ARG NE   N -15.569   0.548  -9.843 1.00 . A A .  86 ARG NE   1 1 
        2  3766 1 1  86 ARG NH1  N -16.440  -1.484  -9.183 1.00 . A A .  86 ARG NH1  1 1 
        2  3767 1 1  86 ARG NH2  N -17.633   0.446  -8.822 1.00 . A A .  86 ARG NH2  1 1 
        2  3768 1 1  86 ARG O    O -10.948   3.338 -12.175 1.00 . A A .  86 ARG O    1 1 
        2  3769 1 1  87 VAL C    C  -8.756   1.244 -13.727 1.00 . A A .  87 VAL C    1 1 
        2  3770 1 1  87 VAL CA   C  -9.647   0.949 -12.533 1.00 . A A .  87 VAL CA   1 1 
        2  3771 1 1  87 VAL CB   C  -9.448  -0.516 -12.098 1.00 . A A .  87 VAL CB   1 1 
        2  3772 1 1  87 VAL CG1  C  -8.042  -0.735 -11.566 1.00 . A A .  87 VAL CG1  1 1 
        2  3773 1 1  87 VAL CG2  C -10.484  -0.913 -11.061 1.00 . A A .  87 VAL CG2  1 1 
        2  3774 1 1  87 VAL H    H -11.564   0.528 -13.322 1.00 . A A .  87 VAL H    1 1 
        2  3775 1 1  87 VAL HA   H  -9.368   1.595 -11.713 1.00 . A A .  87 VAL HA   1 1 
        2  3776 1 1  87 VAL HB   H  -9.581  -1.146 -12.965 1.00 . A A .  87 VAL HB   1 1 
        2  3777 1 1  87 VAL HG11 H  -7.326  -0.499 -12.340 1.00 . A A .  87 VAL HG11 1 1 
        2  3778 1 1  87 VAL HG12 H  -7.927  -1.768 -11.271 1.00 . A A .  87 VAL HG12 1 1 
        2  3779 1 1  87 VAL HG13 H  -7.875  -0.094 -10.713 1.00 . A A .  87 VAL HG13 1 1 
        2  3780 1 1  87 VAL HG21 H -10.376  -0.288 -10.186 1.00 . A A .  87 VAL HG21 1 1 
        2  3781 1 1  87 VAL HG22 H -10.339  -1.947 -10.785 1.00 . A A .  87 VAL HG22 1 1 
        2  3782 1 1  87 VAL HG23 H -11.472  -0.786 -11.474 1.00 . A A .  87 VAL HG23 1 1 
        2  3783 1 1  87 VAL N    N -11.037   1.220 -12.875 1.00 . A A .  87 VAL N    1 1 
        2  3784 1 1  87 VAL O    O  -9.065   0.831 -14.844 1.00 . A A .  87 VAL O    1 1 
        2  3785 1 1  88 VAL C    C  -5.366   1.755 -14.334 1.00 . A A .  88 VAL C    1 1 
        2  3786 1 1  88 VAL CA   C  -6.759   2.318 -14.584 1.00 . A A .  88 VAL CA   1 1 
        2  3787 1 1  88 VAL CB   C  -6.668   3.851 -14.777 1.00 . A A .  88 VAL CB   1 1 
        2  3788 1 1  88 VAL CG1  C  -8.011   4.418 -15.219 1.00 . A A .  88 VAL CG1  1 1 
        2  3789 1 1  88 VAL CG2  C  -6.187   4.532 -13.501 1.00 . A A .  88 VAL CG2  1 1 
        2  3790 1 1  88 VAL H    H  -7.458   2.256 -12.580 1.00 . A A .  88 VAL H    1 1 
        2  3791 1 1  88 VAL HA   H  -7.148   1.887 -15.495 1.00 . A A .  88 VAL HA   1 1 
        2  3792 1 1  88 VAL HB   H  -5.949   4.050 -15.557 1.00 . A A .  88 VAL HB   1 1 
        2  3793 1 1  88 VAL HG11 H  -8.299   3.967 -16.156 1.00 . A A .  88 VAL HG11 1 1 
        2  3794 1 1  88 VAL HG12 H  -7.927   5.488 -15.344 1.00 . A A .  88 VAL HG12 1 1 
        2  3795 1 1  88 VAL HG13 H  -8.758   4.200 -14.470 1.00 . A A .  88 VAL HG13 1 1 
        2  3796 1 1  88 VAL HG21 H  -5.191   4.188 -13.266 1.00 . A A .  88 VAL HG21 1 1 
        2  3797 1 1  88 VAL HG22 H  -6.853   4.286 -12.687 1.00 . A A .  88 VAL HG22 1 1 
        2  3798 1 1  88 VAL HG23 H  -6.175   5.602 -13.646 1.00 . A A .  88 VAL HG23 1 1 
        2  3799 1 1  88 VAL N    N  -7.666   1.963 -13.500 1.00 . A A .  88 VAL N    1 1 
        2  3800 1 1  88 VAL O    O  -4.986   1.503 -13.188 1.00 . A A .  88 VAL O    1 1 
        2  3801 1 1  89 THR C    C  -2.345   2.200 -14.805 1.00 . A A .  89 THR C    1 1 
        2  3802 1 1  89 THR CA   C  -3.246   1.070 -15.288 1.00 . A A .  89 THR CA   1 1 
        2  3803 1 1  89 THR CB   C  -2.690   0.540 -16.628 1.00 . A A .  89 THR CB   1 1 
        2  3804 1 1  89 THR CG2  C  -1.480  -0.352 -16.395 1.00 . A A .  89 THR CG2  1 1 
        2  3805 1 1  89 THR H    H  -4.995   1.694 -16.300 1.00 . A A .  89 THR H    1 1 
        2  3806 1 1  89 THR HA   H  -3.225   0.269 -14.564 1.00 . A A .  89 THR HA   1 1 
        2  3807 1 1  89 THR HB   H  -2.379   1.382 -17.225 1.00 . A A .  89 THR HB   1 1 
        2  3808 1 1  89 THR HG1  H  -3.245  -0.791 -17.984 1.00 . A A .  89 THR HG1  1 1 
        2  3809 1 1  89 THR HG21 H  -1.129  -0.738 -17.341 1.00 . A A .  89 THR HG21 1 1 
        2  3810 1 1  89 THR HG22 H  -1.756  -1.172 -15.749 1.00 . A A .  89 THR HG22 1 1 
        2  3811 1 1  89 THR HG23 H  -0.694   0.226 -15.928 1.00 . A A .  89 THR HG23 1 1 
        2  3812 1 1  89 THR N    N  -4.615   1.541 -15.408 1.00 . A A .  89 THR N    1 1 
        2  3813 1 1  89 THR O    O  -2.612   3.380 -15.049 1.00 . A A .  89 THR O    1 1 
        2  3814 1 1  89 THR OG1  O  -3.688  -0.209 -17.339 1.00 . A A .  89 THR OG1  1 1 
        2  3815 1 1  90 GLY C    C   0.850   2.109 -12.999 1.00 . A A .  90 GLY C    1 1 
        2  3816 1 1  90 GLY CA   C  -0.346   2.795 -13.615 1.00 . A A .  90 GLY CA   1 1 
        2  3817 1 1  90 GLY H    H  -1.139   0.874 -13.949 1.00 . A A .  90 GLY H    1 1 
        2  3818 1 1  90 GLY HA2  H  -0.015   3.429 -14.428 1.00 . A A .  90 GLY HA2  1 1 
        2  3819 1 1  90 GLY HA3  H  -0.828   3.402 -12.865 1.00 . A A .  90 GLY HA3  1 1 
        2  3820 1 1  90 GLY N    N  -1.288   1.831 -14.119 1.00 . A A .  90 GLY N    1 1 
        2  3821 1 1  90 GLY O    O   1.173   0.977 -13.365 1.00 . A A .  90 GLY O    1 1 
        2  3822 1 1  91 LEU C    C   2.841   2.881 -10.034 1.00 . A A .  91 LEU C    1 1 
        2  3823 1 1  91 LEU CA   C   2.650   2.214 -11.384 1.00 . A A .  91 LEU CA   1 1 
        2  3824 1 1  91 LEU CB   C   3.922   2.356 -12.237 1.00 . A A .  91 LEU CB   1 1 
        2  3825 1 1  91 LEU CD1  C   5.826   3.744 -13.068 1.00 . A A .  91 LEU CD1  1 1 
        2  3826 1 1  91 LEU CD2  C   3.494   4.520 -13.471 1.00 . A A .  91 LEU CD2  1 1 
        2  3827 1 1  91 LEU CG   C   4.416   3.786 -12.503 1.00 . A A .  91 LEU CG   1 1 
        2  3828 1 1  91 LEU H    H   1.181   3.667 -11.798 1.00 . A A .  91 LEU H    1 1 
        2  3829 1 1  91 LEU HA   H   2.456   1.161 -11.222 1.00 . A A .  91 LEU HA   1 1 
        2  3830 1 1  91 LEU HB2  H   4.715   1.817 -11.741 1.00 . A A .  91 LEU HB2  1 1 
        2  3831 1 1  91 LEU HB3  H   3.738   1.883 -13.191 1.00 . A A .  91 LEU HB3  1 1 
        2  3832 1 1  91 LEU HD11 H   5.823   3.198 -14.001 1.00 . A A .  91 LEU HD11 1 1 
        2  3833 1 1  91 LEU HD12 H   6.482   3.252 -12.366 1.00 . A A .  91 LEU HD12 1 1 
        2  3834 1 1  91 LEU HD13 H   6.174   4.751 -13.243 1.00 . A A .  91 LEU HD13 1 1 
        2  3835 1 1  91 LEU HD21 H   3.475   3.997 -14.415 1.00 . A A .  91 LEU HD21 1 1 
        2  3836 1 1  91 LEU HD22 H   3.858   5.525 -13.623 1.00 . A A .  91 LEU HD22 1 1 
        2  3837 1 1  91 LEU HD23 H   2.496   4.555 -13.059 1.00 . A A .  91 LEU HD23 1 1 
        2  3838 1 1  91 LEU HG   H   4.441   4.336 -11.574 1.00 . A A .  91 LEU HG   1 1 
        2  3839 1 1  91 LEU N    N   1.493   2.775 -12.058 1.00 . A A .  91 LEU N    1 1 
        2  3840 1 1  91 LEU O    O   2.162   3.859  -9.719 1.00 . A A .  91 LEU O    1 1 
        2  3841 1 1  92 THR C    C   4.945   4.111  -8.007 1.00 . A A .  92 THR C    1 1 
        2  3842 1 1  92 THR CA   C   4.040   2.882  -7.927 1.00 . A A .  92 THR CA   1 1 
        2  3843 1 1  92 THR CB   C   4.707   1.804  -7.055 1.00 . A A .  92 THR CB   1 1 
        2  3844 1 1  92 THR CG2  C   3.669   0.866  -6.455 1.00 . A A .  92 THR CG2  1 1 
        2  3845 1 1  92 THR H    H   4.264   1.572  -9.557 1.00 . A A .  92 THR H    1 1 
        2  3846 1 1  92 THR HA   H   3.102   3.162  -7.469 1.00 . A A .  92 THR HA   1 1 
        2  3847 1 1  92 THR HB   H   5.243   2.291  -6.251 1.00 . A A .  92 THR HB   1 1 
        2  3848 1 1  92 THR HG1  H   6.484   0.988  -7.387 1.00 . A A .  92 THR HG1  1 1 
        2  3849 1 1  92 THR HG21 H   4.165   0.124  -5.845 1.00 . A A .  92 THR HG21 1 1 
        2  3850 1 1  92 THR HG22 H   3.126   0.375  -7.248 1.00 . A A .  92 THR HG22 1 1 
        2  3851 1 1  92 THR HG23 H   2.982   1.434  -5.845 1.00 . A A .  92 THR HG23 1 1 
        2  3852 1 1  92 THR N    N   3.760   2.350  -9.246 1.00 . A A .  92 THR N    1 1 
        2  3853 1 1  92 THR O    O   5.842   4.179  -8.850 1.00 . A A .  92 THR O    1 1 
        2  3854 1 1  92 THR OG1  O   5.636   1.050  -7.851 1.00 . A A .  92 THR OG1  1 1 
        2  3855 1 1  93 PRO C    C   6.883   6.085  -6.477 1.00 . A A .  93 PRO C    1 1 
        2  3856 1 1  93 PRO CA   C   5.506   6.325  -7.083 1.00 . A A .  93 PRO CA   1 1 
        2  3857 1 1  93 PRO CB   C   4.687   7.268  -6.183 1.00 . A A .  93 PRO CB   1 1 
        2  3858 1 1  93 PRO CD   C   3.648   5.108  -6.121 1.00 . A A .  93 PRO CD   1 1 
        2  3859 1 1  93 PRO CG   C   3.386   6.573  -5.934 1.00 . A A .  93 PRO CG   1 1 
        2  3860 1 1  93 PRO HA   H   5.615   6.763  -8.065 1.00 . A A .  93 PRO HA   1 1 
        2  3861 1 1  93 PRO HB2  H   5.222   7.442  -5.261 1.00 . A A .  93 PRO HB2  1 1 
        2  3862 1 1  93 PRO HB3  H   4.537   8.207  -6.696 1.00 . A A .  93 PRO HB3  1 1 
        2  3863 1 1  93 PRO HD2  H   3.985   4.660  -5.198 1.00 . A A .  93 PRO HD2  1 1 
        2  3864 1 1  93 PRO HD3  H   2.764   4.608  -6.487 1.00 . A A .  93 PRO HD3  1 1 
        2  3865 1 1  93 PRO HG2  H   3.055   6.768  -4.925 1.00 . A A .  93 PRO HG2  1 1 
        2  3866 1 1  93 PRO HG3  H   2.647   6.915  -6.643 1.00 . A A .  93 PRO HG3  1 1 
        2  3867 1 1  93 PRO N    N   4.712   5.098  -7.130 1.00 . A A .  93 PRO N    1 1 
        2  3868 1 1  93 PRO O    O   6.999   5.618  -5.346 1.00 . A A .  93 PRO O    1 1 
        2  3869 1 1  94 SER C    C   9.676   7.367  -5.833 1.00 . A A .  94 SER C    1 1 
        2  3870 1 1  94 SER CA   C   9.280   6.222  -6.762 1.00 . A A .  94 SER CA   1 1 
        2  3871 1 1  94 SER CB   C  10.236   6.134  -7.950 1.00 . A A .  94 SER CB   1 1 
        2  3872 1 1  94 SER H    H   7.769   6.753  -8.135 1.00 . A A .  94 SER H    1 1 
        2  3873 1 1  94 SER HA   H   9.321   5.294  -6.209 1.00 . A A .  94 SER HA   1 1 
        2  3874 1 1  94 SER HB2  H  11.253   6.228  -7.599 1.00 . A A .  94 SER HB2  1 1 
        2  3875 1 1  94 SER HB3  H  10.113   5.179  -8.441 1.00 . A A .  94 SER HB3  1 1 
        2  3876 1 1  94 SER HG   H  10.098   6.823  -9.788 1.00 . A A .  94 SER HG   1 1 
        2  3877 1 1  94 SER N    N   7.920   6.393  -7.236 1.00 . A A .  94 SER N    1 1 
        2  3878 1 1  94 SER O    O   9.404   8.535  -6.117 1.00 . A A .  94 SER O    1 1 
        2  3879 1 1  94 SER OG   O   9.978   7.168  -8.889 1.00 . A A .  94 SER OG   1 1 
        2  3880 1 1  95 GLY C    C  11.153   7.406  -2.451 1.00 . A A .  95 GLY C    1 1 
        2  3881 1 1  95 GLY CA   C  10.718   8.027  -3.759 1.00 . A A .  95 GLY CA   1 1 
        2  3882 1 1  95 GLY H    H  10.489   6.076  -4.540 1.00 . A A .  95 GLY H    1 1 
        2  3883 1 1  95 GLY HA2  H  11.541   8.590  -4.173 1.00 . A A .  95 GLY HA2  1 1 
        2  3884 1 1  95 GLY HA3  H   9.891   8.696  -3.572 1.00 . A A .  95 GLY HA3  1 1 
        2  3885 1 1  95 GLY N    N  10.305   7.024  -4.717 1.00 . A A .  95 GLY N    1 1 
        2  3886 1 1  95 GLY O    O  11.309   6.189  -2.365 1.00 . A A .  95 GLY O    1 1 
        2  3887 1 1  96 LYS C    C  10.646   7.836   0.883 1.00 . A A .  96 LYS C    1 1 
        2  3888 1 1  96 LYS CA   C  11.785   7.763  -0.129 1.00 . A A .  96 LYS CA   1 1 
        2  3889 1 1  96 LYS CB   C  12.962   8.609   0.362 1.00 . A A .  96 LYS CB   1 1 
        2  3890 1 1  96 LYS CD   C  14.991   7.318  -0.400 1.00 . A A .  96 LYS CD   1 1 
        2  3891 1 1  96 LYS CE   C  16.181   7.319  -1.345 1.00 . A A .  96 LYS CE   1 1 
        2  3892 1 1  96 LYS CG   C  14.169   8.589  -0.562 1.00 . A A .  96 LYS CG   1 1 
        2  3893 1 1  96 LYS H    H  11.153   9.194  -1.558 1.00 . A A .  96 LYS H    1 1 
        2  3894 1 1  96 LYS HA   H  12.102   6.735  -0.231 1.00 . A A .  96 LYS HA   1 1 
        2  3895 1 1  96 LYS HB2  H  12.635   9.634   0.467 1.00 . A A .  96 LYS HB2  1 1 
        2  3896 1 1  96 LYS HB3  H  13.272   8.241   1.329 1.00 . A A .  96 LYS HB3  1 1 
        2  3897 1 1  96 LYS HD2  H  15.347   7.257   0.618 1.00 . A A .  96 LYS HD2  1 1 
        2  3898 1 1  96 LYS HD3  H  14.367   6.466  -0.620 1.00 . A A .  96 LYS HD3  1 1 
        2  3899 1 1  96 LYS HE2  H  15.829   7.118  -2.345 1.00 . A A .  96 LYS HE2  1 1 
        2  3900 1 1  96 LYS HE3  H  16.640   8.297  -1.318 1.00 . A A .  96 LYS HE3  1 1 
        2  3901 1 1  96 LYS HG2  H  13.828   8.654  -1.585 1.00 . A A .  96 LYS HG2  1 1 
        2  3902 1 1  96 LYS HG3  H  14.793   9.440  -0.338 1.00 . A A .  96 LYS HG3  1 1 
        2  3903 1 1  96 LYS HZ1  H  16.783   5.340  -0.995 1.00 . A A .  96 LYS HZ1  1 1 
        2  3904 1 1  96 LYS HZ2  H  17.572   6.492  -0.022 1.00 . A A .  96 LYS HZ2  1 1 
        2  3905 1 1  96 LYS HZ3  H  17.990   6.332  -1.656 1.00 . A A .  96 LYS HZ3  1 1 
        2  3906 1 1  96 LYS N    N  11.337   8.233  -1.433 1.00 . A A .  96 LYS N    1 1 
        2  3907 1 1  96 LYS NZ   N  17.198   6.299  -0.979 1.00 . A A .  96 LYS NZ   1 1 
        2  3908 1 1  96 LYS O    O  10.018   8.884   1.044 1.00 . A A .  96 LYS O    1 1 
        2  3909 1 1  97 ALA C    C   9.783   5.803   3.741 1.00 . A A .  97 ALA C    1 1 
        2  3910 1 1  97 ALA CA   C   9.346   6.678   2.573 1.00 . A A .  97 ALA CA   1 1 
        2  3911 1 1  97 ALA CB   C   8.041   6.166   1.982 1.00 . A A .  97 ALA CB   1 1 
        2  3912 1 1  97 ALA H    H  10.900   5.912   1.357 1.00 . A A .  97 ALA H    1 1 
        2  3913 1 1  97 ALA HA   H   9.184   7.686   2.931 1.00 . A A .  97 ALA HA   1 1 
        2  3914 1 1  97 ALA HB1  H   7.277   6.160   2.745 1.00 . A A .  97 ALA HB1  1 1 
        2  3915 1 1  97 ALA HB2  H   8.183   5.163   1.608 1.00 . A A .  97 ALA HB2  1 1 
        2  3916 1 1  97 ALA HB3  H   7.735   6.812   1.173 1.00 . A A .  97 ALA HB3  1 1 
        2  3917 1 1  97 ALA N    N  10.382   6.727   1.554 1.00 . A A .  97 ALA N    1 1 
        2  3918 1 1  97 ALA O    O  10.604   4.900   3.577 1.00 . A A .  97 ALA O    1 1 
        2  3919 1 1  98 ALA C    C   8.624   4.142   6.276 1.00 . A A .  98 ALA C    1 1 
        2  3920 1 1  98 ALA CA   C   9.579   5.314   6.112 1.00 . A A .  98 ALA CA   1 1 
        2  3921 1 1  98 ALA CB   C   9.541   6.199   7.346 1.00 . A A .  98 ALA CB   1 1 
        2  3922 1 1  98 ALA H    H   8.590   6.808   4.987 1.00 . A A .  98 ALA H    1 1 
        2  3923 1 1  98 ALA HA   H  10.584   4.936   5.994 1.00 . A A .  98 ALA HA   1 1 
        2  3924 1 1  98 ALA HB1  H  10.217   7.032   7.214 1.00 . A A .  98 ALA HB1  1 1 
        2  3925 1 1  98 ALA HB2  H   9.842   5.626   8.211 1.00 . A A .  98 ALA HB2  1 1 
        2  3926 1 1  98 ALA HB3  H   8.538   6.571   7.493 1.00 . A A .  98 ALA HB3  1 1 
        2  3927 1 1  98 ALA N    N   9.242   6.080   4.920 1.00 . A A .  98 ALA N    1 1 
        2  3928 1 1  98 ALA O    O   7.406   4.322   6.281 1.00 . A A .  98 ALA O    1 1 
        2  3929 1 1  99 SER C    C   8.680   0.972   7.784 1.00 . A A .  99 SER C    1 1 
        2  3930 1 1  99 SER CA   C   8.357   1.751   6.508 1.00 . A A .  99 SER CA   1 1 
        2  3931 1 1  99 SER CB   C   8.578   0.875   5.269 1.00 . A A .  99 SER CB   1 1 
        2  3932 1 1  99 SER H    H  10.154   2.867   6.456 1.00 . A A .  99 SER H    1 1 
        2  3933 1 1  99 SER HA   H   7.324   2.056   6.541 1.00 . A A .  99 SER HA   1 1 
        2  3934 1 1  99 SER HB2  H   8.510   1.487   4.382 1.00 . A A .  99 SER HB2  1 1 
        2  3935 1 1  99 SER HB3  H   9.559   0.427   5.320 1.00 . A A .  99 SER HB3  1 1 
        2  3936 1 1  99 SER HG   H   6.859   0.054   5.750 1.00 . A A .  99 SER HG   1 1 
        2  3937 1 1  99 SER N    N   9.172   2.947   6.412 1.00 . A A .  99 SER N    1 1 
        2  3938 1 1  99 SER O    O   9.839   0.873   8.190 1.00 . A A .  99 SER O    1 1 
        2  3939 1 1  99 SER OG   O   7.609  -0.159   5.178 1.00 . A A .  99 SER OG   1 1 
        2  3940 1 1 100 SER C    C   6.934  -1.642   9.424 1.00 . A A . 100 SER C    1 1 
        2  3941 1 1 100 SER CA   C   7.785  -0.388   9.595 1.00 . A A . 100 SER CA   1 1 
        2  3942 1 1 100 SER CB   C   7.365   0.381  10.854 1.00 . A A . 100 SER CB   1 1 
        2  3943 1 1 100 SER H    H   6.735   0.620   8.071 1.00 . A A . 100 SER H    1 1 
        2  3944 1 1 100 SER HA   H   8.823  -0.677   9.678 1.00 . A A . 100 SER HA   1 1 
        2  3945 1 1 100 SER HB2  H   7.893   1.323  10.890 1.00 . A A . 100 SER HB2  1 1 
        2  3946 1 1 100 SER HB3  H   6.302   0.568  10.820 1.00 . A A . 100 SER HB3  1 1 
        2  3947 1 1 100 SER HG   H   8.615  -0.496  12.088 1.00 . A A . 100 SER HG   1 1 
        2  3948 1 1 100 SER N    N   7.640   0.446   8.416 1.00 . A A . 100 SER N    1 1 
        2  3949 1 1 100 SER O    O   5.862  -1.594   8.811 1.00 . A A . 100 SER O    1 1 
        2  3950 1 1 100 SER OG   O   7.662  -0.352  12.031 1.00 . A A . 100 SER OG   1 1 
        2  3951 1 1 101 LEU C    C   6.048  -4.469  11.042 1.00 . A A . 101 LEU C    1 1 
        2  3952 1 1 101 LEU CA   C   6.725  -4.028   9.747 1.00 . A A . 101 LEU CA   1 1 
        2  3953 1 1 101 LEU CB   C   7.730  -5.084   9.254 1.00 . A A . 101 LEU CB   1 1 
        2  3954 1 1 101 LEU CD1  C   8.183  -7.028   7.740 1.00 . A A . 101 LEU CD1  1 1 
        2  3955 1 1 101 LEU CD2  C   6.577  -7.292   9.623 1.00 . A A . 101 LEU CD2  1 1 
        2  3956 1 1 101 LEU CG   C   7.131  -6.328   8.586 1.00 . A A . 101 LEU CG   1 1 
        2  3957 1 1 101 LEU H    H   8.228  -2.732  10.479 1.00 . A A . 101 LEU H    1 1 
        2  3958 1 1 101 LEU HA   H   5.967  -3.883   8.989 1.00 . A A . 101 LEU HA   1 1 
        2  3959 1 1 101 LEU HB2  H   8.394  -4.609   8.548 1.00 . A A . 101 LEU HB2  1 1 
        2  3960 1 1 101 LEU HB3  H   8.313  -5.409  10.102 1.00 . A A . 101 LEU HB3  1 1 
        2  3961 1 1 101 LEU HD11 H   9.004  -7.336   8.371 1.00 . A A . 101 LEU HD11 1 1 
        2  3962 1 1 101 LEU HD12 H   8.546  -6.349   6.983 1.00 . A A . 101 LEU HD12 1 1 
        2  3963 1 1 101 LEU HD13 H   7.747  -7.894   7.268 1.00 . A A . 101 LEU HD13 1 1 
        2  3964 1 1 101 LEU HD21 H   5.841  -6.786  10.231 1.00 . A A . 101 LEU HD21 1 1 
        2  3965 1 1 101 LEU HD22 H   7.380  -7.644  10.253 1.00 . A A . 101 LEU HD22 1 1 
        2  3966 1 1 101 LEU HD23 H   6.116  -8.131   9.125 1.00 . A A . 101 LEU HD23 1 1 
        2  3967 1 1 101 LEU HG   H   6.322  -6.029   7.936 1.00 . A A . 101 LEU HG   1 1 
        2  3968 1 1 101 LEU N    N   7.408  -2.760   9.942 1.00 . A A . 101 LEU N    1 1 
        2  3969 1 1 101 LEU O    O   6.710  -4.706  12.049 1.00 . A A . 101 LEU O    1 1 
        2  3970 1 1 102 TYR C    C   3.550  -6.443  12.092 1.00 . A A . 102 TYR C    1 1 
        2  3971 1 1 102 TYR CA   C   3.950  -4.970  12.170 1.00 . A A . 102 TYR CA   1 1 
        2  3972 1 1 102 TYR CB   C   2.713  -4.068  12.350 1.00 . A A . 102 TYR CB   1 1 
        2  3973 1 1 102 TYR CD1  C   2.322  -2.964  10.116 1.00 . A A . 102 TYR CD1  1 1 
        2  3974 1 1 102 TYR CD2  C   0.669  -4.481  10.913 1.00 . A A . 102 TYR CD2  1 1 
        2  3975 1 1 102 TYR CE1  C   1.575  -2.737   8.981 1.00 . A A . 102 TYR CE1  1 1 
        2  3976 1 1 102 TYR CE2  C  -0.088  -4.257   9.776 1.00 . A A . 102 TYR CE2  1 1 
        2  3977 1 1 102 TYR CG   C   1.888  -3.841  11.099 1.00 . A A . 102 TYR CG   1 1 
        2  3978 1 1 102 TYR CZ   C   0.371  -3.379   8.813 1.00 . A A . 102 TYR CZ   1 1 
        2  3979 1 1 102 TYR H    H   4.260  -4.419  10.152 1.00 . A A . 102 TYR H    1 1 
        2  3980 1 1 102 TYR HA   H   4.586  -4.839  13.028 1.00 . A A . 102 TYR HA   1 1 
        2  3981 1 1 102 TYR HB2  H   2.064  -4.513  13.087 1.00 . A A . 102 TYR HB2  1 1 
        2  3982 1 1 102 TYR HB3  H   3.036  -3.103  12.709 1.00 . A A . 102 TYR HB3  1 1 
        2  3983 1 1 102 TYR HD1  H   3.267  -2.458  10.247 1.00 . A A . 102 TYR HD1  1 1 
        2  3984 1 1 102 TYR HD2  H   0.315  -5.167  11.667 1.00 . A A . 102 TYR HD2  1 1 
        2  3985 1 1 102 TYR HE1  H   1.936  -2.051   8.228 1.00 . A A . 102 TYR HE1  1 1 
        2  3986 1 1 102 TYR HE2  H  -1.034  -4.762   9.647 1.00 . A A . 102 TYR HE2  1 1 
        2  3987 1 1 102 TYR HH   H  -1.244  -2.815   7.903 1.00 . A A . 102 TYR HH   1 1 
        2  3988 1 1 102 TYR N    N   4.725  -4.578  11.002 1.00 . A A . 102 TYR N    1 1 
        2  3989 1 1 102 TYR O    O   3.065  -6.918  11.063 1.00 . A A . 102 TYR O    1 1 
        2  3990 1 1 102 TYR OH   O  -0.365  -3.152   7.672 1.00 . A A . 102 TYR OH   1 1 
        2  3991 1 1 103 ILE C    C   2.157  -8.813  13.988 1.00 . A A . 103 ILE C    1 1 
        2  3992 1 1 103 ILE CA   C   3.472  -8.584  13.247 1.00 . A A . 103 ILE CA   1 1 
        2  3993 1 1 103 ILE CB   C   4.601  -9.370  13.962 1.00 . A A . 103 ILE CB   1 1 
        2  3994 1 1 103 ILE CD1  C   5.914  -9.898  11.832 1.00 . A A . 103 ILE CD1  1 1 
        2  3995 1 1 103 ILE CG1  C   5.925  -9.236  13.197 1.00 . A A . 103 ILE CG1  1 1 
        2  3996 1 1 103 ILE CG2  C   4.224 -10.838  14.113 1.00 . A A . 103 ILE CG2  1 1 
        2  3997 1 1 103 ILE H    H   4.154  -6.721  13.969 1.00 . A A . 103 ILE H    1 1 
        2  3998 1 1 103 ILE HA   H   3.379  -8.958  12.238 1.00 . A A . 103 ILE HA   1 1 
        2  3999 1 1 103 ILE HB   H   4.723  -8.953  14.951 1.00 . A A . 103 ILE HB   1 1 
        2  4000 1 1 103 ILE HD11 H   6.875  -9.765  11.359 1.00 . A A . 103 ILE HD11 1 1 
        2  4001 1 1 103 ILE HD12 H   5.147  -9.448  11.219 1.00 . A A . 103 ILE HD12 1 1 
        2  4002 1 1 103 ILE HD13 H   5.711 -10.952  11.945 1.00 . A A . 103 ILE HD13 1 1 
        2  4003 1 1 103 ILE HG12 H   6.146  -8.190  13.054 1.00 . A A . 103 ILE HG12 1 1 
        2  4004 1 1 103 ILE HG13 H   6.715  -9.690  13.778 1.00 . A A . 103 ILE HG13 1 1 
        2  4005 1 1 103 ILE HG21 H   4.054 -11.267  13.136 1.00 . A A . 103 ILE HG21 1 1 
        2  4006 1 1 103 ILE HG22 H   3.323 -10.921  14.703 1.00 . A A . 103 ILE HG22 1 1 
        2  4007 1 1 103 ILE HG23 H   5.026 -11.369  14.604 1.00 . A A . 103 ILE HG23 1 1 
        2  4008 1 1 103 ILE N    N   3.778  -7.161  13.181 1.00 . A A . 103 ILE N    1 1 
        2  4009 1 1 103 ILE O    O   2.049  -8.519  15.182 1.00 . A A . 103 ILE O    1 1 
        2  4010 1 1 104 GLY C    C  -1.286  -9.071  13.114 1.00 . A A . 104 GLY C    1 1 
        2  4011 1 1 104 GLY CA   C  -0.112  -9.591  13.917 1.00 . A A . 104 GLY CA   1 1 
        2  4012 1 1 104 GLY H    H   1.291  -9.544  12.333 1.00 . A A . 104 GLY H    1 1 
        2  4013 1 1 104 GLY HA2  H  -0.224 -10.659  14.048 1.00 . A A . 104 GLY HA2  1 1 
        2  4014 1 1 104 GLY HA3  H  -0.122  -9.119  14.889 1.00 . A A . 104 GLY HA3  1 1 
        2  4015 1 1 104 GLY N    N   1.161  -9.330  13.285 1.00 . A A . 104 GLY N    1 1 
        2  4016 1 1 104 GLY O    O  -1.189  -8.903  11.898 1.00 . A A . 104 GLY O    1 1 
        2  4017 1 1 105 PRO C    C  -3.637  -6.870  12.804 1.00 . A A . 105 PRO C    1 1 
        2  4018 1 1 105 PRO CA   C  -3.645  -8.361  13.129 1.00 . A A . 105 PRO CA   1 1 
        2  4019 1 1 105 PRO CB   C  -4.714  -8.669  14.175 1.00 . A A . 105 PRO CB   1 1 
        2  4020 1 1 105 PRO CD   C  -2.583  -8.939  15.241 1.00 . A A . 105 PRO CD   1 1 
        2  4021 1 1 105 PRO CG   C  -4.011  -8.534  15.481 1.00 . A A . 105 PRO CG   1 1 
        2  4022 1 1 105 PRO HA   H  -3.845  -8.925  12.231 1.00 . A A . 105 PRO HA   1 1 
        2  4023 1 1 105 PRO HB2  H  -5.524  -7.960  14.084 1.00 . A A . 105 PRO HB2  1 1 
        2  4024 1 1 105 PRO HB3  H  -5.087  -9.672  14.030 1.00 . A A . 105 PRO HB3  1 1 
        2  4025 1 1 105 PRO HD2  H  -1.911  -8.273  15.761 1.00 . A A . 105 PRO HD2  1 1 
        2  4026 1 1 105 PRO HD3  H  -2.423  -9.960  15.559 1.00 . A A . 105 PRO HD3  1 1 
        2  4027 1 1 105 PRO HG2  H  -4.056  -7.508  15.816 1.00 . A A . 105 PRO HG2  1 1 
        2  4028 1 1 105 PRO HG3  H  -4.467  -9.188  16.210 1.00 . A A . 105 PRO HG3  1 1 
        2  4029 1 1 105 PRO N    N  -2.416  -8.811  13.782 1.00 . A A . 105 PRO N    1 1 
        2  4030 1 1 105 PRO O    O  -2.645  -6.173  13.026 1.00 . A A . 105 PRO O    1 1 
        2  4031 1 1 106 TYR C    C  -5.485  -4.176  13.074 1.00 . A A . 106 TYR C    1 1 
        2  4032 1 1 106 TYR CA   C  -4.869  -4.977  11.934 1.00 . A A . 106 TYR CA   1 1 
        2  4033 1 1 106 TYR CB   C  -5.701  -4.824  10.657 1.00 . A A . 106 TYR CB   1 1 
        2  4034 1 1 106 TYR CD1  C  -4.478  -2.750   9.926 1.00 . A A . 106 TYR CD1  1 1 
        2  4035 1 1 106 TYR CD2  C  -6.852  -2.779   9.722 1.00 . A A . 106 TYR CD2  1 1 
        2  4036 1 1 106 TYR CE1  C  -4.445  -1.473   9.415 1.00 . A A . 106 TYR CE1  1 1 
        2  4037 1 1 106 TYR CE2  C  -6.827  -1.497   9.207 1.00 . A A . 106 TYR CE2  1 1 
        2  4038 1 1 106 TYR CG   C  -5.678  -3.425  10.090 1.00 . A A . 106 TYR CG   1 1 
        2  4039 1 1 106 TYR CZ   C  -5.618  -0.849   9.055 1.00 . A A . 106 TYR CZ   1 1 
        2  4040 1 1 106 TYR H    H  -5.534  -6.966  12.184 1.00 . A A . 106 TYR H    1 1 
        2  4041 1 1 106 TYR HA   H  -3.871  -4.606  11.749 1.00 . A A . 106 TYR HA   1 1 
        2  4042 1 1 106 TYR HB2  H  -5.320  -5.496   9.901 1.00 . A A . 106 TYR HB2  1 1 
        2  4043 1 1 106 TYR HB3  H  -6.728  -5.079  10.871 1.00 . A A . 106 TYR HB3  1 1 
        2  4044 1 1 106 TYR HD1  H  -3.557  -3.241  10.205 1.00 . A A . 106 TYR HD1  1 1 
        2  4045 1 1 106 TYR HD2  H  -7.795  -3.291   9.844 1.00 . A A . 106 TYR HD2  1 1 
        2  4046 1 1 106 TYR HE1  H  -3.499  -0.964   9.297 1.00 . A A . 106 TYR HE1  1 1 
        2  4047 1 1 106 TYR HE2  H  -7.749  -1.009   8.927 1.00 . A A . 106 TYR HE2  1 1 
        2  4048 1 1 106 TYR HH   H  -4.887   0.464   7.850 1.00 . A A . 106 TYR HH   1 1 
        2  4049 1 1 106 TYR N    N  -4.761  -6.375  12.304 1.00 . A A . 106 TYR N    1 1 
        2  4050 1 1 106 TYR O    O  -6.397  -4.645  13.757 1.00 . A A . 106 TYR O    1 1 
        2  4051 1 1 106 TYR OH   O  -5.578   0.424   8.539 1.00 . A A . 106 TYR OH   1 1 
        2  4052 1 1 107 GLY C    C  -4.310  -1.881  15.369 1.00 . A A . 107 GLY C    1 1 
        2  4053 1 1 107 GLY CA   C  -5.423  -2.145  14.380 1.00 . A A . 107 GLY CA   1 1 
        2  4054 1 1 107 GLY H    H  -4.262  -2.648  12.686 1.00 . A A . 107 GLY H    1 1 
        2  4055 1 1 107 GLY HA2  H  -5.779  -1.203  13.987 1.00 . A A . 107 GLY HA2  1 1 
        2  4056 1 1 107 GLY HA3  H  -6.233  -2.644  14.891 1.00 . A A . 107 GLY HA3  1 1 
        2  4057 1 1 107 GLY N    N  -4.967  -2.975  13.283 1.00 . A A . 107 GLY N    1 1 
        2  4058 1 1 107 GLY O    O  -4.317  -0.881  16.081 1.00 . A A . 107 GLY O    1 1 
        2  4059 1 1 108 GLU C    C  -1.095  -1.782  15.666 1.00 . A A . 108 GLU C    1 1 
        2  4060 1 1 108 GLU CA   C  -2.190  -2.665  16.285 1.00 . A A . 108 GLU CA   1 1 
        2  4061 1 1 108 GLU CB   C  -1.667  -4.073  16.601 1.00 . A A . 108 GLU CB   1 1 
        2  4062 1 1 108 GLU CD   C  -0.548  -5.546  18.312 1.00 . A A . 108 GLU CD   1 1 
        2  4063 1 1 108 GLU CG   C  -0.712  -4.138  17.782 1.00 . A A . 108 GLU CG   1 1 
        2  4064 1 1 108 GLU H    H  -3.366  -3.530  14.759 1.00 . A A . 108 GLU H    1 1 
        2  4065 1 1 108 GLU HA   H  -2.536  -2.202  17.198 1.00 . A A . 108 GLU HA   1 1 
        2  4066 1 1 108 GLU HB2  H  -2.510  -4.712  16.816 1.00 . A A . 108 GLU HB2  1 1 
        2  4067 1 1 108 GLU HB3  H  -1.153  -4.456  15.731 1.00 . A A . 108 GLU HB3  1 1 
        2  4068 1 1 108 GLU HG2  H   0.254  -3.772  17.468 1.00 . A A . 108 GLU HG2  1 1 
        2  4069 1 1 108 GLU HG3  H  -1.096  -3.513  18.574 1.00 . A A . 108 GLU HG3  1 1 
        2  4070 1 1 108 GLU N    N  -3.326  -2.771  15.378 1.00 . A A . 108 GLU N    1 1 
        2  4071 1 1 108 GLU O    O   0.092  -1.928  15.952 1.00 . A A . 108 GLU O    1 1 
        2  4072 1 1 108 GLU OE1  O   0.338  -6.279  17.830 1.00 . A A . 108 GLU OE1  1 1 
        2  4073 1 1 108 GLU OE2  O  -1.315  -5.931  19.224 1.00 . A A . 108 GLU OE2  1 1 
        2  4074 1 1 109 ILE C    C  -0.040   1.097  15.139 1.00 . A A . 109 ILE C    1 1 
        2  4075 1 1 109 ILE CA   C  -0.609   0.069  14.153 1.00 . A A . 109 ILE CA   1 1 
        2  4076 1 1 109 ILE CB   C  -1.325   0.801  12.990 1.00 . A A . 109 ILE CB   1 1 
        2  4077 1 1 109 ILE CD1  C  -1.184  -1.111  11.282 1.00 . A A . 109 ILE CD1  1 1 
        2  4078 1 1 109 ILE CG1  C  -2.081  -0.199  12.102 1.00 . A A . 109 ILE CG1  1 1 
        2  4079 1 1 109 ILE CG2  C  -0.334   1.598  12.151 1.00 . A A . 109 ILE CG2  1 1 
        2  4080 1 1 109 ILE H    H  -2.487  -0.728  14.701 1.00 . A A . 109 ILE H    1 1 
        2  4081 1 1 109 ILE HA   H   0.202  -0.517  13.745 1.00 . A A . 109 ILE HA   1 1 
        2  4082 1 1 109 ILE HB   H  -2.029   1.494  13.417 1.00 . A A . 109 ILE HB   1 1 
        2  4083 1 1 109 ILE HD11 H  -1.792  -1.793  10.702 1.00 . A A . 109 ILE HD11 1 1 
        2  4084 1 1 109 ILE HD12 H  -0.540  -1.675  11.941 1.00 . A A . 109 ILE HD12 1 1 
        2  4085 1 1 109 ILE HD13 H  -0.580  -0.514  10.614 1.00 . A A . 109 ILE HD13 1 1 
        2  4086 1 1 109 ILE HG12 H  -2.700  -0.825  12.728 1.00 . A A . 109 ILE HG12 1 1 
        2  4087 1 1 109 ILE HG13 H  -2.714   0.348  11.417 1.00 . A A . 109 ILE HG13 1 1 
        2  4088 1 1 109 ILE HG21 H   0.396   0.927  11.721 1.00 . A A . 109 ILE HG21 1 1 
        2  4089 1 1 109 ILE HG22 H   0.167   2.321  12.777 1.00 . A A . 109 ILE HG22 1 1 
        2  4090 1 1 109 ILE HG23 H  -0.862   2.110  11.360 1.00 . A A . 109 ILE HG23 1 1 
        2  4091 1 1 109 ILE N    N  -1.524  -0.833  14.840 1.00 . A A . 109 ILE N    1 1 
        2  4092 1 1 109 ILE O    O   0.968   1.744  14.869 1.00 . A A . 109 ILE O    1 1 
        2  4093 1 1 110 GLU C    C   1.205   1.877  17.731 1.00 . A A . 110 GLU C    1 1 
        2  4094 1 1 110 GLU CA   C  -0.256   2.133  17.351 1.00 . A A . 110 GLU CA   1 1 
        2  4095 1 1 110 GLU CB   C  -1.151   1.960  18.581 1.00 . A A . 110 GLU CB   1 1 
        2  4096 1 1 110 GLU CD   C  -2.790   3.886  18.683 1.00 . A A . 110 GLU CD   1 1 
        2  4097 1 1 110 GLU CG   C  -2.588   2.415  18.370 1.00 . A A . 110 GLU CG   1 1 
        2  4098 1 1 110 GLU H    H  -1.501   0.685  16.435 1.00 . A A . 110 GLU H    1 1 
        2  4099 1 1 110 GLU HA   H  -0.350   3.143  16.984 1.00 . A A . 110 GLU HA   1 1 
        2  4100 1 1 110 GLU HB2  H  -1.165   0.916  18.856 1.00 . A A . 110 GLU HB2  1 1 
        2  4101 1 1 110 GLU HB3  H  -0.734   2.532  19.396 1.00 . A A . 110 GLU HB3  1 1 
        2  4102 1 1 110 GLU HG2  H  -2.860   2.243  17.339 1.00 . A A . 110 GLU HG2  1 1 
        2  4103 1 1 110 GLU HG3  H  -3.235   1.834  19.012 1.00 . A A . 110 GLU HG3  1 1 
        2  4104 1 1 110 GLU N    N  -0.695   1.222  16.291 1.00 . A A . 110 GLU N    1 1 
        2  4105 1 1 110 GLU O    O   1.986   2.814  17.935 1.00 . A A . 110 GLU O    1 1 
        2  4106 1 1 110 GLU OE1  O  -1.791   4.617  18.823 1.00 . A A . 110 GLU OE1  1 1 
        2  4107 1 1 110 GLU OE2  O  -3.958   4.311  18.834 1.00 . A A . 110 GLU OE2  1 1 
        2  4108 1 1 111 ALA C    C   3.961   0.743  17.199 1.00 . A A . 111 ALA C    1 1 
        2  4109 1 1 111 ALA CA   C   2.919   0.203  18.174 1.00 . A A . 111 ALA CA   1 1 
        2  4110 1 1 111 ALA CB   C   3.011  -1.312  18.260 1.00 . A A . 111 ALA CB   1 1 
        2  4111 1 1 111 ALA H    H   0.917  -0.091  17.564 1.00 . A A . 111 ALA H    1 1 
        2  4112 1 1 111 ALA HA   H   3.116   0.606  19.156 1.00 . A A . 111 ALA HA   1 1 
        2  4113 1 1 111 ALA HB1  H   2.835  -1.738  17.284 1.00 . A A . 111 ALA HB1  1 1 
        2  4114 1 1 111 ALA HB2  H   2.269  -1.679  18.953 1.00 . A A . 111 ALA HB2  1 1 
        2  4115 1 1 111 ALA HB3  H   3.997  -1.592  18.604 1.00 . A A . 111 ALA HB3  1 1 
        2  4116 1 1 111 ALA N    N   1.571   0.601  17.788 1.00 . A A . 111 ALA N    1 1 
        2  4117 1 1 111 ALA O    O   5.052   1.148  17.602 1.00 . A A . 111 ALA O    1 1 
        2  4118 1 1 112 VAL C    C   4.509   2.790  14.880 1.00 . A A . 112 VAL C    1 1 
        2  4119 1 1 112 VAL CA   C   4.541   1.260  14.912 1.00 . A A . 112 VAL CA   1 1 
        2  4120 1 1 112 VAL CB   C   4.254   0.667  13.513 1.00 . A A . 112 VAL CB   1 1 
        2  4121 1 1 112 VAL CG1  C   4.020  -0.832  13.604 1.00 . A A . 112 VAL CG1  1 1 
        2  4122 1 1 112 VAL CG2  C   3.087   1.349  12.821 1.00 . A A . 112 VAL CG2  1 1 
        2  4123 1 1 112 VAL H    H   2.752   0.428  15.632 1.00 . A A . 112 VAL H    1 1 
        2  4124 1 1 112 VAL HA   H   5.534   0.950  15.206 1.00 . A A . 112 VAL HA   1 1 
        2  4125 1 1 112 VAL HB   H   5.129   0.818  12.915 1.00 . A A . 112 VAL HB   1 1 
        2  4126 1 1 112 VAL HG11 H   3.170  -1.025  14.243 1.00 . A A . 112 VAL HG11 1 1 
        2  4127 1 1 112 VAL HG12 H   4.896  -1.309  14.014 1.00 . A A . 112 VAL HG12 1 1 
        2  4128 1 1 112 VAL HG13 H   3.822  -1.225  12.617 1.00 . A A . 112 VAL HG13 1 1 
        2  4129 1 1 112 VAL HG21 H   2.936   0.901  11.849 1.00 . A A . 112 VAL HG21 1 1 
        2  4130 1 1 112 VAL HG22 H   3.302   2.399  12.704 1.00 . A A . 112 VAL HG22 1 1 
        2  4131 1 1 112 VAL HG23 H   2.194   1.225  13.416 1.00 . A A . 112 VAL HG23 1 1 
        2  4132 1 1 112 VAL N    N   3.626   0.760  15.912 1.00 . A A . 112 VAL N    1 1 
        2  4133 1 1 112 VAL O    O   5.501   3.429  14.535 1.00 . A A . 112 VAL O    1 1 
        2  4134 1 1 113 TYR C    C   4.273   5.322  16.436 1.00 . A A . 113 TYR C    1 1 
        2  4135 1 1 113 TYR CA   C   3.271   4.831  15.400 1.00 . A A . 113 TYR CA   1 1 
        2  4136 1 1 113 TYR CB   C   1.865   5.267  15.830 1.00 . A A . 113 TYR CB   1 1 
        2  4137 1 1 113 TYR CD1  C   1.069   5.550  13.448 1.00 . A A . 113 TYR CD1  1 1 
        2  4138 1 1 113 TYR CD2  C  -0.467   4.697  15.057 1.00 . A A . 113 TYR CD2  1 1 
        2  4139 1 1 113 TYR CE1  C   0.096   5.468  12.471 1.00 . A A . 113 TYR CE1  1 1 
        2  4140 1 1 113 TYR CE2  C  -1.447   4.614  14.086 1.00 . A A . 113 TYR CE2  1 1 
        2  4141 1 1 113 TYR CG   C   0.805   5.165  14.756 1.00 . A A . 113 TYR CG   1 1 
        2  4142 1 1 113 TYR CZ   C  -1.161   5.000  12.795 1.00 . A A . 113 TYR CZ   1 1 
        2  4143 1 1 113 TYR H    H   2.585   2.822  15.456 1.00 . A A . 113 TYR H    1 1 
        2  4144 1 1 113 TYR HA   H   3.506   5.277  14.444 1.00 . A A . 113 TYR HA   1 1 
        2  4145 1 1 113 TYR HB2  H   1.549   4.649  16.657 1.00 . A A . 113 TYR HB2  1 1 
        2  4146 1 1 113 TYR HB3  H   1.906   6.296  16.158 1.00 . A A . 113 TYR HB3  1 1 
        2  4147 1 1 113 TYR HD1  H   2.054   5.913  13.197 1.00 . A A . 113 TYR HD1  1 1 
        2  4148 1 1 113 TYR HD2  H  -0.690   4.395  16.070 1.00 . A A . 113 TYR HD2  1 1 
        2  4149 1 1 113 TYR HE1  H   0.321   5.772  11.459 1.00 . A A . 113 TYR HE1  1 1 
        2  4150 1 1 113 TYR HE2  H  -2.430   4.246  14.341 1.00 . A A . 113 TYR HE2  1 1 
        2  4151 1 1 113 TYR HH   H  -1.762   4.535  11.026 1.00 . A A . 113 TYR HH   1 1 
        2  4152 1 1 113 TYR N    N   3.370   3.378  15.260 1.00 . A A . 113 TYR N    1 1 
        2  4153 1 1 113 TYR O    O   4.976   6.313  16.220 1.00 . A A . 113 TYR O    1 1 
        2  4154 1 1 113 TYR OH   O  -2.136   4.918  11.825 1.00 . A A . 113 TYR OH   1 1 
        2  4155 1 1 114 ASP C    C   6.711   4.888  18.153 1.00 . A A . 114 ASP C    1 1 
        2  4156 1 1 114 ASP CA   C   5.263   4.953  18.634 1.00 . A A . 114 ASP CA   1 1 
        2  4157 1 1 114 ASP CB   C   5.065   4.011  19.822 1.00 . A A . 114 ASP CB   1 1 
        2  4158 1 1 114 ASP CG   C   5.918   4.394  21.017 1.00 . A A . 114 ASP CG   1 1 
        2  4159 1 1 114 ASP H    H   3.732   3.839  17.669 1.00 . A A . 114 ASP H    1 1 
        2  4160 1 1 114 ASP HA   H   5.046   5.963  18.947 1.00 . A A . 114 ASP HA   1 1 
        2  4161 1 1 114 ASP HB2  H   4.028   4.035  20.121 1.00 . A A . 114 ASP HB2  1 1 
        2  4162 1 1 114 ASP HB3  H   5.327   3.008  19.522 1.00 . A A . 114 ASP HB3  1 1 
        2  4163 1 1 114 ASP N    N   4.338   4.611  17.557 1.00 . A A . 114 ASP N    1 1 
        2  4164 1 1 114 ASP O    O   7.560   5.659  18.594 1.00 . A A . 114 ASP O    1 1 
        2  4165 1 1 114 ASP OD1  O   5.541   5.341  21.741 1.00 . A A . 114 ASP OD1  1 1 
        2  4166 1 1 114 ASP OD2  O   6.955   3.744  21.245 1.00 . A A . 114 ASP OD2  1 1 
        2  4167 1 1 115 ALA C    C   8.626   4.981  15.702 1.00 . A A . 115 ALA C    1 1 
        2  4168 1 1 115 ALA CA   C   8.322   3.841  16.672 1.00 . A A . 115 ALA CA   1 1 
        2  4169 1 1 115 ALA CB   C   8.466   2.498  15.971 1.00 . A A . 115 ALA CB   1 1 
        2  4170 1 1 115 ALA H    H   6.274   3.374  16.929 1.00 . A A . 115 ALA H    1 1 
        2  4171 1 1 115 ALA HA   H   9.032   3.875  17.487 1.00 . A A . 115 ALA HA   1 1 
        2  4172 1 1 115 ALA HB1  H   8.273   1.703  16.675 1.00 . A A . 115 ALA HB1  1 1 
        2  4173 1 1 115 ALA HB2  H   9.470   2.401  15.585 1.00 . A A . 115 ALA HB2  1 1 
        2  4174 1 1 115 ALA HB3  H   7.761   2.439  15.157 1.00 . A A . 115 ALA HB3  1 1 
        2  4175 1 1 115 ALA N    N   6.986   3.976  17.233 1.00 . A A . 115 ALA N    1 1 
        2  4176 1 1 115 ALA O    O   9.748   5.488  15.651 1.00 . A A . 115 ALA O    1 1 
        2  4177 1 1 116 LEU C    C   7.930   7.812  14.530 1.00 . A A . 116 LEU C    1 1 
        2  4178 1 1 116 LEU CA   C   7.796   6.417  13.925 1.00 . A A . 116 LEU CA   1 1 
        2  4179 1 1 116 LEU CB   C   6.641   6.392  12.918 1.00 . A A . 116 LEU CB   1 1 
        2  4180 1 1 116 LEU CD1  C   8.101   6.133  10.893 1.00 . A A . 116 LEU CD1  1 1 
        2  4181 1 1 116 LEU CD2  C   7.098   4.108  11.958 1.00 . A A . 116 LEU CD2  1 1 
        2  4182 1 1 116 LEU CG   C   6.897   5.581  11.641 1.00 . A A . 116 LEU CG   1 1 
        2  4183 1 1 116 LEU H    H   6.732   4.983  15.064 1.00 . A A . 116 LEU H    1 1 
        2  4184 1 1 116 LEU HA   H   8.711   6.189  13.398 1.00 . A A . 116 LEU HA   1 1 
        2  4185 1 1 116 LEU HB2  H   5.772   5.979  13.411 1.00 . A A . 116 LEU HB2  1 1 
        2  4186 1 1 116 LEU HB3  H   6.422   7.410  12.633 1.00 . A A . 116 LEU HB3  1 1 
        2  4187 1 1 116 LEU HD11 H   7.911   7.159  10.612 1.00 . A A . 116 LEU HD11 1 1 
        2  4188 1 1 116 LEU HD12 H   8.275   5.542  10.006 1.00 . A A . 116 LEU HD12 1 1 
        2  4189 1 1 116 LEU HD13 H   8.972   6.089  11.531 1.00 . A A . 116 LEU HD13 1 1 
        2  4190 1 1 116 LEU HD21 H   7.938   3.996  12.626 1.00 . A A . 116 LEU HD21 1 1 
        2  4191 1 1 116 LEU HD22 H   7.289   3.564  11.043 1.00 . A A . 116 LEU HD22 1 1 
        2  4192 1 1 116 LEU HD23 H   6.209   3.716  12.430 1.00 . A A . 116 LEU HD23 1 1 
        2  4193 1 1 116 LEU HG   H   6.036   5.669  10.993 1.00 . A A . 116 LEU HG   1 1 
        2  4194 1 1 116 LEU N    N   7.619   5.389  14.942 1.00 . A A . 116 LEU N    1 1 
        2  4195 1 1 116 LEU O    O   8.654   8.650  13.988 1.00 . A A . 116 LEU O    1 1 
        2  4196 1 1 117 MET C    C   8.684   9.861  16.552 1.00 . A A . 117 MET C    1 1 
        2  4197 1 1 117 MET CA   C   7.257   9.387  16.275 1.00 . A A . 117 MET CA   1 1 
        2  4198 1 1 117 MET CB   C   6.440   9.412  17.580 1.00 . A A . 117 MET CB   1 1 
        2  4199 1 1 117 MET CE   C   6.699  10.609  20.567 1.00 . A A . 117 MET CE   1 1 
        2  4200 1 1 117 MET CG   C   7.033   8.582  18.710 1.00 . A A . 117 MET CG   1 1 
        2  4201 1 1 117 MET H    H   6.719   7.337  16.061 1.00 . A A . 117 MET H    1 1 
        2  4202 1 1 117 MET HA   H   6.803  10.074  15.574 1.00 . A A . 117 MET HA   1 1 
        2  4203 1 1 117 MET HB2  H   6.362  10.435  17.921 1.00 . A A . 117 MET HB2  1 1 
        2  4204 1 1 117 MET HB3  H   5.447   9.039  17.370 1.00 . A A . 117 MET HB3  1 1 
        2  4205 1 1 117 MET HE1  H   6.328  11.212  19.749 1.00 . A A . 117 MET HE1  1 1 
        2  4206 1 1 117 MET HE2  H   7.773  10.695  20.616 1.00 . A A . 117 MET HE2  1 1 
        2  4207 1 1 117 MET HE3  H   6.266  10.954  21.494 1.00 . A A . 117 MET HE3  1 1 
        2  4208 1 1 117 MET HG2  H   6.916   7.538  18.467 1.00 . A A . 117 MET HG2  1 1 
        2  4209 1 1 117 MET HG3  H   8.084   8.814  18.795 1.00 . A A . 117 MET HG3  1 1 
        2  4210 1 1 117 MET N    N   7.249   8.059  15.652 1.00 . A A . 117 MET N    1 1 
        2  4211 1 1 117 MET O    O   9.009  11.032  16.349 1.00 . A A . 117 MET O    1 1 
        2  4212 1 1 117 MET SD   S   6.244   8.896  20.301 1.00 . A A . 117 MET SD   1 1 
        2  4213 1 1 118 LYS C    C  11.713   9.309  15.963 1.00 . A A . 118 LYS C    1 1 
        2  4214 1 1 118 LYS CA   C  10.925   9.265  17.263 1.00 . A A . 118 LYS CA   1 1 
        2  4215 1 1 118 LYS CB   C  11.553   8.246  18.217 1.00 . A A . 118 LYS CB   1 1 
        2  4216 1 1 118 LYS CD   C  13.627   7.448  19.399 1.00 . A A . 118 LYS CD   1 1 
        2  4217 1 1 118 LYS CE   C  15.134   7.611  19.537 1.00 . A A . 118 LYS CE   1 1 
        2  4218 1 1 118 LYS CG   C  13.040   8.474  18.449 1.00 . A A . 118 LYS CG   1 1 
        2  4219 1 1 118 LYS H    H   9.209   8.033  17.172 1.00 . A A . 118 LYS H    1 1 
        2  4220 1 1 118 LYS HA   H  10.961  10.241  17.722 1.00 . A A . 118 LYS HA   1 1 
        2  4221 1 1 118 LYS HB2  H  11.047   8.303  19.170 1.00 . A A . 118 LYS HB2  1 1 
        2  4222 1 1 118 LYS HB3  H  11.421   7.256  17.807 1.00 . A A . 118 LYS HB3  1 1 
        2  4223 1 1 118 LYS HD2  H  13.172   7.569  20.371 1.00 . A A . 118 LYS HD2  1 1 
        2  4224 1 1 118 LYS HD3  H  13.414   6.457  19.021 1.00 . A A . 118 LYS HD3  1 1 
        2  4225 1 1 118 LYS HE2  H  15.509   6.838  20.193 1.00 . A A . 118 LYS HE2  1 1 
        2  4226 1 1 118 LYS HE3  H  15.584   7.500  18.561 1.00 . A A . 118 LYS HE3  1 1 
        2  4227 1 1 118 LYS HG2  H  13.554   8.407  17.502 1.00 . A A . 118 LYS HG2  1 1 
        2  4228 1 1 118 LYS HG3  H  13.182   9.461  18.866 1.00 . A A . 118 LYS HG3  1 1 
        2  4229 1 1 118 LYS HZ1  H  15.192   9.701  19.455 1.00 . A A . 118 LYS HZ1  1 1 
        2  4230 1 1 118 LYS HZ2  H  16.551   9.002  20.190 1.00 . A A . 118 LYS HZ2  1 1 
        2  4231 1 1 118 LYS HZ3  H  15.077   9.075  21.029 1.00 . A A . 118 LYS HZ3  1 1 
        2  4232 1 1 118 LYS N    N   9.531   8.946  17.006 1.00 . A A . 118 LYS N    1 1 
        2  4233 1 1 118 LYS NZ   N  15.512   8.938  20.092 1.00 . A A . 118 LYS NZ   1 1 
        2  4234 1 1 118 LYS O    O  12.415  10.279  15.689 1.00 . A A . 118 LYS O    1 1 
        2  4235 1 1 119 TRP C    C  12.244   9.282  13.007 1.00 . A A . 119 TRP C    1 1 
        2  4236 1 1 119 TRP CA   C  12.361   8.081  13.949 1.00 . A A . 119 TRP CA   1 1 
        2  4237 1 1 119 TRP CB   C  11.923   6.802  13.227 1.00 . A A . 119 TRP CB   1 1 
        2  4238 1 1 119 TRP CD1  C  13.899   5.467  12.288 1.00 . A A . 119 TRP CD1  1 1 
        2  4239 1 1 119 TRP CD2  C  12.882   6.771  10.780 1.00 . A A . 119 TRP CD2  1 1 
        2  4240 1 1 119 TRP CE2  C  13.939   6.093  10.147 1.00 . A A . 119 TRP CE2  1 1 
        2  4241 1 1 119 TRP CE3  C  12.100   7.651  10.027 1.00 . A A . 119 TRP CE3  1 1 
        2  4242 1 1 119 TRP CG   C  12.871   6.355  12.153 1.00 . A A . 119 TRP CG   1 1 
        2  4243 1 1 119 TRP CH2  C  13.448   7.133   8.084 1.00 . A A . 119 TRP CH2  1 1 
        2  4244 1 1 119 TRP CZ2  C  14.232   6.266   8.797 1.00 . A A . 119 TRP CZ2  1 1 
        2  4245 1 1 119 TRP CZ3  C  12.392   7.822   8.688 1.00 . A A . 119 TRP CZ3  1 1 
        2  4246 1 1 119 TRP H    H  10.890   7.587  15.383 1.00 . A A . 119 TRP H    1 1 
        2  4247 1 1 119 TRP HA   H  13.393   7.976  14.247 1.00 . A A . 119 TRP HA   1 1 
        2  4248 1 1 119 TRP HB2  H  11.840   6.003  13.948 1.00 . A A . 119 TRP HB2  1 1 
        2  4249 1 1 119 TRP HB3  H  10.957   6.969  12.773 1.00 . A A . 119 TRP HB3  1 1 
        2  4250 1 1 119 TRP HD1  H  14.155   4.970  13.212 1.00 . A A . 119 TRP HD1  1 1 
        2  4251 1 1 119 TRP HE1  H  15.316   4.707  10.928 1.00 . A A . 119 TRP HE1  1 1 
        2  4252 1 1 119 TRP HE3  H  11.280   8.193  10.476 1.00 . A A . 119 TRP HE3  1 1 
        2  4253 1 1 119 TRP HH2  H  13.641   7.298   7.034 1.00 . A A . 119 TRP HH2  1 1 
        2  4254 1 1 119 TRP HZ2  H  15.043   5.741   8.316 1.00 . A A . 119 TRP HZ2  1 1 
        2  4255 1 1 119 TRP HZ3  H  11.799   8.498   8.091 1.00 . A A . 119 TRP HZ3  1 1 
        2  4256 1 1 119 TRP N    N  11.564   8.262  15.158 1.00 . A A . 119 TRP N    1 1 
        2  4257 1 1 119 TRP NE1  N  14.544   5.302  11.087 1.00 . A A . 119 TRP NE1  1 1 
        2  4258 1 1 119 TRP O    O  13.248   9.759  12.470 1.00 . A A . 119 TRP O    1 1 
        2  4259 1 1 120 VAL C    C  11.495  12.142  12.309 1.00 . A A . 120 VAL C    1 1 
        2  4260 1 1 120 VAL CA   C  10.780  10.861  11.877 1.00 . A A . 120 VAL CA   1 1 
        2  4261 1 1 120 VAL CB   C   9.265  11.128  11.691 1.00 . A A . 120 VAL CB   1 1 
        2  4262 1 1 120 VAL CG1  C   8.605  11.638  12.965 1.00 . A A . 120 VAL CG1  1 1 
        2  4263 1 1 120 VAL CG2  C   9.033  12.091  10.541 1.00 . A A . 120 VAL CG2  1 1 
        2  4264 1 1 120 VAL H    H  10.270   9.398  13.326 1.00 . A A . 120 VAL H    1 1 
        2  4265 1 1 120 VAL HA   H  11.182  10.554  10.922 1.00 . A A . 120 VAL HA   1 1 
        2  4266 1 1 120 VAL HB   H   8.798  10.192  11.437 1.00 . A A . 120 VAL HB   1 1 
        2  4267 1 1 120 VAL HG11 H   7.562  11.846  12.774 1.00 . A A . 120 VAL HG11 1 1 
        2  4268 1 1 120 VAL HG12 H   9.099  12.542  13.288 1.00 . A A . 120 VAL HG12 1 1 
        2  4269 1 1 120 VAL HG13 H   8.685  10.888  13.739 1.00 . A A . 120 VAL HG13 1 1 
        2  4270 1 1 120 VAL HG21 H   9.526  13.029  10.753 1.00 . A A . 120 VAL HG21 1 1 
        2  4271 1 1 120 VAL HG22 H   7.973  12.260  10.421 1.00 . A A . 120 VAL HG22 1 1 
        2  4272 1 1 120 VAL HG23 H   9.437  11.670   9.632 1.00 . A A . 120 VAL HG23 1 1 
        2  4273 1 1 120 VAL N    N  11.024   9.774  12.819 1.00 . A A . 120 VAL N    1 1 
        2  4274 1 1 120 VAL O    O  12.126  12.816  11.492 1.00 . A A . 120 VAL O    1 1 
        2  4275 1 1 121 ASP C    C  13.569  13.438  14.221 1.00 . A A . 121 ASP C    1 1 
        2  4276 1 1 121 ASP CA   C  12.060  13.643  14.146 1.00 . A A . 121 ASP CA   1 1 
        2  4277 1 1 121 ASP CB   C  11.505  13.967  15.537 1.00 . A A . 121 ASP CB   1 1 
        2  4278 1 1 121 ASP CG   C  12.214  15.142  16.182 1.00 . A A . 121 ASP CG   1 1 
        2  4279 1 1 121 ASP H    H  10.878  11.882  14.187 1.00 . A A . 121 ASP H    1 1 
        2  4280 1 1 121 ASP HA   H  11.856  14.472  13.487 1.00 . A A . 121 ASP HA   1 1 
        2  4281 1 1 121 ASP HB2  H  10.457  14.207  15.452 1.00 . A A . 121 ASP HB2  1 1 
        2  4282 1 1 121 ASP HB3  H  11.623  13.103  16.176 1.00 . A A . 121 ASP HB3  1 1 
        2  4283 1 1 121 ASP N    N  11.402  12.460  13.593 1.00 . A A . 121 ASP N    1 1 
        2  4284 1 1 121 ASP O    O  14.347  14.359  13.972 1.00 . A A . 121 ASP O    1 1 
        2  4285 1 1 121 ASP OD1  O  11.937  16.298  15.793 1.00 . A A . 121 ASP OD1  1 1 
        2  4286 1 1 121 ASP OD2  O  13.053  14.916  17.080 1.00 . A A . 121 ASP OD2  1 1 
        2  4287 1 1 122 ASP C    C  16.106  12.013  13.360 1.00 . A A . 122 ASP C    1 1 
        2  4288 1 1 122 ASP CA   C  15.376  11.862  14.690 1.00 . A A . 122 ASP CA   1 1 
        2  4289 1 1 122 ASP CB   C  15.510  10.423  15.200 1.00 . A A . 122 ASP CB   1 1 
        2  4290 1 1 122 ASP CG   C  16.952   9.977  15.329 1.00 . A A . 122 ASP CG   1 1 
        2  4291 1 1 122 ASP H    H  13.286  11.531  14.742 1.00 . A A . 122 ASP H    1 1 
        2  4292 1 1 122 ASP HA   H  15.822  12.533  15.410 1.00 . A A . 122 ASP HA   1 1 
        2  4293 1 1 122 ASP HB2  H  15.044  10.350  16.171 1.00 . A A . 122 ASP HB2  1 1 
        2  4294 1 1 122 ASP HB3  H  15.006   9.758  14.515 1.00 . A A . 122 ASP HB3  1 1 
        2  4295 1 1 122 ASP N    N  13.966  12.217  14.561 1.00 . A A . 122 ASP N    1 1 
        2  4296 1 1 122 ASP O    O  17.144  12.677  13.281 1.00 . A A . 122 ASP O    1 1 
        2  4297 1 1 122 ASP OD1  O  17.567  10.235  16.384 1.00 . A A . 122 ASP OD1  1 1 
        2  4298 1 1 122 ASP OD2  O  17.474   9.352  14.379 1.00 . A A . 122 ASP OD2  1 1 
        2  4299 1 1 123 ASN C    C  15.938  12.801  10.348 1.00 . A A . 123 ASN C    1 1 
        2  4300 1 1 123 ASN CA   C  16.188  11.443  11.003 1.00 . A A . 123 ASN CA   1 1 
        2  4301 1 1 123 ASN CB   C  15.642  10.314  10.130 1.00 . A A . 123 ASN CB   1 1 
        2  4302 1 1 123 ASN CG   C  16.661   9.805   9.130 1.00 . A A . 123 ASN CG   1 1 
        2  4303 1 1 123 ASN H    H  14.743  10.874  12.435 1.00 . A A . 123 ASN H    1 1 
        2  4304 1 1 123 ASN HA   H  17.252  11.308  11.132 1.00 . A A . 123 ASN HA   1 1 
        2  4305 1 1 123 ASN HB2  H  15.344   9.490  10.763 1.00 . A A . 123 ASN HB2  1 1 
        2  4306 1 1 123 ASN HB3  H  14.780  10.674   9.587 1.00 . A A . 123 ASN HB3  1 1 
        2  4307 1 1 123 ASN HD21 H  15.902   7.976   9.251 1.00 . A A . 123 ASN HD21 1 1 
        2  4308 1 1 123 ASN HD22 H  17.239   8.166   8.180 1.00 . A A . 123 ASN HD22 1 1 
        2  4309 1 1 123 ASN N    N  15.569  11.394  12.316 1.00 . A A . 123 ASN N    1 1 
        2  4310 1 1 123 ASN ND2  N  16.594   8.521   8.823 1.00 . A A . 123 ASN ND2  1 1 
        2  4311 1 1 123 ASN O    O  16.813  13.352   9.678 1.00 . A A . 123 ASN O    1 1 
        2  4312 1 1 123 ASN OD1  O  17.513  10.552   8.653 1.00 . A A . 123 ASN OD1  1 1 
        2  4313 1 1 124 GLY C    C  13.885  14.699   8.671 1.00 . A A . 124 GLY C    1 1 
        2  4314 1 1 124 GLY CA   C  14.439  14.682  10.085 1.00 . A A . 124 GLY CA   1 1 
        2  4315 1 1 124 GLY H    H  14.062  12.835  11.053 1.00 . A A . 124 GLY H    1 1 
        2  4316 1 1 124 GLY HA2  H  13.712  15.130  10.747 1.00 . A A . 124 GLY HA2  1 1 
        2  4317 1 1 124 GLY HA3  H  15.343  15.273  10.111 1.00 . A A . 124 GLY HA3  1 1 
        2  4318 1 1 124 GLY N    N  14.746  13.346  10.564 1.00 . A A . 124 GLY N    1 1 
        2  4319 1 1 124 GLY O    O  14.507  15.255   7.766 1.00 . A A . 124 GLY O    1 1 
        2  4320 1 1 125 PHE C    C  10.664  14.640   7.246 1.00 . A A . 125 PHE C    1 1 
        2  4321 1 1 125 PHE CA   C  12.081  14.081   7.171 1.00 . A A . 125 PHE CA   1 1 
        2  4322 1 1 125 PHE CB   C  12.048  12.669   6.610 1.00 . A A . 125 PHE CB   1 1 
        2  4323 1 1 125 PHE CD1  C  13.964  12.809   4.996 1.00 . A A . 125 PHE CD1  1 1 
        2  4324 1 1 125 PHE CD2  C  14.022  11.121   6.677 1.00 . A A . 125 PHE CD2  1 1 
        2  4325 1 1 125 PHE CE1  C  15.178  12.370   4.505 1.00 . A A . 125 PHE CE1  1 1 
        2  4326 1 1 125 PHE CE2  C  15.236  10.679   6.192 1.00 . A A . 125 PHE CE2  1 1 
        2  4327 1 1 125 PHE CG   C  13.372  12.191   6.086 1.00 . A A . 125 PHE CG   1 1 
        2  4328 1 1 125 PHE CZ   C  15.816  11.303   5.105 1.00 . A A . 125 PHE CZ   1 1 
        2  4329 1 1 125 PHE H    H  12.280  13.636   9.217 1.00 . A A . 125 PHE H    1 1 
        2  4330 1 1 125 PHE HA   H  12.665  14.704   6.510 1.00 . A A . 125 PHE HA   1 1 
        2  4331 1 1 125 PHE HB2  H  11.736  11.993   7.389 1.00 . A A . 125 PHE HB2  1 1 
        2  4332 1 1 125 PHE HB3  H  11.335  12.631   5.811 1.00 . A A . 125 PHE HB3  1 1 
        2  4333 1 1 125 PHE HD1  H  13.467  13.646   4.528 1.00 . A A . 125 PHE HD1  1 1 
        2  4334 1 1 125 PHE HD2  H  13.569  10.631   7.527 1.00 . A A . 125 PHE HD2  1 1 
        2  4335 1 1 125 PHE HE1  H  15.628  12.861   3.655 1.00 . A A . 125 PHE HE1  1 1 
        2  4336 1 1 125 PHE HE2  H  15.734   9.843   6.663 1.00 . A A . 125 PHE HE2  1 1 
        2  4337 1 1 125 PHE HZ   H  16.765  10.957   4.725 1.00 . A A . 125 PHE HZ   1 1 
        2  4338 1 1 125 PHE N    N  12.721  14.090   8.474 1.00 . A A . 125 PHE N    1 1 
        2  4339 1 1 125 PHE O    O  10.010  14.558   8.285 1.00 . A A . 125 PHE O    1 1 
        2  4340 1 1 126 ASP C    C   8.156  15.349   4.794 1.00 . A A . 126 ASP C    1 1 
        2  4341 1 1 126 ASP CA   C   8.883  15.815   6.054 1.00 . A A . 126 ASP CA   1 1 
        2  4342 1 1 126 ASP CB   C   9.053  17.338   6.041 1.00 . A A . 126 ASP CB   1 1 
        2  4343 1 1 126 ASP CG   C   7.740  18.096   6.034 1.00 . A A . 126 ASP CG   1 1 
        2  4344 1 1 126 ASP H    H  10.752  15.148   5.319 1.00 . A A . 126 ASP H    1 1 
        2  4345 1 1 126 ASP HA   H   8.312  15.524   6.924 1.00 . A A . 126 ASP HA   1 1 
        2  4346 1 1 126 ASP HB2  H   9.607  17.634   6.918 1.00 . A A . 126 ASP HB2  1 1 
        2  4347 1 1 126 ASP HB3  H   9.613  17.619   5.160 1.00 . A A . 126 ASP HB3  1 1 
        2  4348 1 1 126 ASP N    N  10.196  15.179   6.129 1.00 . A A . 126 ASP N    1 1 
        2  4349 1 1 126 ASP O    O   8.779  15.183   3.746 1.00 . A A . 126 ASP O    1 1 
        2  4350 1 1 126 ASP OD1  O   7.153  18.274   4.947 1.00 . A A . 126 ASP OD1  1 1 
        2  4351 1 1 126 ASP OD2  O   7.305  18.545   7.117 1.00 . A A . 126 ASP OD2  1 1 
        2  4352 1 1 127 LEU C    C   4.744  15.350   3.667 1.00 . A A . 127 LEU C    1 1 
        2  4353 1 1 127 LEU CA   C   6.077  14.616   3.767 1.00 . A A . 127 LEU CA   1 1 
        2  4354 1 1 127 LEU CB   C   5.834  13.114   3.938 1.00 . A A . 127 LEU CB   1 1 
        2  4355 1 1 127 LEU CD1  C   6.685  12.440   1.680 1.00 . A A . 127 LEU CD1  1 1 
        2  4356 1 1 127 LEU CD2  C   5.233  10.885   2.993 1.00 . A A . 127 LEU CD2  1 1 
        2  4357 1 1 127 LEU CG   C   5.525  12.338   2.660 1.00 . A A . 127 LEU CG   1 1 
        2  4358 1 1 127 LEU H    H   6.393  15.317   5.743 1.00 . A A . 127 LEU H    1 1 
        2  4359 1 1 127 LEU HA   H   6.645  14.787   2.864 1.00 . A A . 127 LEU HA   1 1 
        2  4360 1 1 127 LEU HB2  H   6.710  12.681   4.389 1.00 . A A . 127 LEU HB2  1 1 
        2  4361 1 1 127 LEU HB3  H   5.004  12.983   4.615 1.00 . A A . 127 LEU HB3  1 1 
        2  4362 1 1 127 LEU HD11 H   6.450  11.887   0.783 1.00 . A A . 127 LEU HD11 1 1 
        2  4363 1 1 127 LEU HD12 H   7.577  12.030   2.133 1.00 . A A . 127 LEU HD12 1 1 
        2  4364 1 1 127 LEU HD13 H   6.855  13.477   1.430 1.00 . A A . 127 LEU HD13 1 1 
        2  4365 1 1 127 LEU HD21 H   6.096  10.444   3.471 1.00 . A A . 127 LEU HD21 1 1 
        2  4366 1 1 127 LEU HD22 H   5.011  10.345   2.085 1.00 . A A . 127 LEU HD22 1 1 
        2  4367 1 1 127 LEU HD23 H   4.387  10.830   3.661 1.00 . A A . 127 LEU HD23 1 1 
        2  4368 1 1 127 LEU HG   H   4.647  12.758   2.190 1.00 . A A . 127 LEU HG   1 1 
        2  4369 1 1 127 LEU N    N   6.851  15.127   4.895 1.00 . A A . 127 LEU N    1 1 
        2  4370 1 1 127 LEU O    O   4.308  15.981   4.628 1.00 . A A . 127 LEU O    1 1 
        2  4371 1 1 128 SER C    C   1.688  15.138   2.991 1.00 . A A . 128 SER C    1 1 
        2  4372 1 1 128 SER CA   C   2.810  15.918   2.305 1.00 . A A . 128 SER CA   1 1 
        2  4373 1 1 128 SER CB   C   2.513  16.064   0.809 1.00 . A A . 128 SER CB   1 1 
        2  4374 1 1 128 SER H    H   4.515  14.783   1.758 1.00 . A A . 128 SER H    1 1 
        2  4375 1 1 128 SER HA   H   2.866  16.902   2.748 1.00 . A A . 128 SER HA   1 1 
        2  4376 1 1 128 SER HB2  H   3.356  16.530   0.322 1.00 . A A . 128 SER HB2  1 1 
        2  4377 1 1 128 SER HB3  H   2.346  15.086   0.380 1.00 . A A . 128 SER HB3  1 1 
        2  4378 1 1 128 SER HG   H   0.802  16.844   1.375 1.00 . A A . 128 SER HG   1 1 
        2  4379 1 1 128 SER N    N   4.100  15.269   2.507 1.00 . A A . 128 SER N    1 1 
        2  4380 1 1 128 SER O    O   0.636  15.697   3.301 1.00 . A A . 128 SER O    1 1 
        2  4381 1 1 128 SER OG   O   1.361  16.861   0.586 1.00 . A A . 128 SER OG   1 1 
        2  4382 1 1 129 GLY C    C   0.657  11.706   3.242 1.00 . A A . 129 GLY C    1 1 
        2  4383 1 1 129 GLY CA   C   0.897  13.050   3.902 1.00 . A A . 129 GLY CA   1 1 
        2  4384 1 1 129 GLY H    H   2.767  13.451   2.976 1.00 . A A . 129 GLY H    1 1 
        2  4385 1 1 129 GLY HA2  H   1.207  12.881   4.921 1.00 . A A . 129 GLY HA2  1 1 
        2  4386 1 1 129 GLY HA3  H  -0.030  13.604   3.909 1.00 . A A . 129 GLY HA3  1 1 
        2  4387 1 1 129 GLY N    N   1.912  13.851   3.235 1.00 . A A . 129 GLY N    1 1 
        2  4388 1 1 129 GLY O    O  -0.460  11.187   3.274 1.00 . A A . 129 GLY O    1 1 
        2  4389 1 1 130 GLU C    C   1.793   8.707   2.983 1.00 . A A . 130 GLU C    1 1 
        2  4390 1 1 130 GLU CA   C   1.595   9.845   1.986 1.00 . A A . 130 GLU CA   1 1 
        2  4391 1 1 130 GLU CB   C   2.656   9.728   0.885 1.00 . A A . 130 GLU CB   1 1 
        2  4392 1 1 130 GLU CD   C   1.440  11.042  -0.897 1.00 . A A . 130 GLU CD   1 1 
        2  4393 1 1 130 GLU CG   C   2.700  10.909  -0.073 1.00 . A A . 130 GLU CG   1 1 
        2  4394 1 1 130 GLU H    H   2.564  11.588   2.676 1.00 . A A . 130 GLU H    1 1 
        2  4395 1 1 130 GLU HA   H   0.612   9.768   1.546 1.00 . A A . 130 GLU HA   1 1 
        2  4396 1 1 130 GLU HB2  H   3.626   9.636   1.348 1.00 . A A . 130 GLU HB2  1 1 
        2  4397 1 1 130 GLU HB3  H   2.459   8.834   0.309 1.00 . A A . 130 GLU HB3  1 1 
        2  4398 1 1 130 GLU HG2  H   2.829  11.813   0.501 1.00 . A A . 130 GLU HG2  1 1 
        2  4399 1 1 130 GLU HG3  H   3.540  10.783  -0.740 1.00 . A A . 130 GLU HG3  1 1 
        2  4400 1 1 130 GLU N    N   1.702  11.135   2.657 1.00 . A A . 130 GLU N    1 1 
        2  4401 1 1 130 GLU O    O   2.877   8.557   3.546 1.00 . A A . 130 GLU O    1 1 
        2  4402 1 1 130 GLU OE1  O   1.240  10.222  -1.821 1.00 . A A . 130 GLU OE1  1 1 
        2  4403 1 1 130 GLU OE2  O   0.650  11.959  -0.633 1.00 . A A . 130 GLU OE2  1 1 
        2  4404 1 1 131 ALA C    C   0.244   5.539   3.347 1.00 . A A . 131 ALA C    1 1 
        2  4405 1 1 131 ALA CA   C   0.874   6.734   4.056 1.00 . A A . 131 ALA CA   1 1 
        2  4406 1 1 131 ALA CB   C   0.218   6.972   5.405 1.00 . A A . 131 ALA CB   1 1 
        2  4407 1 1 131 ALA H    H  -0.134   8.146   2.826 1.00 . A A . 131 ALA H    1 1 
        2  4408 1 1 131 ALA HA   H   1.930   6.536   4.223 1.00 . A A . 131 ALA HA   1 1 
        2  4409 1 1 131 ALA HB1  H   0.355   6.102   6.031 1.00 . A A . 131 ALA HB1  1 1 
        2  4410 1 1 131 ALA HB2  H  -0.837   7.153   5.268 1.00 . A A . 131 ALA HB2  1 1 
        2  4411 1 1 131 ALA HB3  H   0.672   7.830   5.878 1.00 . A A . 131 ALA HB3  1 1 
        2  4412 1 1 131 ALA N    N   0.750   7.922   3.218 1.00 . A A . 131 ALA N    1 1 
        2  4413 1 1 131 ALA O    O  -0.865   5.637   2.834 1.00 . A A . 131 ALA O    1 1 
        2  4414 1 1 132 TYR C    C   0.867   1.978   3.353 1.00 . A A . 132 TYR C    1 1 
        2  4415 1 1 132 TYR CA   C   0.428   3.241   2.629 1.00 . A A . 132 TYR CA   1 1 
        2  4416 1 1 132 TYR CB   C   0.858   3.187   1.153 1.00 . A A . 132 TYR CB   1 1 
        2  4417 1 1 132 TYR CD1  C   3.245   3.979   0.858 1.00 . A A . 132 TYR CD1  1 1 
        2  4418 1 1 132 TYR CD2  C   2.822   1.633   0.801 1.00 . A A . 132 TYR CD2  1 1 
        2  4419 1 1 132 TYR CE1  C   4.593   3.741   0.662 1.00 . A A . 132 TYR CE1  1 1 
        2  4420 1 1 132 TYR CE2  C   4.166   1.388   0.603 1.00 . A A . 132 TYR CE2  1 1 
        2  4421 1 1 132 TYR CG   C   2.336   2.930   0.933 1.00 . A A . 132 TYR CG   1 1 
        2  4422 1 1 132 TYR CZ   C   5.047   2.445   0.535 1.00 . A A . 132 TYR CZ   1 1 
        2  4423 1 1 132 TYR H    H   1.844   4.395   3.707 1.00 . A A . 132 TYR H    1 1 
        2  4424 1 1 132 TYR HA   H  -0.649   3.300   2.673 1.00 . A A . 132 TYR HA   1 1 
        2  4425 1 1 132 TYR HB2  H   0.312   2.395   0.661 1.00 . A A . 132 TYR HB2  1 1 
        2  4426 1 1 132 TYR HB3  H   0.610   4.128   0.683 1.00 . A A . 132 TYR HB3  1 1 
        2  4427 1 1 132 TYR HD1  H   2.889   4.994   0.959 1.00 . A A . 132 TYR HD1  1 1 
        2  4428 1 1 132 TYR HD2  H   2.128   0.805   0.854 1.00 . A A . 132 TYR HD2  1 1 
        2  4429 1 1 132 TYR HE1  H   5.284   4.568   0.604 1.00 . A A . 132 TYR HE1  1 1 
        2  4430 1 1 132 TYR HE2  H   4.521   0.374   0.503 1.00 . A A . 132 TYR HE2  1 1 
        2  4431 1 1 132 TYR HH   H   6.895   2.825   0.886 1.00 . A A . 132 TYR HH   1 1 
        2  4432 1 1 132 TYR N    N   0.955   4.427   3.286 1.00 . A A . 132 TYR N    1 1 
        2  4433 1 1 132 TYR O    O   2.000   1.880   3.813 1.00 . A A . 132 TYR O    1 1 
        2  4434 1 1 132 TYR OH   O   6.390   2.205   0.352 1.00 . A A . 132 TYR OH   1 1 
        2  4435 1 1 133 GLU C    C   0.139  -1.384   3.024 1.00 . A A . 133 GLU C    1 1 
        2  4436 1 1 133 GLU CA   C   0.302  -0.267   4.048 1.00 . A A . 133 GLU CA   1 1 
        2  4437 1 1 133 GLU CB   C  -0.548  -0.521   5.298 1.00 . A A . 133 GLU CB   1 1 
        2  4438 1 1 133 GLU CD   C  -2.806  -0.436   6.409 1.00 . A A . 133 GLU CD   1 1 
        2  4439 1 1 133 GLU CG   C  -2.040  -0.302   5.108 1.00 . A A . 133 GLU CG   1 1 
        2  4440 1 1 133 GLU H    H  -0.939   1.166   3.110 1.00 . A A . 133 GLU H    1 1 
        2  4441 1 1 133 GLU HA   H   1.342  -0.226   4.339 1.00 . A A . 133 GLU HA   1 1 
        2  4442 1 1 133 GLU HB2  H  -0.398  -1.543   5.611 1.00 . A A . 133 GLU HB2  1 1 
        2  4443 1 1 133 GLU HB3  H  -0.209   0.136   6.085 1.00 . A A . 133 GLU HB3  1 1 
        2  4444 1 1 133 GLU HG2  H  -2.201   0.690   4.711 1.00 . A A . 133 GLU HG2  1 1 
        2  4445 1 1 133 GLU HG3  H  -2.414  -1.035   4.409 1.00 . A A . 133 GLU HG3  1 1 
        2  4446 1 1 133 GLU N    N  -0.028   1.015   3.451 1.00 . A A . 133 GLU N    1 1 
        2  4447 1 1 133 GLU O    O  -0.616  -1.251   2.062 1.00 . A A . 133 GLU O    1 1 
        2  4448 1 1 133 GLU OE1  O  -2.771  -1.532   7.007 1.00 . A A . 133 GLU OE1  1 1 
        2  4449 1 1 133 GLU OE2  O  -3.459   0.546   6.834 1.00 . A A . 133 GLU OE2  1 1 
        2  4450 1 1 134 ILE C    C   0.215  -4.801   2.885 1.00 . A A . 134 ILE C    1 1 
        2  4451 1 1 134 ILE CA   C   0.877  -3.575   2.270 1.00 . A A . 134 ILE CA   1 1 
        2  4452 1 1 134 ILE CB   C   2.318  -3.943   1.848 1.00 . A A . 134 ILE CB   1 1 
        2  4453 1 1 134 ILE CD1  C   4.517  -2.947   1.012 1.00 . A A . 134 ILE CD1  1 1 
        2  4454 1 1 134 ILE CG1  C   3.064  -2.694   1.362 1.00 . A A . 134 ILE CG1  1 1 
        2  4455 1 1 134 ILE CG2  C   2.298  -5.014   0.763 1.00 . A A . 134 ILE CG2  1 1 
        2  4456 1 1 134 ILE H    H   1.435  -2.528   4.025 1.00 . A A . 134 ILE H    1 1 
        2  4457 1 1 134 ILE HA   H   0.327  -3.272   1.392 1.00 . A A . 134 ILE HA   1 1 
        2  4458 1 1 134 ILE HB   H   2.830  -4.346   2.709 1.00 . A A . 134 ILE HB   1 1 
        2  4459 1 1 134 ILE HD11 H   4.574  -3.699   0.240 1.00 . A A . 134 ILE HD11 1 1 
        2  4460 1 1 134 ILE HD12 H   5.043  -3.290   1.889 1.00 . A A . 134 ILE HD12 1 1 
        2  4461 1 1 134 ILE HD13 H   4.966  -2.032   0.657 1.00 . A A . 134 ILE HD13 1 1 
        2  4462 1 1 134 ILE HG12 H   2.574  -2.310   0.481 1.00 . A A . 134 ILE HG12 1 1 
        2  4463 1 1 134 ILE HG13 H   3.037  -1.944   2.140 1.00 . A A . 134 ILE HG13 1 1 
        2  4464 1 1 134 ILE HG21 H   1.770  -4.643  -0.103 1.00 . A A . 134 ILE HG21 1 1 
        2  4465 1 1 134 ILE HG22 H   1.799  -5.896   1.138 1.00 . A A . 134 ILE HG22 1 1 
        2  4466 1 1 134 ILE HG23 H   3.312  -5.267   0.487 1.00 . A A . 134 ILE HG23 1 1 
        2  4467 1 1 134 ILE N    N   0.877  -2.467   3.217 1.00 . A A . 134 ILE N    1 1 
        2  4468 1 1 134 ILE O    O   0.667  -5.296   3.915 1.00 . A A . 134 ILE O    1 1 
        2  4469 1 1 135 TYR C    C  -1.140  -7.730   2.078 1.00 . A A . 135 TYR C    1 1 
        2  4470 1 1 135 TYR CA   C  -1.561  -6.444   2.775 1.00 . A A . 135 TYR CA   1 1 
        2  4471 1 1 135 TYR CB   C  -3.071  -6.247   2.637 1.00 . A A . 135 TYR CB   1 1 
        2  4472 1 1 135 TYR CD1  C  -3.522  -5.359   4.956 1.00 . A A . 135 TYR CD1  1 1 
        2  4473 1 1 135 TYR CD2  C  -4.294  -4.088   3.094 1.00 . A A . 135 TYR CD2  1 1 
        2  4474 1 1 135 TYR CE1  C  -4.045  -4.420   5.821 1.00 . A A . 135 TYR CE1  1 1 
        2  4475 1 1 135 TYR CE2  C  -4.823  -3.145   3.953 1.00 . A A . 135 TYR CE2  1 1 
        2  4476 1 1 135 TYR CG   C  -3.638  -5.210   3.578 1.00 . A A . 135 TYR CG   1 1 
        2  4477 1 1 135 TYR CZ   C  -4.696  -3.317   5.315 1.00 . A A . 135 TYR CZ   1 1 
        2  4478 1 1 135 TYR H    H  -1.117  -4.904   1.388 1.00 . A A . 135 TYR H    1 1 
        2  4479 1 1 135 TYR HA   H  -1.318  -6.525   3.824 1.00 . A A . 135 TYR HA   1 1 
        2  4480 1 1 135 TYR HB2  H  -3.296  -5.937   1.628 1.00 . A A . 135 TYR HB2  1 1 
        2  4481 1 1 135 TYR HB3  H  -3.569  -7.186   2.838 1.00 . A A . 135 TYR HB3  1 1 
        2  4482 1 1 135 TYR HD1  H  -3.009  -6.222   5.353 1.00 . A A . 135 TYR HD1  1 1 
        2  4483 1 1 135 TYR HD2  H  -4.390  -3.956   2.028 1.00 . A A . 135 TYR HD2  1 1 
        2  4484 1 1 135 TYR HE1  H  -3.945  -4.554   6.889 1.00 . A A . 135 TYR HE1  1 1 
        2  4485 1 1 135 TYR HE2  H  -5.331  -2.278   3.557 1.00 . A A . 135 TYR HE2  1 1 
        2  4486 1 1 135 TYR HH   H  -4.491  -2.003   6.703 1.00 . A A . 135 TYR HH   1 1 
        2  4487 1 1 135 TYR N    N  -0.836  -5.300   2.246 1.00 . A A . 135 TYR N    1 1 
        2  4488 1 1 135 TYR O    O  -1.370  -7.912   0.884 1.00 . A A . 135 TYR O    1 1 
        2  4489 1 1 135 TYR OH   O  -5.216  -2.380   6.174 1.00 . A A . 135 TYR OH   1 1 
        2  4490 1 1 136 LEU C    C  -0.412 -10.993   3.344 1.00 . A A . 136 LEU C    1 1 
        2  4491 1 1 136 LEU CA   C  -0.094  -9.913   2.319 1.00 . A A . 136 LEU CA   1 1 
        2  4492 1 1 136 LEU CB   C   1.408  -9.924   1.981 1.00 . A A . 136 LEU CB   1 1 
        2  4493 1 1 136 LEU CD1  C   3.772 -10.151   2.787 1.00 . A A . 136 LEU CD1  1 1 
        2  4494 1 1 136 LEU CD2  C   2.399  -8.225   3.558 1.00 . A A . 136 LEU CD2  1 1 
        2  4495 1 1 136 LEU CG   C   2.371  -9.694   3.157 1.00 . A A . 136 LEU CG   1 1 
        2  4496 1 1 136 LEU H    H  -0.319  -8.390   3.770 1.00 . A A . 136 LEU H    1 1 
        2  4497 1 1 136 LEU HA   H  -0.661 -10.111   1.421 1.00 . A A . 136 LEU HA   1 1 
        2  4498 1 1 136 LEU HB2  H   1.645 -10.881   1.538 1.00 . A A . 136 LEU HB2  1 1 
        2  4499 1 1 136 LEU HB3  H   1.592  -9.157   1.245 1.00 . A A . 136 LEU HB3  1 1 
        2  4500 1 1 136 LEU HD11 H   4.427 -10.021   3.635 1.00 . A A . 136 LEU HD11 1 1 
        2  4501 1 1 136 LEU HD12 H   4.136  -9.562   1.958 1.00 . A A . 136 LEU HD12 1 1 
        2  4502 1 1 136 LEU HD13 H   3.750 -11.194   2.506 1.00 . A A . 136 LEU HD13 1 1 
        2  4503 1 1 136 LEU HD21 H   3.111  -8.085   4.358 1.00 . A A . 136 LEU HD21 1 1 
        2  4504 1 1 136 LEU HD22 H   1.417  -7.925   3.891 1.00 . A A . 136 LEU HD22 1 1 
        2  4505 1 1 136 LEU HD23 H   2.690  -7.627   2.707 1.00 . A A . 136 LEU HD23 1 1 
        2  4506 1 1 136 LEU HG   H   2.042 -10.273   4.009 1.00 . A A . 136 LEU HG   1 1 
        2  4507 1 1 136 LEU N    N  -0.511  -8.615   2.834 1.00 . A A . 136 LEU N    1 1 
        2  4508 1 1 136 LEU O    O   0.157 -12.084   3.324 1.00 . A A . 136 LEU O    1 1 
        2  4509 1 1 137 ASP C    C  -2.984 -12.317   5.026 1.00 . A A . 137 ASP C    1 1 
        2  4510 1 1 137 ASP CA   C  -1.697 -11.559   5.328 1.00 . A A . 137 ASP CA   1 1 
        2  4511 1 1 137 ASP CB   C  -1.869 -10.739   6.609 1.00 . A A . 137 ASP CB   1 1 
        2  4512 1 1 137 ASP CG   C  -3.098  -9.848   6.577 1.00 . A A . 137 ASP CG   1 1 
        2  4513 1 1 137 ASP H    H  -1.823  -9.826   4.136 1.00 . A A . 137 ASP H    1 1 
        2  4514 1 1 137 ASP HA   H  -0.893 -12.265   5.466 1.00 . A A . 137 ASP HA   1 1 
        2  4515 1 1 137 ASP HB2  H  -1.959 -11.411   7.449 1.00 . A A . 137 ASP HB2  1 1 
        2  4516 1 1 137 ASP HB3  H  -0.999 -10.112   6.747 1.00 . A A . 137 ASP HB3  1 1 
        2  4517 1 1 137 ASP N    N  -1.344 -10.677   4.228 1.00 . A A . 137 ASP N    1 1 
        2  4518 1 1 137 ASP O    O  -3.619 -12.102   3.990 1.00 . A A . 137 ASP O    1 1 
        2  4519 1 1 137 ASP OD1  O  -3.280  -9.115   5.583 1.00 . A A . 137 ASP OD1  1 1 
        2  4520 1 1 137 ASP OD2  O  -3.893  -9.893   7.538 1.00 . A A . 137 ASP OD2  1 1 
        2  4521 1 1 138 ASN C    C  -4.971 -14.495   7.225 1.00 . A A . 138 ASN C    1 1 
        2  4522 1 1 138 ASN CA   C  -4.616 -13.931   5.849 1.00 . A A . 138 ASN CA   1 1 
        2  4523 1 1 138 ASN CB   C  -4.563 -15.056   4.811 1.00 . A A . 138 ASN CB   1 1 
        2  4524 1 1 138 ASN CG   C  -5.927 -15.679   4.565 1.00 . A A . 138 ASN CG   1 1 
        2  4525 1 1 138 ASN H    H  -2.749 -13.407   6.677 1.00 . A A . 138 ASN H    1 1 
        2  4526 1 1 138 ASN HA   H  -5.376 -13.219   5.562 1.00 . A A . 138 ASN HA   1 1 
        2  4527 1 1 138 ASN HB2  H  -4.195 -14.657   3.875 1.00 . A A . 138 ASN HB2  1 1 
        2  4528 1 1 138 ASN HB3  H  -3.892 -15.828   5.156 1.00 . A A . 138 ASN HB3  1 1 
        2  4529 1 1 138 ASN HD21 H  -5.086 -17.424   4.124 1.00 . A A . 138 ASN HD21 1 1 
        2  4530 1 1 138 ASN HD22 H  -6.810 -17.377   4.044 1.00 . A A . 138 ASN HD22 1 1 
        2  4531 1 1 138 ASN N    N  -3.349 -13.218   5.928 1.00 . A A . 138 ASN N    1 1 
        2  4532 1 1 138 ASN ND2  N  -5.942 -16.953   4.210 1.00 . A A . 138 ASN ND2  1 1 
        2  4533 1 1 138 ASN O    O  -4.687 -15.657   7.528 1.00 . A A . 138 ASN O    1 1 
        2  4534 1 1 138 ASN OD1  O  -6.958 -15.017   4.684 1.00 . A A . 138 ASN OD1  1 1 
        2  4535 1 1 139 PRO C    C  -6.798 -15.229   9.573 1.00 . A A . 139 PRO C    1 1 
        2  4536 1 1 139 PRO CA   C  -5.902 -13.999   9.471 1.00 . A A . 139 PRO CA   1 1 
        2  4537 1 1 139 PRO CB   C  -6.654 -12.765   9.987 1.00 . A A . 139 PRO CB   1 1 
        2  4538 1 1 139 PRO CD   C  -5.912 -12.255   7.783 1.00 . A A . 139 PRO CD   1 1 
        2  4539 1 1 139 PRO CG   C  -7.001 -11.975   8.770 1.00 . A A . 139 PRO CG   1 1 
        2  4540 1 1 139 PRO HA   H  -5.017 -14.155  10.070 1.00 . A A . 139 PRO HA   1 1 
        2  4541 1 1 139 PRO HB2  H  -7.540 -13.079  10.519 1.00 . A A . 139 PRO HB2  1 1 
        2  4542 1 1 139 PRO HB3  H  -6.013 -12.203  10.649 1.00 . A A . 139 PRO HB3  1 1 
        2  4543 1 1 139 PRO HD2  H  -6.276 -12.160   6.774 1.00 . A A . 139 PRO HD2  1 1 
        2  4544 1 1 139 PRO HD3  H  -5.075 -11.595   7.949 1.00 . A A . 139 PRO HD3  1 1 
        2  4545 1 1 139 PRO HG2  H  -7.955 -12.299   8.379 1.00 . A A . 139 PRO HG2  1 1 
        2  4546 1 1 139 PRO HG3  H  -7.028 -10.922   9.009 1.00 . A A . 139 PRO HG3  1 1 
        2  4547 1 1 139 PRO N    N  -5.553 -13.646   8.087 1.00 . A A . 139 PRO N    1 1 
        2  4548 1 1 139 PRO O    O  -7.488 -15.589   8.619 1.00 . A A . 139 PRO O    1 1 
        2  4549 1 1 140 ALA C    C  -7.045 -18.302  10.400 1.00 . A A . 140 ALA C    1 1 
        2  4550 1 1 140 ALA CA   C  -7.569 -17.040  11.078 1.00 . A A . 140 ALA CA   1 1 
        2  4551 1 1 140 ALA CB   C  -9.038 -16.818  10.746 1.00 . A A . 140 ALA CB   1 1 
        2  4552 1 1 140 ALA H    H  -6.136 -15.526  11.431 1.00 . A A . 140 ALA H    1 1 
        2  4553 1 1 140 ALA HA   H  -7.497 -17.183  12.147 1.00 . A A . 140 ALA HA   1 1 
        2  4554 1 1 140 ALA HB1  H  -9.148 -16.681   9.680 1.00 . A A . 140 ALA HB1  1 1 
        2  4555 1 1 140 ALA HB2  H  -9.396 -15.940  11.261 1.00 . A A . 140 ALA HB2  1 1 
        2  4556 1 1 140 ALA HB3  H  -9.611 -17.679  11.058 1.00 . A A . 140 ALA HB3  1 1 
        2  4557 1 1 140 ALA N    N  -6.757 -15.864  10.747 1.00 . A A . 140 ALA N    1 1 
        2  4558 1 1 140 ALA O    O  -7.072 -19.386  10.986 1.00 . A A . 140 ALA O    1 1 
        2  4559 1 1 141 GLU C    C  -4.555 -19.494   8.740 1.00 . A A . 141 GLU C    1 1 
        2  4560 1 1 141 GLU CA   C  -6.038 -19.304   8.438 1.00 . A A . 141 GLU CA   1 1 
        2  4561 1 1 141 GLU CB   C  -6.250 -19.125   6.933 1.00 . A A . 141 GLU CB   1 1 
        2  4562 1 1 141 GLU CD   C  -6.012 -20.158   4.638 1.00 . A A . 141 GLU CD   1 1 
        2  4563 1 1 141 GLU CG   C  -5.934 -20.379   6.131 1.00 . A A . 141 GLU CG   1 1 
        2  4564 1 1 141 GLU H    H  -6.548 -17.268   8.767 1.00 . A A . 141 GLU H    1 1 
        2  4565 1 1 141 GLU HA   H  -6.575 -20.181   8.767 1.00 . A A . 141 GLU HA   1 1 
        2  4566 1 1 141 GLU HB2  H  -7.282 -18.858   6.752 1.00 . A A . 141 GLU HB2  1 1 
        2  4567 1 1 141 GLU HB3  H  -5.613 -18.328   6.581 1.00 . A A . 141 GLU HB3  1 1 
        2  4568 1 1 141 GLU HG2  H  -4.935 -20.707   6.376 1.00 . A A . 141 GLU HG2  1 1 
        2  4569 1 1 141 GLU HG3  H  -6.639 -21.152   6.400 1.00 . A A . 141 GLU HG3  1 1 
        2  4570 1 1 141 GLU N    N  -6.559 -18.162   9.178 1.00 . A A . 141 GLU N    1 1 
        2  4571 1 1 141 GLU O    O  -4.107 -20.600   9.045 1.00 . A A . 141 GLU O    1 1 
        2  4572 1 1 141 GLU OE1  O  -7.106 -20.327   4.058 1.00 . A A . 141 GLU OE1  1 1 
        2  4573 1 1 141 GLU OE2  O  -4.973 -19.822   4.033 1.00 . A A . 141 GLU OE2  1 1 
        2  4574 1 1 142 THR C    C  -2.126 -17.635  10.243 1.00 . A A . 142 THR C    1 1 
        2  4575 1 1 142 THR CA   C  -2.384 -18.450   8.975 1.00 . A A . 142 THR CA   1 1 
        2  4576 1 1 142 THR CB   C  -1.533 -17.921   7.793 1.00 . A A . 142 THR CB   1 1 
        2  4577 1 1 142 THR CG2  C  -1.663 -16.414   7.635 1.00 . A A . 142 THR CG2  1 1 
        2  4578 1 1 142 THR H    H  -4.208 -17.556   8.402 1.00 . A A . 142 THR H    1 1 
        2  4579 1 1 142 THR HA   H  -2.111 -19.482   9.159 1.00 . A A . 142 THR HA   1 1 
        2  4580 1 1 142 THR HB   H  -1.886 -18.388   6.885 1.00 . A A . 142 THR HB   1 1 
        2  4581 1 1 142 THR HG1  H  -0.079 -19.204   8.179 1.00 . A A . 142 THR HG1  1 1 
        2  4582 1 1 142 THR HG21 H  -1.326 -15.928   8.539 1.00 . A A . 142 THR HG21 1 1 
        2  4583 1 1 142 THR HG22 H  -2.696 -16.158   7.451 1.00 . A A . 142 THR HG22 1 1 
        2  4584 1 1 142 THR HG23 H  -1.057 -16.085   6.803 1.00 . A A . 142 THR HG23 1 1 
        2  4585 1 1 142 THR N    N  -3.801 -18.410   8.663 1.00 . A A . 142 THR N    1 1 
        2  4586 1 1 142 THR O    O  -2.927 -16.764  10.593 1.00 . A A . 142 THR O    1 1 
        2  4587 1 1 142 THR OG1  O  -0.153 -18.256   7.974 1.00 . A A . 142 THR OG1  1 1 
        2  4588 1 1 143 ALA C    C  -0.285 -15.836  12.002 1.00 . A A . 143 ALA C    1 1 
        2  4589 1 1 143 ALA CA   C  -0.757 -17.273  12.208 1.00 . A A . 143 ALA CA   1 1 
        2  4590 1 1 143 ALA CB   C   0.273 -18.069  12.990 1.00 . A A . 143 ALA CB   1 1 
        2  4591 1 1 143 ALA H    H  -0.398 -18.581  10.587 1.00 . A A . 143 ALA H    1 1 
        2  4592 1 1 143 ALA HA   H  -1.673 -17.258  12.781 1.00 . A A . 143 ALA HA   1 1 
        2  4593 1 1 143 ALA HB1  H  -0.086 -19.076  13.134 1.00 . A A . 143 ALA HB1  1 1 
        2  4594 1 1 143 ALA HB2  H   0.437 -17.602  13.951 1.00 . A A . 143 ALA HB2  1 1 
        2  4595 1 1 143 ALA HB3  H   1.202 -18.096  12.439 1.00 . A A . 143 ALA HB3  1 1 
        2  4596 1 1 143 ALA N    N  -1.036 -17.925  10.938 1.00 . A A . 143 ALA N    1 1 
        2  4597 1 1 143 ALA O    O   0.429 -15.537  11.043 1.00 . A A . 143 ALA O    1 1 
        2  4598 1 1 144 PRO C    C   1.163 -13.246  12.877 1.00 . A A . 144 PRO C    1 1 
        2  4599 1 1 144 PRO CA   C  -0.338 -13.505  12.818 1.00 . A A . 144 PRO CA   1 1 
        2  4600 1 1 144 PRO CB   C  -1.033 -12.889  14.035 1.00 . A A . 144 PRO CB   1 1 
        2  4601 1 1 144 PRO CD   C  -1.489 -15.225  14.103 1.00 . A A . 144 PRO CD   1 1 
        2  4602 1 1 144 PRO CG   C  -1.257 -14.025  14.970 1.00 . A A . 144 PRO CG   1 1 
        2  4603 1 1 144 PRO HA   H  -0.737 -13.066  11.916 1.00 . A A . 144 PRO HA   1 1 
        2  4604 1 1 144 PRO HB2  H  -0.396 -12.136  14.473 1.00 . A A . 144 PRO HB2  1 1 
        2  4605 1 1 144 PRO HB3  H  -1.965 -12.443  13.728 1.00 . A A . 144 PRO HB3  1 1 
        2  4606 1 1 144 PRO HD2  H  -1.145 -16.124  14.596 1.00 . A A . 144 PRO HD2  1 1 
        2  4607 1 1 144 PRO HD3  H  -2.535 -15.309  13.844 1.00 . A A . 144 PRO HD3  1 1 
        2  4608 1 1 144 PRO HG2  H  -0.384 -14.170  15.589 1.00 . A A . 144 PRO HG2  1 1 
        2  4609 1 1 144 PRO HG3  H  -2.125 -13.831  15.583 1.00 . A A . 144 PRO HG3  1 1 
        2  4610 1 1 144 PRO N    N  -0.675 -14.931  12.912 1.00 . A A . 144 PRO N    1 1 
        2  4611 1 1 144 PRO O    O   1.654 -12.251  12.346 1.00 . A A . 144 PRO O    1 1 
        2  4612 1 1 145 ASP C    C   4.019 -14.563  12.378 1.00 . A A . 145 ASP C    1 1 
        2  4613 1 1 145 ASP CA   C   3.336 -14.028  13.630 1.00 . A A . 145 ASP CA   1 1 
        2  4614 1 1 145 ASP CB   C   3.849 -14.763  14.872 1.00 . A A . 145 ASP CB   1 1 
        2  4615 1 1 145 ASP CG   C   3.711 -16.266  14.768 1.00 . A A . 145 ASP CG   1 1 
        2  4616 1 1 145 ASP H    H   1.442 -14.933  13.910 1.00 . A A . 145 ASP H    1 1 
        2  4617 1 1 145 ASP HA   H   3.567 -12.978  13.725 1.00 . A A . 145 ASP HA   1 1 
        2  4618 1 1 145 ASP HB2  H   4.893 -14.529  15.015 1.00 . A A . 145 ASP HB2  1 1 
        2  4619 1 1 145 ASP HB3  H   3.290 -14.428  15.736 1.00 . A A . 145 ASP HB3  1 1 
        2  4620 1 1 145 ASP N    N   1.890 -14.154  13.513 1.00 . A A . 145 ASP N    1 1 
        2  4621 1 1 145 ASP O    O   5.230 -14.411  12.201 1.00 . A A . 145 ASP O    1 1 
        2  4622 1 1 145 ASP OD1  O   2.568 -16.756  14.695 1.00 . A A . 145 ASP OD1  1 1 
        2  4623 1 1 145 ASP OD2  O   4.748 -16.963  14.777 1.00 . A A . 145 ASP OD2  1 1 
        2  4624 1 1 146 GLN C    C   3.501 -14.679   9.145 1.00 . A A . 146 GLN C    1 1 
        2  4625 1 1 146 GLN CA   C   3.756 -15.687  10.247 1.00 . A A . 146 GLN CA   1 1 
        2  4626 1 1 146 GLN CB   C   3.109 -17.022   9.887 1.00 . A A . 146 GLN CB   1 1 
        2  4627 1 1 146 GLN CD   C   2.850 -19.465  10.407 1.00 . A A . 146 GLN CD   1 1 
        2  4628 1 1 146 GLN CG   C   3.475 -18.153  10.829 1.00 . A A . 146 GLN CG   1 1 
        2  4629 1 1 146 GLN H    H   2.276 -15.270  11.696 1.00 . A A . 146 GLN H    1 1 
        2  4630 1 1 146 GLN HA   H   4.821 -15.826  10.358 1.00 . A A . 146 GLN HA   1 1 
        2  4631 1 1 146 GLN HB2  H   2.036 -16.904   9.903 1.00 . A A . 146 GLN HB2  1 1 
        2  4632 1 1 146 GLN HB3  H   3.417 -17.298   8.889 1.00 . A A . 146 GLN HB3  1 1 
        2  4633 1 1 146 GLN HE21 H   4.411 -19.870   9.239 1.00 . A A . 146 GLN HE21 1 1 
        2  4634 1 1 146 GLN HE22 H   3.146 -21.061   9.260 1.00 . A A . 146 GLN HE22 1 1 
        2  4635 1 1 146 GLN HG2  H   4.549 -18.265  10.842 1.00 . A A . 146 GLN HG2  1 1 
        2  4636 1 1 146 GLN HG3  H   3.125 -17.905  11.819 1.00 . A A . 146 GLN HG3  1 1 
        2  4637 1 1 146 GLN N    N   3.236 -15.177  11.503 1.00 . A A . 146 GLN N    1 1 
        2  4638 1 1 146 GLN NE2  N   3.537 -20.205   9.553 1.00 . A A . 146 GLN NE2  1 1 
        2  4639 1 1 146 GLN O    O   4.295 -14.542   8.212 1.00 . A A . 146 GLN O    1 1 
        2  4640 1 1 146 GLN OE1  O   1.749 -19.806  10.834 1.00 . A A . 146 GLN OE1  1 1 
        2  4641 1 1 147 LEU C    C   2.763 -11.652   8.609 1.00 . A A . 147 LEU C    1 1 
        2  4642 1 1 147 LEU CA   C   2.053 -12.959   8.283 1.00 . A A . 147 LEU CA   1 1 
        2  4643 1 1 147 LEU CB   C   0.529 -12.798   8.177 1.00 . A A . 147 LEU CB   1 1 
        2  4644 1 1 147 LEU CD1  C  -0.528 -11.138   9.751 1.00 . A A . 147 LEU CD1  1 1 
        2  4645 1 1 147 LEU CD2  C  -1.548 -13.392   9.450 1.00 . A A . 147 LEU CD2  1 1 
        2  4646 1 1 147 LEU CG   C  -0.246 -12.609   9.488 1.00 . A A . 147 LEU CG   1 1 
        2  4647 1 1 147 LEU H    H   1.811 -14.095  10.039 1.00 . A A . 147 LEU H    1 1 
        2  4648 1 1 147 LEU HA   H   2.426 -13.311   7.332 1.00 . A A . 147 LEU HA   1 1 
        2  4649 1 1 147 LEU HB2  H   0.328 -11.947   7.549 1.00 . A A . 147 LEU HB2  1 1 
        2  4650 1 1 147 LEU HB3  H   0.141 -13.679   7.687 1.00 . A A . 147 LEU HB3  1 1 
        2  4651 1 1 147 LEU HD11 H  -1.103 -10.731   8.931 1.00 . A A . 147 LEU HD11 1 1 
        2  4652 1 1 147 LEU HD12 H   0.403 -10.602   9.839 1.00 . A A . 147 LEU HD12 1 1 
        2  4653 1 1 147 LEU HD13 H  -1.092 -11.038  10.667 1.00 . A A . 147 LEU HD13 1 1 
        2  4654 1 1 147 LEU HD21 H  -1.333 -14.443   9.330 1.00 . A A . 147 LEU HD21 1 1 
        2  4655 1 1 147 LEU HD22 H  -2.148 -13.051   8.619 1.00 . A A . 147 LEU HD22 1 1 
        2  4656 1 1 147 LEU HD23 H  -2.088 -13.239  10.371 1.00 . A A . 147 LEU HD23 1 1 
        2  4657 1 1 147 LEU HG   H   0.349 -12.989  10.308 1.00 . A A . 147 LEU HG   1 1 
        2  4658 1 1 147 LEU N    N   2.396 -13.962   9.263 1.00 . A A . 147 LEU N    1 1 
        2  4659 1 1 147 LEU O    O   2.407 -10.935   9.540 1.00 . A A . 147 LEU O    1 1 
        2  4660 1 1 148 ARG C    C   4.087  -9.032   7.275 1.00 . A A . 148 ARG C    1 1 
        2  4661 1 1 148 ARG CA   C   4.620 -10.197   8.095 1.00 . A A . 148 ARG CA   1 1 
        2  4662 1 1 148 ARG CB   C   6.093 -10.489   7.783 1.00 . A A . 148 ARG CB   1 1 
        2  4663 1 1 148 ARG CD   C   7.689 -11.816   6.367 1.00 . A A . 148 ARG CD   1 1 
        2  4664 1 1 148 ARG CG   C   6.322 -11.156   6.434 1.00 . A A . 148 ARG CG   1 1 
        2  4665 1 1 148 ARG CZ   C   8.893 -13.684   7.457 1.00 . A A . 148 ARG CZ   1 1 
        2  4666 1 1 148 ARG H    H   4.050 -11.983   7.125 1.00 . A A . 148 ARG H    1 1 
        2  4667 1 1 148 ARG HA   H   4.529  -9.948   9.142 1.00 . A A . 148 ARG HA   1 1 
        2  4668 1 1 148 ARG HB2  H   6.640  -9.557   7.792 1.00 . A A . 148 ARG HB2  1 1 
        2  4669 1 1 148 ARG HB3  H   6.490 -11.136   8.552 1.00 . A A . 148 ARG HB3  1 1 
        2  4670 1 1 148 ARG HD2  H   7.844 -12.197   5.369 1.00 . A A . 148 ARG HD2  1 1 
        2  4671 1 1 148 ARG HD3  H   8.443 -11.075   6.591 1.00 . A A . 148 ARG HD3  1 1 
        2  4672 1 1 148 ARG HE   H   7.026 -13.110   7.889 1.00 . A A . 148 ARG HE   1 1 
        2  4673 1 1 148 ARG HG2  H   5.562 -11.907   6.282 1.00 . A A . 148 ARG HG2  1 1 
        2  4674 1 1 148 ARG HG3  H   6.254 -10.408   5.657 1.00 . A A . 148 ARG HG3  1 1 
        2  4675 1 1 148 ARG HH11 H   9.984 -12.709   6.049 1.00 . A A . 148 ARG HH11 1 1 
        2  4676 1 1 148 ARG HH12 H  10.795 -14.036   6.831 1.00 . A A . 148 ARG HH12 1 1 
        2  4677 1 1 148 ARG HH21 H   8.086 -14.856   8.909 1.00 . A A . 148 ARG HH21 1 1 
        2  4678 1 1 148 ARG HH22 H   9.715 -15.259   8.441 1.00 . A A . 148 ARG HH22 1 1 
        2  4679 1 1 148 ARG N    N   3.818 -11.380   7.860 1.00 . A A . 148 ARG N    1 1 
        2  4680 1 1 148 ARG NE   N   7.806 -12.921   7.322 1.00 . A A . 148 ARG NE   1 1 
        2  4681 1 1 148 ARG NH1  N   9.972 -13.457   6.722 1.00 . A A . 148 ARG NH1  1 1 
        2  4682 1 1 148 ARG NH2  N   8.899 -14.675   8.339 1.00 . A A . 148 ARG NH2  1 1 
        2  4683 1 1 148 ARG O    O   4.328  -8.926   6.070 1.00 . A A . 148 ARG O    1 1 
        2  4684 1 1 149 THR C    C   3.463  -5.764   7.526 1.00 . A A . 149 THR C    1 1 
        2  4685 1 1 149 THR CA   C   2.688  -7.056   7.304 1.00 . A A . 149 THR CA   1 1 
        2  4686 1 1 149 THR CB   C   1.264  -6.921   7.870 1.00 . A A . 149 THR CB   1 1 
        2  4687 1 1 149 THR CG2  C   0.347  -6.218   6.882 1.00 . A A . 149 THR CG2  1 1 
        2  4688 1 1 149 THR H    H   3.287  -8.255   8.922 1.00 . A A . 149 THR H    1 1 
        2  4689 1 1 149 THR HA   H   2.625  -7.262   6.246 1.00 . A A . 149 THR HA   1 1 
        2  4690 1 1 149 THR HB   H   1.302  -6.349   8.788 1.00 . A A . 149 THR HB   1 1 
        2  4691 1 1 149 THR HG1  H   0.427  -8.264   9.054 1.00 . A A . 149 THR HG1  1 1 
        2  4692 1 1 149 THR HG21 H   0.741  -5.236   6.663 1.00 . A A . 149 THR HG21 1 1 
        2  4693 1 1 149 THR HG22 H  -0.639  -6.122   7.312 1.00 . A A . 149 THR HG22 1 1 
        2  4694 1 1 149 THR HG23 H   0.289  -6.796   5.972 1.00 . A A . 149 THR HG23 1 1 
        2  4695 1 1 149 THR N    N   3.369  -8.156   7.950 1.00 . A A . 149 THR N    1 1 
        2  4696 1 1 149 THR O    O   3.921  -5.496   8.630 1.00 . A A . 149 THR O    1 1 
        2  4697 1 1 149 THR OG1  O   0.739  -8.228   8.144 1.00 . A A . 149 THR OG1  1 1 
        2  4698 1 1 150 ARG C    C   3.708  -2.530   6.130 1.00 . A A . 150 ARG C    1 1 
        2  4699 1 1 150 ARG CA   C   4.450  -3.770   6.596 1.00 . A A . 150 ARG CA   1 1 
        2  4700 1 1 150 ARG CB   C   5.776  -3.921   5.828 1.00 . A A . 150 ARG CB   1 1 
        2  4701 1 1 150 ARG CD   C   5.185  -5.613   4.046 1.00 . A A . 150 ARG CD   1 1 
        2  4702 1 1 150 ARG CG   C   5.645  -4.191   4.331 1.00 . A A . 150 ARG CG   1 1 
        2  4703 1 1 150 ARG CZ   C   6.417  -7.175   2.607 1.00 . A A . 150 ARG CZ   1 1 
        2  4704 1 1 150 ARG H    H   3.163  -5.162   5.646 1.00 . A A . 150 ARG H    1 1 
        2  4705 1 1 150 ARG HA   H   4.681  -3.642   7.643 1.00 . A A . 150 ARG HA   1 1 
        2  4706 1 1 150 ARG HB2  H   6.346  -3.014   5.950 1.00 . A A . 150 ARG HB2  1 1 
        2  4707 1 1 150 ARG HB3  H   6.332  -4.738   6.267 1.00 . A A . 150 ARG HB3  1 1 
        2  4708 1 1 150 ARG HD2  H   5.567  -6.262   4.819 1.00 . A A . 150 ARG HD2  1 1 
        2  4709 1 1 150 ARG HD3  H   4.105  -5.637   4.058 1.00 . A A . 150 ARG HD3  1 1 
        2  4710 1 1 150 ARG HE   H   5.411  -5.571   1.953 1.00 . A A . 150 ARG HE   1 1 
        2  4711 1 1 150 ARG HG2  H   4.925  -3.504   3.913 1.00 . A A . 150 ARG HG2  1 1 
        2  4712 1 1 150 ARG HG3  H   6.606  -4.033   3.864 1.00 . A A . 150 ARG HG3  1 1 
        2  4713 1 1 150 ARG HH11 H   6.349  -7.676   4.568 1.00 . A A . 150 ARG HH11 1 1 
        2  4714 1 1 150 ARG HH12 H   7.297  -8.734   3.571 1.00 . A A . 150 ARG HH12 1 1 
        2  4715 1 1 150 ARG HH21 H   6.630  -6.975   0.593 1.00 . A A . 150 ARG HH21 1 1 
        2  4716 1 1 150 ARG HH22 H   7.468  -8.326   1.306 1.00 . A A . 150 ARG HH22 1 1 
        2  4717 1 1 150 ARG N    N   3.625  -4.964   6.487 1.00 . A A . 150 ARG N    1 1 
        2  4718 1 1 150 ARG NE   N   5.655  -6.092   2.750 1.00 . A A . 150 ARG NE   1 1 
        2  4719 1 1 150 ARG NH1  N   6.706  -7.921   3.667 1.00 . A A . 150 ARG NH1  1 1 
        2  4720 1 1 150 ARG NH2  N   6.869  -7.525   1.408 1.00 . A A . 150 ARG NH2  1 1 
        2  4721 1 1 150 ARG O    O   3.026  -2.539   5.105 1.00 . A A . 150 ARG O    1 1 
        2  4722 1 1 151 VAL C    C   4.306   0.850   6.346 1.00 . A A . 151 VAL C    1 1 
        2  4723 1 1 151 VAL CA   C   3.229  -0.198   6.594 1.00 . A A . 151 VAL CA   1 1 
        2  4724 1 1 151 VAL CB   C   2.298   0.270   7.741 1.00 . A A . 151 VAL CB   1 1 
        2  4725 1 1 151 VAL CG1  C   3.079   0.532   9.019 1.00 . A A . 151 VAL CG1  1 1 
        2  4726 1 1 151 VAL CG2  C   1.507   1.504   7.334 1.00 . A A . 151 VAL CG2  1 1 
        2  4727 1 1 151 VAL H    H   4.409  -1.539   7.713 1.00 . A A . 151 VAL H    1 1 
        2  4728 1 1 151 VAL HA   H   2.638  -0.321   5.699 1.00 . A A . 151 VAL HA   1 1 
        2  4729 1 1 151 VAL HB   H   1.594  -0.524   7.943 1.00 . A A . 151 VAL HB   1 1 
        2  4730 1 1 151 VAL HG11 H   3.609  -0.364   9.309 1.00 . A A . 151 VAL HG11 1 1 
        2  4731 1 1 151 VAL HG12 H   2.396   0.815   9.805 1.00 . A A . 151 VAL HG12 1 1 
        2  4732 1 1 151 VAL HG13 H   3.786   1.332   8.851 1.00 . A A . 151 VAL HG13 1 1 
        2  4733 1 1 151 VAL HG21 H   0.887   1.822   8.158 1.00 . A A . 151 VAL HG21 1 1 
        2  4734 1 1 151 VAL HG22 H   0.884   1.266   6.484 1.00 . A A . 151 VAL HG22 1 1 
        2  4735 1 1 151 VAL HG23 H   2.191   2.296   7.068 1.00 . A A . 151 VAL HG23 1 1 
        2  4736 1 1 151 VAL N    N   3.851  -1.469   6.902 1.00 . A A . 151 VAL N    1 1 
        2  4737 1 1 151 VAL O    O   5.400   0.775   6.908 1.00 . A A . 151 VAL O    1 1 
        2  4738 1 1 152 SER C    C   4.121   4.181   5.640 1.00 . A A . 152 SER C    1 1 
        2  4739 1 1 152 SER CA   C   4.892   2.922   5.278 1.00 . A A . 152 SER CA   1 1 
        2  4740 1 1 152 SER CB   C   5.382   2.966   3.831 1.00 . A A . 152 SER CB   1 1 
        2  4741 1 1 152 SER H    H   3.182   1.737   4.961 1.00 . A A . 152 SER H    1 1 
        2  4742 1 1 152 SER HA   H   5.737   2.821   5.943 1.00 . A A . 152 SER HA   1 1 
        2  4743 1 1 152 SER HB2  H   5.698   1.977   3.532 1.00 . A A . 152 SER HB2  1 1 
        2  4744 1 1 152 SER HB3  H   4.575   3.293   3.192 1.00 . A A . 152 SER HB3  1 1 
        2  4745 1 1 152 SER HG   H   6.675   4.267   4.529 1.00 . A A . 152 SER HG   1 1 
        2  4746 1 1 152 SER N    N   4.020   1.793   5.480 1.00 . A A . 152 SER N    1 1 
        2  4747 1 1 152 SER O    O   3.078   4.472   5.056 1.00 . A A . 152 SER O    1 1 
        2  4748 1 1 152 SER OG   O   6.473   3.856   3.679 1.00 . A A . 152 SER OG   1 1 
        2  4749 1 1 153 LEU C    C   4.320   7.342   6.688 1.00 . A A . 153 LEU C    1 1 
        2  4750 1 1 153 LEU CA   C   3.874   5.989   7.219 1.00 . A A . 153 LEU CA   1 1 
        2  4751 1 1 153 LEU CB   C   4.049   5.930   8.734 1.00 . A A . 153 LEU CB   1 1 
        2  4752 1 1 153 LEU CD1  C   2.028   7.252   9.472 1.00 . A A . 153 LEU CD1  1 1 
        2  4753 1 1 153 LEU CD2  C   1.846   4.786   9.134 1.00 . A A . 153 LEU CD2  1 1 
        2  4754 1 1 153 LEU CG   C   2.758   5.922   9.570 1.00 . A A . 153 LEU CG   1 1 
        2  4755 1 1 153 LEU H    H   5.545   4.736   6.911 1.00 . A A . 153 LEU H    1 1 
        2  4756 1 1 153 LEU HA   H   2.832   5.844   6.981 1.00 . A A . 153 LEU HA   1 1 
        2  4757 1 1 153 LEU HB2  H   4.599   5.033   8.959 1.00 . A A . 153 LEU HB2  1 1 
        2  4758 1 1 153 LEU HB3  H   4.643   6.779   9.038 1.00 . A A . 153 LEU HB3  1 1 
        2  4759 1 1 153 LEU HD11 H   1.758   7.440   8.444 1.00 . A A . 153 LEU HD11 1 1 
        2  4760 1 1 153 LEU HD12 H   2.672   8.042   9.827 1.00 . A A . 153 LEU HD12 1 1 
        2  4761 1 1 153 LEU HD13 H   1.134   7.217  10.078 1.00 . A A . 153 LEU HD13 1 1 
        2  4762 1 1 153 LEU HD21 H   0.938   4.810   9.718 1.00 . A A . 153 LEU HD21 1 1 
        2  4763 1 1 153 LEU HD22 H   2.346   3.841   9.284 1.00 . A A . 153 LEU HD22 1 1 
        2  4764 1 1 153 LEU HD23 H   1.602   4.901   8.085 1.00 . A A . 153 LEU HD23 1 1 
        2  4765 1 1 153 LEU HG   H   3.016   5.763  10.607 1.00 . A A . 153 LEU HG   1 1 
        2  4766 1 1 153 LEU N    N   4.629   4.911   6.610 1.00 . A A . 153 LEU N    1 1 
        2  4767 1 1 153 LEU O    O   5.381   7.471   6.072 1.00 . A A . 153 LEU O    1 1 
        2  4768 1 1 154 MET C    C   4.931  10.281   7.313 1.00 . A A . 154 MET C    1 1 
        2  4769 1 1 154 MET CA   C   3.751   9.702   6.543 1.00 . A A . 154 MET CA   1 1 
        2  4770 1 1 154 MET CB   C   2.502  10.545   6.813 1.00 . A A . 154 MET CB   1 1 
        2  4771 1 1 154 MET CE   C   1.489  12.714   8.949 1.00 . A A . 154 MET CE   1 1 
        2  4772 1 1 154 MET CG   C   2.685  12.030   6.552 1.00 . A A . 154 MET CG   1 1 
        2  4773 1 1 154 MET H    H   2.666   8.141   7.428 1.00 . A A . 154 MET H    1 1 
        2  4774 1 1 154 MET HA   H   3.971   9.716   5.488 1.00 . A A . 154 MET HA   1 1 
        2  4775 1 1 154 MET HB2  H   1.702  10.189   6.181 1.00 . A A . 154 MET HB2  1 1 
        2  4776 1 1 154 MET HB3  H   2.214  10.416   7.846 1.00 . A A . 154 MET HB3  1 1 
        2  4777 1 1 154 MET HE1  H   0.731  13.267   9.484 1.00 . A A . 154 MET HE1  1 1 
        2  4778 1 1 154 MET HE2  H   2.469  13.033   9.278 1.00 . A A . 154 MET HE2  1 1 
        2  4779 1 1 154 MET HE3  H   1.369  11.659   9.144 1.00 . A A . 154 MET HE3  1 1 
        2  4780 1 1 154 MET HG2  H   3.600  12.354   7.026 1.00 . A A . 154 MET HG2  1 1 
        2  4781 1 1 154 MET HG3  H   2.759  12.187   5.486 1.00 . A A . 154 MET HG3  1 1 
        2  4782 1 1 154 MET N    N   3.491   8.335   6.942 1.00 . A A . 154 MET N    1 1 
        2  4783 1 1 154 MET O    O   4.946  10.267   8.543 1.00 . A A . 154 MET O    1 1 
        2  4784 1 1 154 MET SD   S   1.320  13.021   7.191 1.00 . A A . 154 MET SD   1 1 
        2  4785 1 1 155 LEU C    C   6.393  12.893   7.610 1.00 . A A . 155 LEU C    1 1 
        2  4786 1 1 155 LEU CA   C   6.988  11.560   7.178 1.00 . A A . 155 LEU CA   1 1 
        2  4787 1 1 155 LEU CB   C   8.133  11.757   6.180 1.00 . A A . 155 LEU CB   1 1 
        2  4788 1 1 155 LEU CD1  C   9.818  10.728   4.615 1.00 . A A . 155 LEU CD1  1 1 
        2  4789 1 1 155 LEU CD2  C   9.514   9.797   6.918 1.00 . A A . 155 LEU CD2  1 1 
        2  4790 1 1 155 LEU CG   C   8.822  10.461   5.736 1.00 . A A . 155 LEU CG   1 1 
        2  4791 1 1 155 LEU H    H   5.946  10.581   5.623 1.00 . A A . 155 LEU H    1 1 
        2  4792 1 1 155 LEU HA   H   7.354  11.036   8.049 1.00 . A A . 155 LEU HA   1 1 
        2  4793 1 1 155 LEU HB2  H   7.739  12.253   5.305 1.00 . A A . 155 LEU HB2  1 1 
        2  4794 1 1 155 LEU HB3  H   8.874  12.397   6.634 1.00 . A A . 155 LEU HB3  1 1 
        2  4795 1 1 155 LEU HD11 H  10.573  11.417   4.961 1.00 . A A . 155 LEU HD11 1 1 
        2  4796 1 1 155 LEU HD12 H   9.301  11.154   3.769 1.00 . A A . 155 LEU HD12 1 1 
        2  4797 1 1 155 LEU HD13 H  10.284   9.799   4.321 1.00 . A A . 155 LEU HD13 1 1 
        2  4798 1 1 155 LEU HD21 H   8.785   9.566   7.680 1.00 . A A . 155 LEU HD21 1 1 
        2  4799 1 1 155 LEU HD22 H  10.259  10.466   7.323 1.00 . A A . 155 LEU HD22 1 1 
        2  4800 1 1 155 LEU HD23 H   9.991   8.884   6.589 1.00 . A A . 155 LEU HD23 1 1 
        2  4801 1 1 155 LEU HG   H   8.074   9.777   5.361 1.00 . A A . 155 LEU HG   1 1 
        2  4802 1 1 155 LEU N    N   5.926  10.764   6.582 1.00 . A A . 155 LEU N    1 1 
        2  4803 1 1 155 LEU O    O   5.341  13.273   7.100 1.00 . A A . 155 LEU O    1 1 
        2  4804 1 1 156 HIS C    C   5.581  14.171  10.340 1.00 . A A . 156 HIS C    1 1 
        2  4805 1 1 156 HIS CA   C   6.483  14.732   9.241 1.00 . A A . 156 HIS CA   1 1 
        2  4806 1 1 156 HIS CB   C   5.705  15.682   8.308 1.00 . A A . 156 HIS CB   1 1 
        2  4807 1 1 156 HIS CD2  C   3.835  16.895   9.650 1.00 . A A . 156 HIS CD2  1 1 
        2  4808 1 1 156 HIS CE1  C   4.697  18.902   9.641 1.00 . A A . 156 HIS CE1  1 1 
        2  4809 1 1 156 HIS CG   C   5.017  16.827   8.991 1.00 . A A . 156 HIS CG   1 1 
        2  4810 1 1 156 HIS H    H   8.017  13.382   8.674 1.00 . A A . 156 HIS H    1 1 
        2  4811 1 1 156 HIS HA   H   7.290  15.279   9.707 1.00 . A A . 156 HIS HA   1 1 
        2  4812 1 1 156 HIS HB2  H   6.391  16.101   7.589 1.00 . A A . 156 HIS HB2  1 1 
        2  4813 1 1 156 HIS HB3  H   4.953  15.112   7.782 1.00 . A A . 156 HIS HB3  1 1 
        2  4814 1 1 156 HIS HD1  H   6.373  18.384   8.579 1.00 . A A . 156 HIS HD1  1 1 
        2  4815 1 1 156 HIS HD2  H   3.159  16.072   9.837 1.00 . A A . 156 HIS HD2  1 1 
        2  4816 1 1 156 HIS HE1  H   4.843  19.958   9.805 1.00 . A A . 156 HIS HE1  1 1 
        2  4817 1 1 156 HIS HE2  H   2.793  18.590  10.296 1.00 . A A . 156 HIS HE2  1 1 
        2  4818 1 1 156 HIS N    N   7.080  13.611   8.502 1.00 . A A . 156 HIS N    1 1 
        2  4819 1 1 156 HIS ND1  N   5.529  18.100   9.006 1.00 . A A . 156 HIS ND1  1 1 
        2  4820 1 1 156 HIS NE2  N   3.656  18.198  10.041 1.00 . A A . 156 HIS NE2  1 1 
        2  4821 1 1 156 HIS O    O   4.739  13.311  10.082 1.00 . A A . 156 HIS O    1 1 
        2  4822 1 1 157 GLU C    C   3.579  14.039  12.523 1.00 . A A . 157 GLU C    1 1 
        2  4823 1 1 157 GLU CA   C   5.087  14.120  12.739 1.00 . A A . 157 GLU CA   1 1 
        2  4824 1 1 157 GLU CB   C   5.405  14.961  13.974 1.00 . A A . 157 GLU CB   1 1 
        2  4825 1 1 157 GLU CD   C   7.166  15.743  15.605 1.00 . A A . 157 GLU CD   1 1 
        2  4826 1 1 157 GLU CG   C   6.866  14.891  14.393 1.00 . A A . 157 GLU CG   1 1 
        2  4827 1 1 157 GLU H    H   6.411  15.397  11.683 1.00 . A A . 157 GLU H    1 1 
        2  4828 1 1 157 GLU HA   H   5.459  13.120  12.903 1.00 . A A . 157 GLU HA   1 1 
        2  4829 1 1 157 GLU HB2  H   5.160  15.992  13.766 1.00 . A A . 157 GLU HB2  1 1 
        2  4830 1 1 157 GLU HB3  H   4.798  14.613  14.797 1.00 . A A . 157 GLU HB3  1 1 
        2  4831 1 1 157 GLU HG2  H   7.112  13.867  14.624 1.00 . A A . 157 GLU HG2  1 1 
        2  4832 1 1 157 GLU HG3  H   7.480  15.232  13.572 1.00 . A A . 157 GLU HG3  1 1 
        2  4833 1 1 157 GLU N    N   5.780  14.653  11.565 1.00 . A A . 157 GLU N    1 1 
        2  4834 1 1 157 GLU O    O   2.956  14.978  12.020 1.00 . A A . 157 GLU O    1 1 
        2  4835 1 1 157 GLU OE1  O   6.901  15.287  16.735 1.00 . A A . 157 GLU OE1  1 1 
        2  4836 1 1 157 GLU OE2  O   7.662  16.876  15.436 1.00 . A A . 157 GLU OE2  1 1 
        2  4837 1 1 158 SER C    C   0.681  13.665  13.230 1.00 . A A . 158 SER C    1 1 
        2  4838 1 1 158 SER CA   C   1.614  12.585  12.683 1.00 . A A . 158 SER CA   1 1 
        2  4839 1 1 158 SER CB   C   1.297  11.237  13.333 1.00 . A A . 158 SER CB   1 1 
        2  4840 1 1 158 SER H    H   3.573  12.233  13.363 1.00 . A A . 158 SER H    1 1 
        2  4841 1 1 158 SER HA   H   1.461  12.500  11.618 1.00 . A A . 158 SER HA   1 1 
        2  4842 1 1 158 SER HB2  H   1.297  11.348  14.407 1.00 . A A . 158 SER HB2  1 1 
        2  4843 1 1 158 SER HB3  H   0.325  10.900  13.004 1.00 . A A . 158 SER HB3  1 1 
        2  4844 1 1 158 SER HG   H   2.230  10.110  12.024 1.00 . A A . 158 SER HG   1 1 
        2  4845 1 1 158 SER N    N   3.017  12.899  12.909 1.00 . A A . 158 SER N    1 1 
        2  4846 1 1 158 SER O    O   0.783  14.069  14.394 1.00 . A A . 158 SER O    1 1 
        2  4847 1 1 158 SER OG   O   2.266  10.263  12.972 1.00 . A A . 158 SER OG   1 1 
        2  4848 1 1 159 LEU C    C  -2.317  14.374  13.566 1.00 . A A . 159 LEU C    1 1 
        2  4849 1 1 159 LEU CA   C  -1.243  15.090  12.761 1.00 . A A . 159 LEU CA   1 1 
        2  4850 1 1 159 LEU CB   C  -1.873  15.767  11.534 1.00 . A A . 159 LEU CB   1 1 
        2  4851 1 1 159 LEU CD1  C   0.172  16.107  10.094 1.00 . A A . 159 LEU CD1  1 1 
        2  4852 1 1 159 LEU CD2  C  -1.825  17.575   9.799 1.00 . A A . 159 LEU CD2  1 1 
        2  4853 1 1 159 LEU CG   C  -0.993  16.787  10.797 1.00 . A A . 159 LEU CG   1 1 
        2  4854 1 1 159 LEU H    H  -0.173  13.845  11.434 1.00 . A A . 159 LEU H    1 1 
        2  4855 1 1 159 LEU HA   H  -0.780  15.841  13.383 1.00 . A A . 159 LEU HA   1 1 
        2  4856 1 1 159 LEU HB2  H  -2.149  14.994  10.832 1.00 . A A . 159 LEU HB2  1 1 
        2  4857 1 1 159 LEU HB3  H  -2.773  16.271  11.855 1.00 . A A . 159 LEU HB3  1 1 
        2  4858 1 1 159 LEU HD11 H   0.773  16.851   9.592 1.00 . A A . 159 LEU HD11 1 1 
        2  4859 1 1 159 LEU HD12 H  -0.207  15.402   9.370 1.00 . A A . 159 LEU HD12 1 1 
        2  4860 1 1 159 LEU HD13 H   0.776  15.586  10.821 1.00 . A A . 159 LEU HD13 1 1 
        2  4861 1 1 159 LEU HD21 H  -2.264  16.899   9.082 1.00 . A A . 159 LEU HD21 1 1 
        2  4862 1 1 159 LEU HD22 H  -1.195  18.284   9.287 1.00 . A A . 159 LEU HD22 1 1 
        2  4863 1 1 159 LEU HD23 H  -2.609  18.103  10.323 1.00 . A A . 159 LEU HD23 1 1 
        2  4864 1 1 159 LEU HG   H  -0.585  17.485  11.514 1.00 . A A . 159 LEU HG   1 1 
        2  4865 1 1 159 LEU N    N  -0.213  14.139  12.366 1.00 . A A . 159 LEU N    1 1 
        2  4866 1 1 159 LEU O    O  -2.782  14.874  14.590 1.00 . A A . 159 LEU O    1 1 
        2  4867 1 1 160 GLU C    C  -2.985  11.885  15.117 1.00 . A A . 160 GLU C    1 1 
        2  4868 1 1 160 GLU CA   C  -3.631  12.342  13.812 1.00 . A A . 160 GLU CA   1 1 
        2  4869 1 1 160 GLU CB   C  -4.012  11.134  12.950 1.00 . A A . 160 GLU CB   1 1 
        2  4870 1 1 160 GLU CD   C  -6.355  10.914  13.862 1.00 . A A . 160 GLU CD   1 1 
        2  4871 1 1 160 GLU CG   C  -5.037  10.218  13.596 1.00 . A A . 160 GLU CG   1 1 
        2  4872 1 1 160 GLU H    H  -2.361  12.894  12.225 1.00 . A A . 160 GLU H    1 1 
        2  4873 1 1 160 GLU HA   H  -4.516  12.916  14.034 1.00 . A A . 160 GLU HA   1 1 
        2  4874 1 1 160 GLU HB2  H  -4.417  11.488  12.016 1.00 . A A . 160 GLU HB2  1 1 
        2  4875 1 1 160 GLU HB3  H  -3.122  10.555  12.750 1.00 . A A . 160 GLU HB3  1 1 
        2  4876 1 1 160 GLU HG2  H  -5.216   9.381  12.937 1.00 . A A . 160 GLU HG2  1 1 
        2  4877 1 1 160 GLU HG3  H  -4.639   9.859  14.533 1.00 . A A . 160 GLU HG3  1 1 
        2  4878 1 1 160 GLU N    N  -2.704  13.196  13.089 1.00 . A A . 160 GLU N    1 1 
        2  4879 1 1 160 GLU O    O  -1.938  11.234  15.111 1.00 . A A . 160 GLU O    1 1 
        2  4880 1 1 160 GLU OE1  O  -7.232  10.889  12.976 1.00 . A A . 160 GLU OE1  1 1 
        2  4881 1 1 160 GLU OE2  O  -6.520  11.486  14.959 1.00 . A A . 160 GLU OE2  1 1 
        2  4882 1 1 161 HIS C    C  -3.308  10.599  18.049 1.00 . A A . 161 HIS C    1 1 
        2  4883 1 1 161 HIS CA   C  -3.006  12.000  17.537 1.00 . A A . 161 HIS CA   1 1 
        2  4884 1 1 161 HIS CB   C  -3.481  13.048  18.547 1.00 . A A . 161 HIS CB   1 1 
        2  4885 1 1 161 HIS CD2  C  -1.879  15.074  18.251 1.00 . A A . 161 HIS CD2  1 1 
        2  4886 1 1 161 HIS CE1  C  -3.334  16.526  17.495 1.00 . A A . 161 HIS CE1  1 1 
        2  4887 1 1 161 HIS CG   C  -3.082  14.452  18.194 1.00 . A A . 161 HIS CG   1 1 
        2  4888 1 1 161 HIS H    H  -4.494  12.648  16.177 1.00 . A A . 161 HIS H    1 1 
        2  4889 1 1 161 HIS HA   H  -1.936  12.094  17.422 1.00 . A A . 161 HIS HA   1 1 
        2  4890 1 1 161 HIS HB2  H  -4.558  13.015  18.608 1.00 . A A . 161 HIS HB2  1 1 
        2  4891 1 1 161 HIS HB3  H  -3.063  12.818  19.518 1.00 . A A . 161 HIS HB3  1 1 
        2  4892 1 1 161 HIS HD1  H  -4.931  15.242  17.548 1.00 . A A . 161 HIS HD1  1 1 
        2  4893 1 1 161 HIS HD2  H  -0.946  14.636  18.578 1.00 . A A . 161 HIS HD2  1 1 
        2  4894 1 1 161 HIS HE1  H  -3.780  17.436  17.121 1.00 . A A . 161 HIS HE1  1 1 
        2  4895 1 1 161 HIS HE2  H  -1.336  16.976  17.539 1.00 . A A . 161 HIS HE2  1 1 
        2  4896 1 1 161 HIS N    N  -3.606  12.233  16.232 1.00 . A A . 161 HIS N    1 1 
        2  4897 1 1 161 HIS ND1  N  -3.970  15.391  17.717 1.00 . A A . 161 HIS ND1  1 1 
        2  4898 1 1 161 HIS NE2  N  -2.063  16.363  17.811 1.00 . A A . 161 HIS NE2  1 1 
        2  4899 1 1 161 HIS O    O  -4.234  10.397  18.836 1.00 . A A . 161 HIS O    1 1 
        2  4900 1 1 162 HIS C    C  -1.284   7.912  18.742 1.00 . A A . 162 HIS C    1 1 
        2  4901 1 1 162 HIS CA   C  -2.605   8.269  18.084 1.00 . A A . 162 HIS CA   1 1 
        2  4902 1 1 162 HIS CB   C  -2.915   7.263  16.974 1.00 . A A . 162 HIS CB   1 1 
        2  4903 1 1 162 HIS CD2  C  -5.238   7.825  15.968 1.00 . A A . 162 HIS CD2  1 1 
        2  4904 1 1 162 HIS CE1  C  -6.355   6.125  16.778 1.00 . A A . 162 HIS CE1  1 1 
        2  4905 1 1 162 HIS CG   C  -4.374   7.085  16.699 1.00 . A A . 162 HIS CG   1 1 
        2  4906 1 1 162 HIS H    H  -1.918   9.837  16.839 1.00 . A A . 162 HIS H    1 1 
        2  4907 1 1 162 HIS HA   H  -3.388   8.232  18.826 1.00 . A A . 162 HIS HA   1 1 
        2  4908 1 1 162 HIS HB2  H  -2.448   7.595  16.059 1.00 . A A . 162 HIS HB2  1 1 
        2  4909 1 1 162 HIS HB3  H  -2.508   6.301  17.250 1.00 . A A . 162 HIS HB3  1 1 
        2  4910 1 1 162 HIS HD1  H  -4.755   5.302  17.776 1.00 . A A . 162 HIS HD1  1 1 
        2  4911 1 1 162 HIS HD2  H  -5.007   8.734  15.430 1.00 . A A . 162 HIS HD2  1 1 
        2  4912 1 1 162 HIS HE1  H  -7.155   5.437  17.009 1.00 . A A . 162 HIS HE1  1 1 
        2  4913 1 1 162 HIS HE2  H  -7.306   7.571  15.670 1.00 . A A . 162 HIS HE2  1 1 
        2  4914 1 1 162 HIS N    N  -2.545   9.630  17.567 1.00 . A A . 162 HIS N    1 1 
        2  4915 1 1 162 HIS ND1  N  -5.107   6.027  17.195 1.00 . A A . 162 HIS ND1  1 1 
        2  4916 1 1 162 HIS NE2  N  -6.459   7.207  16.032 1.00 . A A . 162 HIS NE2  1 1 
        2  4917 1 1 162 HIS O    O  -0.248   7.870  18.081 1.00 . A A . 162 HIS O    1 1 
        2  4918 1 1 163 HIS C    C  -0.382   6.291  21.842 1.00 . A A . 163 HIS C    1 1 
        2  4919 1 1 163 HIS CA   C  -0.106   7.340  20.779 1.00 . A A . 163 HIS CA   1 1 
        2  4920 1 1 163 HIS CB   C   0.541   8.575  21.410 1.00 . A A . 163 HIS CB   1 1 
        2  4921 1 1 163 HIS CD2  C   1.191  10.482  19.770 1.00 . A A . 163 HIS CD2  1 1 
        2  4922 1 1 163 HIS CE1  C   3.204   9.783  19.275 1.00 . A A . 163 HIS CE1  1 1 
        2  4923 1 1 163 HIS CG   C   1.410   9.338  20.463 1.00 . A A . 163 HIS CG   1 1 
        2  4924 1 1 163 HIS H    H  -2.166   7.762  20.528 1.00 . A A . 163 HIS H    1 1 
        2  4925 1 1 163 HIS HA   H   0.587   6.920  20.065 1.00 . A A . 163 HIS HA   1 1 
        2  4926 1 1 163 HIS HB2  H  -0.232   9.240  21.763 1.00 . A A . 163 HIS HB2  1 1 
        2  4927 1 1 163 HIS HB3  H   1.152   8.265  22.246 1.00 . A A . 163 HIS HB3  1 1 
        2  4928 1 1 163 HIS HD1  H   3.127   8.115  20.465 1.00 . A A . 163 HIS HD1  1 1 
        2  4929 1 1 163 HIS HD2  H   0.293  11.084  19.793 1.00 . A A . 163 HIS HD2  1 1 
        2  4930 1 1 163 HIS HE1  H   4.192   9.713  18.844 1.00 . A A . 163 HIS HE1  1 1 
        2  4931 1 1 163 HIS HE2  H   2.542  11.601  18.607 1.00 . A A . 163 HIS HE2  1 1 
        2  4932 1 1 163 HIS N    N  -1.314   7.693  20.047 1.00 . A A . 163 HIS N    1 1 
        2  4933 1 1 163 HIS ND1  N   2.677   8.930  20.128 1.00 . A A . 163 HIS ND1  1 1 
        2  4934 1 1 163 HIS NE2  N   2.325  10.736  19.038 1.00 . A A . 163 HIS NE2  1 1 
        2  4935 1 1 163 HIS O    O  -0.405   6.588  23.040 1.00 . A A . 163 HIS O    1 1 
        2  4936 1 1 164 HIS C    C   0.440   3.020  22.139 1.00 . A A . 164 HIS C    1 1 
        2  4937 1 1 164 HIS CA   C  -0.753   3.947  22.307 1.00 . A A . 164 HIS CA   1 1 
        2  4938 1 1 164 HIS CB   C  -2.052   3.178  22.047 1.00 . A A . 164 HIS CB   1 1 
        2  4939 1 1 164 HIS CD2  C  -3.856   4.153  23.629 1.00 . A A . 164 HIS CD2  1 1 
        2  4940 1 1 164 HIS CE1  C  -5.142   5.082  22.123 1.00 . A A . 164 HIS CE1  1 1 
        2  4941 1 1 164 HIS CG   C  -3.292   3.929  22.421 1.00 . A A . 164 HIS CG   1 1 
        2  4942 1 1 164 HIS H    H  -0.724   4.920  20.427 1.00 . A A . 164 HIS H    1 1 
        2  4943 1 1 164 HIS HA   H  -0.761   4.329  23.316 1.00 . A A . 164 HIS HA   1 1 
        2  4944 1 1 164 HIS HB2  H  -2.114   2.945  20.995 1.00 . A A . 164 HIS HB2  1 1 
        2  4945 1 1 164 HIS HB3  H  -2.036   2.258  22.612 1.00 . A A . 164 HIS HB3  1 1 
        2  4946 1 1 164 HIS HD1  H  -3.994   4.524  20.514 1.00 . A A . 164 HIS HD1  1 1 
        2  4947 1 1 164 HIS HD2  H  -3.471   3.826  24.584 1.00 . A A . 164 HIS HD2  1 1 
        2  4948 1 1 164 HIS HE1  H  -5.951   5.620  21.652 1.00 . A A . 164 HIS HE1  1 1 
        2  4949 1 1 164 HIS HE2  H  -5.747   4.927  24.071 1.00 . A A . 164 HIS HE2  1 1 
        2  4950 1 1 164 HIS N    N  -0.624   5.073  21.400 1.00 . A A . 164 HIS N    1 1 
        2  4951 1 1 164 HIS ND1  N  -4.125   4.524  21.499 1.00 . A A . 164 HIS ND1  1 1 
        2  4952 1 1 164 HIS NE2  N  -5.006   4.871  23.421 1.00 . A A . 164 HIS NE2  1 1 
        2  4953 1 1 164 HIS O    O   0.777   2.638  21.023 1.00 . A A . 164 HIS O    1 1 
        2  4954 1 1 165 HIS C    C   1.670   0.339  22.993 1.00 . A A . 165 HIS C    1 1 
        2  4955 1 1 165 HIS CA   C   2.208   1.750  23.193 1.00 . A A . 165 HIS CA   1 1 
        2  4956 1 1 165 HIS CB   C   3.055   1.834  24.468 1.00 . A A . 165 HIS CB   1 1 
        2  4957 1 1 165 HIS CD2  C   5.165   3.341  24.384 1.00 . A A . 165 HIS CD2  1 1 
        2  4958 1 1 165 HIS CE1  C   4.241   5.229  24.997 1.00 . A A . 165 HIS CE1  1 1 
        2  4959 1 1 165 HIS CG   C   3.849   3.099  24.590 1.00 . A A . 165 HIS CG   1 1 
        2  4960 1 1 165 HIS H    H   0.831   3.081  24.098 1.00 . A A . 165 HIS H    1 1 
        2  4961 1 1 165 HIS HA   H   2.824   2.008  22.345 1.00 . A A . 165 HIS HA   1 1 
        2  4962 1 1 165 HIS HB2  H   2.402   1.769  25.327 1.00 . A A . 165 HIS HB2  1 1 
        2  4963 1 1 165 HIS HB3  H   3.746   1.003  24.487 1.00 . A A . 165 HIS HB3  1 1 
        2  4964 1 1 165 HIS HD1  H   2.348   4.466  25.188 1.00 . A A . 165 HIS HD1  1 1 
        2  4965 1 1 165 HIS HD2  H   5.907   2.621  24.074 1.00 . A A . 165 HIS HD2  1 1 
        2  4966 1 1 165 HIS HE1  H   4.102   6.265  25.266 1.00 . A A . 165 HIS HE1  1 1 
        2  4967 1 1 165 HIS HE2  H   6.224   5.159  24.478 1.00 . A A . 165 HIS HE2  1 1 
        2  4968 1 1 165 HIS N    N   1.098   2.689  23.239 1.00 . A A . 165 HIS N    1 1 
        2  4969 1 1 165 HIS ND1  N   3.299   4.305  24.973 1.00 . A A . 165 HIS ND1  1 1 
        2  4970 1 1 165 HIS NE2  N   5.380   4.670  24.645 1.00 . A A . 165 HIS NE2  1 1 
        2  4971 1 1 165 HIS O    O   1.719  -0.197  21.886 1.00 . A A . 165 HIS O    1 1 
        2  4972 1 1 166 HIS C    C  -0.019  -1.952  25.361 1.00 . A A . 166 HIS C    1 1 
        2  4973 1 1 166 HIS CA   C   0.468  -1.537  23.983 1.00 . A A . 166 HIS CA   1 1 
        2  4974 1 1 166 HIS CB   C   1.397  -2.618  23.426 1.00 . A A . 166 HIS CB   1 1 
        2  4975 1 1 166 HIS CD2  C   0.070  -3.887  21.613 1.00 . A A . 166 HIS CD2  1 1 
        2  4976 1 1 166 HIS CE1  C  -0.271  -5.754  22.698 1.00 . A A . 166 HIS CE1  1 1 
        2  4977 1 1 166 HIS CG   C   0.651  -3.763  22.826 1.00 . A A . 166 HIS CG   1 1 
        2  4978 1 1 166 HIS H    H   1.177   0.215  24.927 1.00 . A A . 166 HIS H    1 1 
        2  4979 1 1 166 HIS HA   H  -0.386  -1.434  23.329 1.00 . A A . 166 HIS HA   1 1 
        2  4980 1 1 166 HIS HB2  H   2.024  -2.188  22.660 1.00 . A A . 166 HIS HB2  1 1 
        2  4981 1 1 166 HIS HB3  H   2.016  -3.003  24.224 1.00 . A A . 166 HIS HB3  1 1 
        2  4982 1 1 166 HIS HD1  H   0.718  -5.173  24.398 1.00 . A A . 166 HIS HD1  1 1 
        2  4983 1 1 166 HIS HD2  H   0.056  -3.141  20.831 1.00 . A A . 166 HIS HD2  1 1 
        2  4984 1 1 166 HIS HE1  H  -0.596  -6.754  22.948 1.00 . A A . 166 HIS HE1  1 1 
        2  4985 1 1 166 HIS HE2  H  -0.866  -5.555  20.738 1.00 . A A . 166 HIS HE2  1 1 
        2  4986 1 1 166 HIS N    N   1.133  -0.243  24.060 1.00 . A A . 166 HIS N    1 1 
        2  4987 1 1 166 HIS ND1  N   0.422  -4.951  23.482 1.00 . A A . 166 HIS ND1  1 1 
        2  4988 1 1 166 HIS NE2  N  -0.497  -5.131  21.559 1.00 . A A . 166 HIS NE2  1 1 
        2  4989 1 1 166 HIS O    O   0.700  -2.711  26.040 1.00 . A A . 166 HIS O    1 1 
        2  4990 1 1 166 HIS OXT  O  -1.105  -1.498  25.768 1.00 . A A . 166 HIS OXT  1 1 
        3  4991 1 1   1 MET C    C  10.998   4.106  31.030 1.00 . A A .   1 MET C    1 1 
        3  4992 1 1   1 MET CA   C  12.172   4.050  32.003 1.00 . A A .   1 MET CA   1 1 
        3  4993 1 1   1 MET CB   C  12.133   2.753  32.829 1.00 . A A .   1 MET CB   1 1 
        3  4994 1 1   1 MET CE   C  10.888  -0.127  33.433 1.00 . A A .   1 MET CE   1 1 
        3  4995 1 1   1 MET CG   C  10.938   2.632  33.768 1.00 . A A .   1 MET CG   1 1 
        3  4996 1 1   1 MET H1   H  11.292   5.255  33.457 1.00 . A A .   1 MET H1   1 1 
        3  4997 1 1   1 MET H2   H  12.229   6.104  32.324 1.00 . A A .   1 MET H2   1 1 
        3  4998 1 1   1 MET H3   H  12.988   5.200  33.536 1.00 . A A .   1 MET H3   1 1 
        3  4999 1 1   1 MET HA   H  13.087   4.069  31.428 1.00 . A A .   1 MET HA   1 1 
        3  5000 1 1   1 MET HB2  H  12.110   1.914  32.149 1.00 . A A .   1 MET HB2  1 1 
        3  5001 1 1   1 MET HB3  H  13.034   2.696  33.422 1.00 . A A .   1 MET HB3  1 1 
        3  5002 1 1   1 MET HE1  H   9.978   0.000  32.865 1.00 . A A .   1 MET HE1  1 1 
        3  5003 1 1   1 MET HE2  H  10.903  -1.115  33.871 1.00 . A A .   1 MET HE2  1 1 
        3  5004 1 1   1 MET HE3  H  11.738  -0.010  32.778 1.00 . A A .   1 MET HE3  1 1 
        3  5005 1 1   1 MET HG2  H  10.948   3.469  34.451 1.00 . A A .   1 MET HG2  1 1 
        3  5006 1 1   1 MET HG3  H  10.031   2.660  33.181 1.00 . A A .   1 MET HG3  1 1 
        3  5007 1 1   1 MET N    N  12.171   5.231  32.892 1.00 . A A .   1 MET N    1 1 
        3  5008 1 1   1 MET O    O   9.835   4.138  31.435 1.00 . A A .   1 MET O    1 1 
        3  5009 1 1   1 MET SD   S  10.958   1.106  34.732 1.00 . A A .   1 MET SD   1 1 
        3  5010 1 1   2 ASP C    C  10.570   3.077  27.692 1.00 . A A .   2 ASP C    1 1 
        3  5011 1 1   2 ASP CA   C  10.306   4.190  28.698 1.00 . A A .   2 ASP CA   1 1 
        3  5012 1 1   2 ASP CB   C  10.327   5.550  27.983 1.00 . A A .   2 ASP CB   1 1 
        3  5013 1 1   2 ASP CG   C   9.750   6.681  28.819 1.00 . A A .   2 ASP CG   1 1 
        3  5014 1 1   2 ASP H    H  12.267   4.128  29.487 1.00 . A A .   2 ASP H    1 1 
        3  5015 1 1   2 ASP HA   H   9.339   4.036  29.152 1.00 . A A .   2 ASP HA   1 1 
        3  5016 1 1   2 ASP HB2  H  11.347   5.802  27.737 1.00 . A A .   2 ASP HB2  1 1 
        3  5017 1 1   2 ASP HB3  H   9.753   5.477  27.071 1.00 . A A .   2 ASP HB3  1 1 
        3  5018 1 1   2 ASP N    N  11.315   4.144  29.747 1.00 . A A .   2 ASP N    1 1 
        3  5019 1 1   2 ASP O    O  11.521   2.312  27.850 1.00 . A A .   2 ASP O    1 1 
        3  5020 1 1   2 ASP OD1  O  10.471   7.233  29.677 1.00 . A A .   2 ASP OD1  1 1 
        3  5021 1 1   2 ASP OD2  O   8.570   7.036  28.607 1.00 . A A .   2 ASP OD2  1 1 
        3  5022 1 1   3 PHE C    C  10.391   2.729  24.325 1.00 . A A .   3 PHE C    1 1 
        3  5023 1 1   3 PHE CA   C   9.976   2.007  25.604 1.00 . A A .   3 PHE CA   1 1 
        3  5024 1 1   3 PHE CB   C   8.764   1.082  25.378 1.00 . A A .   3 PHE CB   1 1 
        3  5025 1 1   3 PHE CD1  C   6.712   2.298  26.176 1.00 . A A .   3 PHE CD1  1 1 
        3  5026 1 1   3 PHE CD2  C   6.944   1.888  23.840 1.00 . A A .   3 PHE CD2  1 1 
        3  5027 1 1   3 PHE CE1  C   5.501   2.922  25.950 1.00 . A A .   3 PHE CE1  1 1 
        3  5028 1 1   3 PHE CE2  C   5.732   2.509  23.609 1.00 . A A .   3 PHE CE2  1 1 
        3  5029 1 1   3 PHE CG   C   7.449   1.777  25.126 1.00 . A A .   3 PHE CG   1 1 
        3  5030 1 1   3 PHE CZ   C   5.010   3.028  24.665 1.00 . A A .   3 PHE CZ   1 1 
        3  5031 1 1   3 PHE H    H   8.950   3.561  26.620 1.00 . A A .   3 PHE H    1 1 
        3  5032 1 1   3 PHE HA   H  10.813   1.398  25.921 1.00 . A A .   3 PHE HA   1 1 
        3  5033 1 1   3 PHE HB2  H   8.965   0.453  24.525 1.00 . A A .   3 PHE HB2  1 1 
        3  5034 1 1   3 PHE HB3  H   8.641   0.456  26.250 1.00 . A A .   3 PHE HB3  1 1 
        3  5035 1 1   3 PHE HD1  H   7.095   2.214  27.182 1.00 . A A .   3 PHE HD1  1 1 
        3  5036 1 1   3 PHE HD2  H   7.508   1.485  23.011 1.00 . A A .   3 PHE HD2  1 1 
        3  5037 1 1   3 PHE HE1  H   4.938   3.324  26.778 1.00 . A A .   3 PHE HE1  1 1 
        3  5038 1 1   3 PHE HE2  H   5.351   2.591  22.601 1.00 . A A .   3 PHE HE2  1 1 
        3  5039 1 1   3 PHE HZ   H   4.064   3.513  24.485 1.00 . A A .   3 PHE HZ   1 1 
        3  5040 1 1   3 PHE N    N   9.734   2.972  26.667 1.00 . A A .   3 PHE N    1 1 
        3  5041 1 1   3 PHE O    O   9.583   3.377  23.663 1.00 . A A .   3 PHE O    1 1 
        3  5042 1 1   4 GLU C    C  12.649   2.413  21.768 1.00 . A A .   4 GLU C    1 1 
        3  5043 1 1   4 GLU CA   C  12.259   3.360  22.900 1.00 . A A .   4 GLU CA   1 1 
        3  5044 1 1   4 GLU CB   C  13.485   4.159  23.374 1.00 . A A .   4 GLU CB   1 1 
        3  5045 1 1   4 GLU CD   C  14.291   2.660  25.267 1.00 . A A .   4 GLU CD   1 1 
        3  5046 1 1   4 GLU CG   C  14.624   3.308  23.933 1.00 . A A .   4 GLU CG   1 1 
        3  5047 1 1   4 GLU H    H  12.256   2.054  24.564 1.00 . A A .   4 GLU H    1 1 
        3  5048 1 1   4 GLU HA   H  11.515   4.049  22.531 1.00 . A A .   4 GLU HA   1 1 
        3  5049 1 1   4 GLU HB2  H  13.871   4.728  22.542 1.00 . A A .   4 GLU HB2  1 1 
        3  5050 1 1   4 GLU HB3  H  13.168   4.844  24.148 1.00 . A A .   4 GLU HB3  1 1 
        3  5051 1 1   4 GLU HG2  H  14.851   2.527  23.224 1.00 . A A .   4 GLU HG2  1 1 
        3  5052 1 1   4 GLU HG3  H  15.492   3.937  24.062 1.00 . A A .   4 GLU HG3  1 1 
        3  5053 1 1   4 GLU N    N  11.673   2.631  24.014 1.00 . A A .   4 GLU N    1 1 
        3  5054 1 1   4 GLU O    O  13.286   2.819  20.794 1.00 . A A .   4 GLU O    1 1 
        3  5055 1 1   4 GLU OE1  O  14.513   3.296  26.315 1.00 . A A .   4 GLU OE1  1 1 
        3  5056 1 1   4 GLU OE2  O  13.803   1.509  25.271 1.00 . A A .   4 GLU OE2  1 1 
        3  5057 1 1   5 CYS C    C  11.291  -0.671  20.597 1.00 . A A .   5 CYS C    1 1 
        3  5058 1 1   5 CYS CA   C  12.532   0.170  20.865 1.00 . A A .   5 CYS CA   1 1 
        3  5059 1 1   5 CYS CB   C  13.726  -0.713  21.243 1.00 . A A .   5 CYS CB   1 1 
        3  5060 1 1   5 CYS H    H  11.805   0.876  22.719 1.00 . A A .   5 CYS H    1 1 
        3  5061 1 1   5 CYS HA   H  12.775   0.713  19.963 1.00 . A A .   5 CYS HA   1 1 
        3  5062 1 1   5 CYS HB2  H  13.802  -1.520  20.530 1.00 . A A .   5 CYS HB2  1 1 
        3  5063 1 1   5 CYS HB3  H  14.628  -0.119  21.202 1.00 . A A .   5 CYS HB3  1 1 
        3  5064 1 1   5 CYS HG   H  13.633  -2.768  22.746 1.00 . A A .   5 CYS HG   1 1 
        3  5065 1 1   5 CYS N    N  12.272   1.153  21.904 1.00 . A A .   5 CYS N    1 1 
        3  5066 1 1   5 CYS O    O  11.194  -1.823  21.021 1.00 . A A .   5 CYS O    1 1 
        3  5067 1 1   5 CYS SG   S  13.620  -1.446  22.894 1.00 . A A .   5 CYS SG   1 1 
        3  5068 1 1   6 GLN C    C   9.158  -1.196  18.108 1.00 . A A .   6 GLN C    1 1 
        3  5069 1 1   6 GLN CA   C   9.100  -0.752  19.565 1.00 . A A .   6 GLN CA   1 1 
        3  5070 1 1   6 GLN CB   C   7.865   0.134  19.817 1.00 . A A .   6 GLN CB   1 1 
        3  5071 1 1   6 GLN CD   C   8.752   2.506  20.019 1.00 . A A .   6 GLN CD   1 1 
        3  5072 1 1   6 GLN CG   C   7.934   1.527  19.195 1.00 . A A .   6 GLN CG   1 1 
        3  5073 1 1   6 GLN H    H  10.443   0.868  19.661 1.00 . A A .   6 GLN H    1 1 
        3  5074 1 1   6 GLN HA   H   9.027  -1.633  20.186 1.00 . A A .   6 GLN HA   1 1 
        3  5075 1 1   6 GLN HB2  H   6.996  -0.365  19.416 1.00 . A A .   6 GLN HB2  1 1 
        3  5076 1 1   6 GLN HB3  H   7.736   0.250  20.883 1.00 . A A .   6 GLN HB3  1 1 
        3  5077 1 1   6 GLN HE21 H   7.108   3.112  20.965 1.00 . A A .   6 GLN HE21 1 1 
        3  5078 1 1   6 GLN HE22 H   8.594   3.861  21.454 1.00 . A A .   6 GLN HE22 1 1 
        3  5079 1 1   6 GLN HG2  H   8.382   1.446  18.216 1.00 . A A .   6 GLN HG2  1 1 
        3  5080 1 1   6 GLN HG3  H   6.929   1.912  19.097 1.00 . A A .   6 GLN HG3  1 1 
        3  5081 1 1   6 GLN N    N  10.326  -0.069  19.927 1.00 . A A .   6 GLN N    1 1 
        3  5082 1 1   6 GLN NE2  N   8.088   3.236  20.899 1.00 . A A .   6 GLN NE2  1 1 
        3  5083 1 1   6 GLN O    O   9.130  -0.372  17.191 1.00 . A A .   6 GLN O    1 1 
        3  5084 1 1   6 GLN OE1  O   9.967   2.616  19.852 1.00 . A A .   6 GLN OE1  1 1 
        3  5085 1 1   7 PHE C    C  10.531  -2.666  15.800 1.00 . A A .   7 PHE C    1 1 
        3  5086 1 1   7 PHE CA   C   9.306  -3.118  16.595 1.00 . A A .   7 PHE CA   1 1 
        3  5087 1 1   7 PHE CB   C   8.016  -2.810  15.829 1.00 . A A .   7 PHE CB   1 1 
        3  5088 1 1   7 PHE CD1  C   6.141  -2.873  17.503 1.00 . A A .   7 PHE CD1  1 1 
        3  5089 1 1   7 PHE CD2  C   6.295  -4.635  15.903 1.00 . A A .   7 PHE CD2  1 1 
        3  5090 1 1   7 PHE CE1  C   5.018  -3.463  18.049 1.00 . A A .   7 PHE CE1  1 1 
        3  5091 1 1   7 PHE CE2  C   5.171  -5.230  16.446 1.00 . A A .   7 PHE CE2  1 1 
        3  5092 1 1   7 PHE CG   C   6.793  -3.452  16.424 1.00 . A A .   7 PHE CG   1 1 
        3  5093 1 1   7 PHE CZ   C   4.532  -4.644  17.522 1.00 . A A .   7 PHE CZ   1 1 
        3  5094 1 1   7 PHE H    H   9.365  -3.086  18.701 1.00 . A A .   7 PHE H    1 1 
        3  5095 1 1   7 PHE HA   H   9.372  -4.186  16.738 1.00 . A A .   7 PHE HA   1 1 
        3  5096 1 1   7 PHE HB2  H   7.858  -1.741  15.814 1.00 . A A .   7 PHE HB2  1 1 
        3  5097 1 1   7 PHE HB3  H   8.121  -3.167  14.821 1.00 . A A .   7 PHE HB3  1 1 
        3  5098 1 1   7 PHE HD1  H   6.520  -1.949  17.917 1.00 . A A .   7 PHE HD1  1 1 
        3  5099 1 1   7 PHE HD2  H   6.794  -5.095  15.065 1.00 . A A .   7 PHE HD2  1 1 
        3  5100 1 1   7 PHE HE1  H   4.521  -3.004  18.892 1.00 . A A .   7 PHE HE1  1 1 
        3  5101 1 1   7 PHE HE2  H   4.795  -6.153  16.029 1.00 . A A .   7 PHE HE2  1 1 
        3  5102 1 1   7 PHE HZ   H   3.655  -5.106  17.948 1.00 . A A .   7 PHE HZ   1 1 
        3  5103 1 1   7 PHE N    N   9.277  -2.506  17.917 1.00 . A A .   7 PHE N    1 1 
        3  5104 1 1   7 PHE O    O  11.447  -2.051  16.346 1.00 . A A .   7 PHE O    1 1 
        3  5105 1 1   8 VAL C    C  11.269  -1.608  12.621 1.00 . A A .   8 VAL C    1 1 
        3  5106 1 1   8 VAL CA   C  11.677  -2.651  13.660 1.00 . A A .   8 VAL CA   1 1 
        3  5107 1 1   8 VAL CB   C  12.267  -3.908  12.971 1.00 . A A .   8 VAL CB   1 1 
        3  5108 1 1   8 VAL CG1  C  11.199  -4.672  12.200 1.00 . A A .   8 VAL CG1  1 1 
        3  5109 1 1   8 VAL CG2  C  13.424  -3.533  12.055 1.00 . A A .   8 VAL CG2  1 1 
        3  5110 1 1   8 VAL H    H   9.791  -3.478  14.135 1.00 . A A .   8 VAL H    1 1 
        3  5111 1 1   8 VAL HA   H  12.445  -2.224  14.290 1.00 . A A .   8 VAL HA   1 1 
        3  5112 1 1   8 VAL HB   H  12.650  -4.562  13.741 1.00 . A A .   8 VAL HB   1 1 
        3  5113 1 1   8 VAL HG11 H  11.641  -5.540  11.732 1.00 . A A .   8 VAL HG11 1 1 
        3  5114 1 1   8 VAL HG12 H  10.775  -4.032  11.442 1.00 . A A .   8 VAL HG12 1 1 
        3  5115 1 1   8 VAL HG13 H  10.421  -4.988  12.879 1.00 . A A .   8 VAL HG13 1 1 
        3  5116 1 1   8 VAL HG21 H  14.201  -3.055  12.633 1.00 . A A .   8 VAL HG21 1 1 
        3  5117 1 1   8 VAL HG22 H  13.074  -2.854  11.292 1.00 . A A .   8 VAL HG22 1 1 
        3  5118 1 1   8 VAL HG23 H  13.817  -4.424  11.589 1.00 . A A .   8 VAL HG23 1 1 
        3  5119 1 1   8 VAL N    N  10.553  -2.996  14.518 1.00 . A A .   8 VAL N    1 1 
        3  5120 1 1   8 VAL O    O  10.330  -1.812  11.844 1.00 . A A .   8 VAL O    1 1 
        3  5121 1 1   9 CYS C    C  12.897   0.855  10.795 1.00 . A A .   9 CYS C    1 1 
        3  5122 1 1   9 CYS CA   C  11.688   0.595  11.688 1.00 . A A .   9 CYS CA   1 1 
        3  5123 1 1   9 CYS CB   C  11.302   1.866  12.447 1.00 . A A .   9 CYS CB   1 1 
        3  5124 1 1   9 CYS H    H  12.700  -0.372  13.271 1.00 . A A .   9 CYS H    1 1 
        3  5125 1 1   9 CYS HA   H  10.857   0.288  11.071 1.00 . A A .   9 CYS HA   1 1 
        3  5126 1 1   9 CYS HB2  H  11.202   2.682  11.746 1.00 . A A .   9 CYS HB2  1 1 
        3  5127 1 1   9 CYS HB3  H  10.356   1.708  12.944 1.00 . A A .   9 CYS HB3  1 1 
        3  5128 1 1   9 CYS HG   H  12.029   1.993  14.888 1.00 . A A .   9 CYS HG   1 1 
        3  5129 1 1   9 CYS N    N  11.968  -0.481  12.625 1.00 . A A .   9 CYS N    1 1 
        3  5130 1 1   9 CYS O    O  14.025   0.496  11.142 1.00 . A A .   9 CYS O    1 1 
        3  5131 1 1   9 CYS SG   S  12.502   2.363  13.702 1.00 . A A .   9 CYS SG   1 1 
        3  5132 1 1  10 GLU C    C  13.219   2.803   7.674 1.00 . A A .  10 GLU C    1 1 
        3  5133 1 1  10 GLU CA   C  13.706   1.761   8.681 1.00 . A A .  10 GLU CA   1 1 
        3  5134 1 1  10 GLU CB   C  14.122   0.472   7.954 1.00 . A A .  10 GLU CB   1 1 
        3  5135 1 1  10 GLU CD   C  15.622  -0.624   6.238 1.00 . A A .  10 GLU CD   1 1 
        3  5136 1 1  10 GLU CG   C  15.278   0.650   6.982 1.00 . A A .  10 GLU CG   1 1 
        3  5137 1 1  10 GLU H    H  11.727   1.728   9.428 1.00 . A A .  10 GLU H    1 1 
        3  5138 1 1  10 GLU HA   H  14.553   2.157   9.219 1.00 . A A .  10 GLU HA   1 1 
        3  5139 1 1  10 GLU HB2  H  14.414  -0.262   8.691 1.00 . A A .  10 GLU HB2  1 1 
        3  5140 1 1  10 GLU HB3  H  13.273   0.093   7.403 1.00 . A A .  10 GLU HB3  1 1 
        3  5141 1 1  10 GLU HG2  H  15.010   1.408   6.262 1.00 . A A .  10 GLU HG2  1 1 
        3  5142 1 1  10 GLU HG3  H  16.148   0.973   7.534 1.00 . A A .  10 GLU HG3  1 1 
        3  5143 1 1  10 GLU N    N  12.651   1.467   9.643 1.00 . A A .  10 GLU N    1 1 
        3  5144 1 1  10 GLU O    O  12.016   2.914   7.416 1.00 . A A .  10 GLU O    1 1 
        3  5145 1 1  10 GLU OE1  O  14.877  -0.995   5.310 1.00 . A A .  10 GLU OE1  1 1 
        3  5146 1 1  10 GLU OE2  O  16.647  -1.257   6.571 1.00 . A A .  10 GLU OE2  1 1 
        3  5147 1 1  11 LEU C    C  13.789   3.744   4.751 1.00 . A A .  11 LEU C    1 1 
        3  5148 1 1  11 LEU CA   C  13.813   4.509   6.059 1.00 . A A .  11 LEU CA   1 1 
        3  5149 1 1  11 LEU CB   C  14.841   5.648   5.991 1.00 . A A .  11 LEU CB   1 1 
        3  5150 1 1  11 LEU CD1  C  15.382   8.010   5.382 1.00 . A A .  11 LEU CD1  1 1 
        3  5151 1 1  11 LEU CD2  C  14.630   6.467   3.599 1.00 . A A .  11 LEU CD2  1 1 
        3  5152 1 1  11 LEU CG   C  14.487   6.830   5.072 1.00 . A A .  11 LEU CG   1 1 
        3  5153 1 1  11 LEU H    H  15.073   3.514   7.437 1.00 . A A .  11 LEU H    1 1 
        3  5154 1 1  11 LEU HA   H  12.832   4.917   6.254 1.00 . A A .  11 LEU HA   1 1 
        3  5155 1 1  11 LEU HB2  H  14.981   6.033   6.991 1.00 . A A .  11 LEU HB2  1 1 
        3  5156 1 1  11 LEU HB3  H  15.780   5.234   5.655 1.00 . A A .  11 LEU HB3  1 1 
        3  5157 1 1  11 LEU HD11 H  15.224   8.320   6.403 1.00 . A A .  11 LEU HD11 1 1 
        3  5158 1 1  11 LEU HD12 H  15.144   8.823   4.713 1.00 . A A .  11 LEU HD12 1 1 
        3  5159 1 1  11 LEU HD13 H  16.414   7.721   5.246 1.00 . A A .  11 LEU HD13 1 1 
        3  5160 1 1  11 LEU HD21 H  14.357   7.316   2.992 1.00 . A A .  11 LEU HD21 1 1 
        3  5161 1 1  11 LEU HD22 H  13.980   5.636   3.370 1.00 . A A .  11 LEU HD22 1 1 
        3  5162 1 1  11 LEU HD23 H  15.654   6.191   3.395 1.00 . A A .  11 LEU HD23 1 1 
        3  5163 1 1  11 LEU HG   H  13.463   7.126   5.250 1.00 . A A .  11 LEU HG   1 1 
        3  5164 1 1  11 LEU N    N  14.145   3.578   7.125 1.00 . A A .  11 LEU N    1 1 
        3  5165 1 1  11 LEU O    O  14.761   3.067   4.404 1.00 . A A .  11 LEU O    1 1 
        3  5166 1 1  12 LYS C    C  12.227   3.968   1.620 1.00 . A A .  12 LYS C    1 1 
        3  5167 1 1  12 LYS CA   C  12.571   3.080   2.803 1.00 . A A .  12 LYS CA   1 1 
        3  5168 1 1  12 LYS CB   C  11.516   1.987   2.962 1.00 . A A .  12 LYS CB   1 1 
        3  5169 1 1  12 LYS CD   C  12.643  -0.177   2.293 1.00 . A A .  12 LYS CD   1 1 
        3  5170 1 1  12 LYS CE   C  14.062   0.361   2.225 1.00 . A A .  12 LYS CE   1 1 
        3  5171 1 1  12 LYS CG   C  11.602   0.876   1.924 1.00 . A A .  12 LYS CG   1 1 
        3  5172 1 1  12 LYS H    H  11.965   4.436   4.304 1.00 . A A .  12 LYS H    1 1 
        3  5173 1 1  12 LYS HA   H  13.529   2.620   2.619 1.00 . A A .  12 LYS HA   1 1 
        3  5174 1 1  12 LYS HB2  H  11.623   1.541   3.941 1.00 . A A .  12 LYS HB2  1 1 
        3  5175 1 1  12 LYS HB3  H  10.538   2.439   2.891 1.00 . A A .  12 LYS HB3  1 1 
        3  5176 1 1  12 LYS HD2  H  12.451  -0.520   3.298 1.00 . A A .  12 LYS HD2  1 1 
        3  5177 1 1  12 LYS HD3  H  12.553  -1.009   1.608 1.00 . A A .  12 LYS HD3  1 1 
        3  5178 1 1  12 LYS HE2  H  14.282   0.635   1.203 1.00 . A A .  12 LYS HE2  1 1 
        3  5179 1 1  12 LYS HE3  H  14.129   1.238   2.853 1.00 . A A .  12 LYS HE3  1 1 
        3  5180 1 1  12 LYS HG2  H  10.638   0.398   1.844 1.00 . A A .  12 LYS HG2  1 1 
        3  5181 1 1  12 LYS HG3  H  11.869   1.312   0.973 1.00 . A A .  12 LYS HG3  1 1 
        3  5182 1 1  12 LYS HZ1  H  16.024  -0.261   2.562 1.00 . A A .  12 LYS HZ1  1 1 
        3  5183 1 1  12 LYS HZ2  H  14.969  -1.518   2.127 1.00 . A A .  12 LYS HZ2  1 1 
        3  5184 1 1  12 LYS HZ3  H  14.909  -0.860   3.692 1.00 . A A .  12 LYS HZ3  1 1 
        3  5185 1 1  12 LYS N    N  12.695   3.842   4.021 1.00 . A A .  12 LYS N    1 1 
        3  5186 1 1  12 LYS NZ   N  15.059  -0.638   2.681 1.00 . A A .  12 LYS NZ   1 1 
        3  5187 1 1  12 LYS O    O  11.299   4.778   1.679 1.00 . A A .  12 LYS O    1 1 
        3  5188 1 1  13 GLU C    C  11.961   3.498  -1.608 1.00 . A A .  13 GLU C    1 1 
        3  5189 1 1  13 GLU CA   C  12.718   4.468  -0.703 1.00 . A A .  13 GLU CA   1 1 
        3  5190 1 1  13 GLU CB   C  14.021   4.932  -1.356 1.00 . A A .  13 GLU CB   1 1 
        3  5191 1 1  13 GLU CD   C  16.169   6.235  -1.065 1.00 . A A .  13 GLU CD   1 1 
        3  5192 1 1  13 GLU CG   C  14.836   5.852  -0.461 1.00 . A A .  13 GLU CG   1 1 
        3  5193 1 1  13 GLU H    H  13.810   3.262   0.638 1.00 . A A .  13 GLU H    1 1 
        3  5194 1 1  13 GLU HA   H  12.091   5.326  -0.507 1.00 . A A .  13 GLU HA   1 1 
        3  5195 1 1  13 GLU HB2  H  14.622   4.066  -1.593 1.00 . A A .  13 GLU HB2  1 1 
        3  5196 1 1  13 GLU HB3  H  13.789   5.461  -2.267 1.00 . A A .  13 GLU HB3  1 1 
        3  5197 1 1  13 GLU HG2  H  14.271   6.754  -0.283 1.00 . A A .  13 GLU HG2  1 1 
        3  5198 1 1  13 GLU HG3  H  15.015   5.350   0.480 1.00 . A A .  13 GLU HG3  1 1 
        3  5199 1 1  13 GLU N    N  13.003   3.820   0.561 1.00 . A A .  13 GLU N    1 1 
        3  5200 1 1  13 GLU O    O  12.381   2.353  -1.795 1.00 . A A .  13 GLU O    1 1 
        3  5201 1 1  13 GLU OE1  O  17.140   5.461  -0.911 1.00 . A A .  13 GLU OE1  1 1 
        3  5202 1 1  13 GLU OE2  O  16.259   7.318  -1.679 1.00 . A A .  13 GLU OE2  1 1 
        3  5203 1 1  14 LEU C    C  10.206   3.192  -4.400 1.00 . A A .  14 LEU C    1 1 
        3  5204 1 1  14 LEU CA   C   9.943   3.089  -2.903 1.00 . A A .  14 LEU CA   1 1 
        3  5205 1 1  14 LEU CB   C   8.472   3.441  -2.619 1.00 . A A .  14 LEU CB   1 1 
        3  5206 1 1  14 LEU CD1  C   8.291   1.687  -0.823 1.00 . A A .  14 LEU CD1  1 1 
        3  5207 1 1  14 LEU CD2  C   8.491   4.103  -0.179 1.00 . A A .  14 LEU CD2  1 1 
        3  5208 1 1  14 LEU CG   C   7.950   3.118  -1.209 1.00 . A A .  14 LEU CG   1 1 
        3  5209 1 1  14 LEU H    H  10.618   4.905  -2.044 1.00 . A A .  14 LEU H    1 1 
        3  5210 1 1  14 LEU HA   H  10.123   2.072  -2.590 1.00 . A A .  14 LEU HA   1 1 
        3  5211 1 1  14 LEU HB2  H   8.345   4.500  -2.787 1.00 . A A .  14 LEU HB2  1 1 
        3  5212 1 1  14 LEU HB3  H   7.858   2.910  -3.331 1.00 . A A .  14 LEU HB3  1 1 
        3  5213 1 1  14 LEU HD11 H   7.818   1.006  -1.515 1.00 . A A .  14 LEU HD11 1 1 
        3  5214 1 1  14 LEU HD12 H   7.936   1.489   0.179 1.00 . A A .  14 LEU HD12 1 1 
        3  5215 1 1  14 LEU HD13 H   9.362   1.550  -0.859 1.00 . A A .  14 LEU HD13 1 1 
        3  5216 1 1  14 LEU HD21 H   8.180   5.104  -0.439 1.00 . A A .  14 LEU HD21 1 1 
        3  5217 1 1  14 LEU HD22 H   9.569   4.054  -0.168 1.00 . A A .  14 LEU HD22 1 1 
        3  5218 1 1  14 LEU HD23 H   8.108   3.849   0.799 1.00 . A A .  14 LEU HD23 1 1 
        3  5219 1 1  14 LEU HG   H   6.872   3.205  -1.213 1.00 . A A .  14 LEU HG   1 1 
        3  5220 1 1  14 LEU N    N  10.840   3.952  -2.145 1.00 . A A .  14 LEU N    1 1 
        3  5221 1 1  14 LEU O    O  10.446   4.282  -4.925 1.00 . A A .  14 LEU O    1 1 
        3  5222 1 1  15 ALA C    C   8.972   1.610  -7.168 1.00 . A A .  15 ALA C    1 1 
        3  5223 1 1  15 ALA CA   C  10.297   2.015  -6.525 1.00 . A A .  15 ALA CA   1 1 
        3  5224 1 1  15 ALA CB   C  11.407   1.057  -6.932 1.00 . A A .  15 ALA CB   1 1 
        3  5225 1 1  15 ALA H    H  10.037   1.210  -4.589 1.00 . A A .  15 ALA H    1 1 
        3  5226 1 1  15 ALA HA   H  10.565   3.007  -6.863 1.00 . A A .  15 ALA HA   1 1 
        3  5227 1 1  15 ALA HB1  H  11.503   1.057  -8.007 1.00 . A A .  15 ALA HB1  1 1 
        3  5228 1 1  15 ALA HB2  H  11.165   0.060  -6.592 1.00 . A A .  15 ALA HB2  1 1 
        3  5229 1 1  15 ALA HB3  H  12.339   1.373  -6.487 1.00 . A A .  15 ALA HB3  1 1 
        3  5230 1 1  15 ALA N    N  10.162   2.054  -5.078 1.00 . A A .  15 ALA N    1 1 
        3  5231 1 1  15 ALA O    O   8.224   0.803  -6.609 1.00 . A A .  15 ALA O    1 1 
        3  5232 1 1  16 PRO C    C   7.202   0.531  -9.569 1.00 . A A .  16 PRO C    1 1 
        3  5233 1 1  16 PRO CA   C   7.381   1.950  -9.028 1.00 . A A .  16 PRO CA   1 1 
        3  5234 1 1  16 PRO CB   C   7.423   2.951 -10.188 1.00 . A A .  16 PRO CB   1 1 
        3  5235 1 1  16 PRO CD   C   9.553   3.060  -9.119 1.00 . A A .  16 PRO CD   1 1 
        3  5236 1 1  16 PRO CG   C   8.870   3.162 -10.453 1.00 . A A .  16 PRO CG   1 1 
        3  5237 1 1  16 PRO HA   H   6.551   2.192  -8.379 1.00 . A A .  16 PRO HA   1 1 
        3  5238 1 1  16 PRO HB2  H   6.919   2.533 -11.048 1.00 . A A .  16 PRO HB2  1 1 
        3  5239 1 1  16 PRO HB3  H   6.937   3.871  -9.892 1.00 . A A .  16 PRO HB3  1 1 
        3  5240 1 1  16 PRO HD2  H  10.534   2.626  -9.228 1.00 . A A .  16 PRO HD2  1 1 
        3  5241 1 1  16 PRO HD3  H   9.618   4.032  -8.652 1.00 . A A .  16 PRO HD3  1 1 
        3  5242 1 1  16 PRO HG2  H   9.235   2.398 -11.123 1.00 . A A .  16 PRO HG2  1 1 
        3  5243 1 1  16 PRO HG3  H   9.026   4.142 -10.881 1.00 . A A .  16 PRO HG3  1 1 
        3  5244 1 1  16 PRO N    N   8.667   2.167  -8.350 1.00 . A A .  16 PRO N    1 1 
        3  5245 1 1  16 PRO O    O   8.160  -0.108 -10.014 1.00 . A A .  16 PRO O    1 1 
        3  5246 1 1  17 VAL C    C   4.221  -1.090 -10.760 1.00 . A A .  17 VAL C    1 1 
        3  5247 1 1  17 VAL CA   C   5.606  -1.228 -10.116 1.00 . A A .  17 VAL CA   1 1 
        3  5248 1 1  17 VAL CB   C   5.614  -2.372  -9.060 1.00 . A A .  17 VAL CB   1 1 
        3  5249 1 1  17 VAL CG1  C   4.702  -2.048  -7.888 1.00 . A A .  17 VAL CG1  1 1 
        3  5250 1 1  17 VAL CG2  C   5.235  -3.712  -9.674 1.00 . A A .  17 VAL CG2  1 1 
        3  5251 1 1  17 VAL H    H   5.280   0.553  -9.028 1.00 . A A .  17 VAL H    1 1 
        3  5252 1 1  17 VAL HA   H   6.333  -1.455 -10.883 1.00 . A A .  17 VAL HA   1 1 
        3  5253 1 1  17 VAL HB   H   6.622  -2.457  -8.676 1.00 . A A .  17 VAL HB   1 1 
        3  5254 1 1  17 VAL HG11 H   4.717  -2.867  -7.182 1.00 . A A .  17 VAL HG11 1 1 
        3  5255 1 1  17 VAL HG12 H   3.695  -1.902  -8.246 1.00 . A A .  17 VAL HG12 1 1 
        3  5256 1 1  17 VAL HG13 H   5.045  -1.148  -7.402 1.00 . A A .  17 VAL HG13 1 1 
        3  5257 1 1  17 VAL HG21 H   4.251  -3.638 -10.113 1.00 . A A .  17 VAL HG21 1 1 
        3  5258 1 1  17 VAL HG22 H   5.232  -4.471  -8.906 1.00 . A A .  17 VAL HG22 1 1 
        3  5259 1 1  17 VAL HG23 H   5.952  -3.973 -10.438 1.00 . A A .  17 VAL HG23 1 1 
        3  5260 1 1  17 VAL N    N   5.971   0.041  -9.508 1.00 . A A .  17 VAL N    1 1 
        3  5261 1 1  17 VAL O    O   3.363  -0.381 -10.228 1.00 . A A .  17 VAL O    1 1 
        3  5262 1 1  18 PRO C    C   1.556  -2.209 -11.756 1.00 . A A .  18 PRO C    1 1 
        3  5263 1 1  18 PRO CA   C   2.698  -1.681 -12.623 1.00 . A A .  18 PRO CA   1 1 
        3  5264 1 1  18 PRO CB   C   2.902  -2.580 -13.851 1.00 . A A .  18 PRO CB   1 1 
        3  5265 1 1  18 PRO CD   C   4.989  -2.490 -12.696 1.00 . A A .  18 PRO CD   1 1 
        3  5266 1 1  18 PRO CG   C   4.136  -3.368 -13.563 1.00 . A A .  18 PRO CG   1 1 
        3  5267 1 1  18 PRO HA   H   2.459  -0.678 -12.948 1.00 . A A .  18 PRO HA   1 1 
        3  5268 1 1  18 PRO HB2  H   2.044  -3.224 -13.976 1.00 . A A .  18 PRO HB2  1 1 
        3  5269 1 1  18 PRO HB3  H   3.026  -1.966 -14.730 1.00 . A A .  18 PRO HB3  1 1 
        3  5270 1 1  18 PRO HD2  H   5.604  -3.089 -12.041 1.00 . A A .  18 PRO HD2  1 1 
        3  5271 1 1  18 PRO HD3  H   5.601  -1.837 -13.301 1.00 . A A .  18 PRO HD3  1 1 
        3  5272 1 1  18 PRO HG2  H   3.879  -4.277 -13.040 1.00 . A A .  18 PRO HG2  1 1 
        3  5273 1 1  18 PRO HG3  H   4.649  -3.596 -14.485 1.00 . A A .  18 PRO HG3  1 1 
        3  5274 1 1  18 PRO N    N   3.995  -1.722 -11.932 1.00 . A A .  18 PRO N    1 1 
        3  5275 1 1  18 PRO O    O   1.625  -3.320 -11.219 1.00 . A A .  18 PRO O    1 1 
        3  5276 1 1  19 ALA C    C  -1.919  -1.159 -11.285 1.00 . A A .  19 ALA C    1 1 
        3  5277 1 1  19 ALA CA   C  -0.613  -1.753 -10.770 1.00 . A A .  19 ALA CA   1 1 
        3  5278 1 1  19 ALA CB   C  -0.337  -1.268  -9.352 1.00 . A A .  19 ALA CB   1 1 
        3  5279 1 1  19 ALA H    H   0.470  -0.575 -12.151 1.00 . A A .  19 ALA H    1 1 
        3  5280 1 1  19 ALA HA   H  -0.703  -2.828 -10.744 1.00 . A A .  19 ALA HA   1 1 
        3  5281 1 1  19 ALA HB1  H  -1.153  -1.555  -8.708 1.00 . A A .  19 ALA HB1  1 1 
        3  5282 1 1  19 ALA HB2  H  -0.237  -0.192  -9.351 1.00 . A A .  19 ALA HB2  1 1 
        3  5283 1 1  19 ALA HB3  H   0.579  -1.713  -8.991 1.00 . A A .  19 ALA HB3  1 1 
        3  5284 1 1  19 ALA N    N   0.502  -1.414 -11.636 1.00 . A A .  19 ALA N    1 1 
        3  5285 1 1  19 ALA O    O  -1.921  -0.161 -12.008 1.00 . A A .  19 ALA O    1 1 
        3  5286 1 1  20 LEU C    C  -4.971  -0.782  -9.887 1.00 . A A .  20 LEU C    1 1 
        3  5287 1 1  20 LEU CA   C  -4.352  -1.252 -11.192 1.00 . A A .  20 LEU CA   1 1 
        3  5288 1 1  20 LEU CB   C  -5.274  -2.286 -11.852 1.00 . A A .  20 LEU CB   1 1 
        3  5289 1 1  20 LEU CD1  C  -3.856  -3.097 -13.766 1.00 . A A .  20 LEU CD1  1 1 
        3  5290 1 1  20 LEU CD2  C  -6.350  -3.166 -13.932 1.00 . A A .  20 LEU CD2  1 1 
        3  5291 1 1  20 LEU CG   C  -5.154  -2.414 -13.372 1.00 . A A .  20 LEU CG   1 1 
        3  5292 1 1  20 LEU H    H  -2.946  -2.654 -10.450 1.00 . A A .  20 LEU H    1 1 
        3  5293 1 1  20 LEU HA   H  -4.239  -0.403 -11.851 1.00 . A A .  20 LEU HA   1 1 
        3  5294 1 1  20 LEU HB2  H  -5.062  -3.250 -11.417 1.00 . A A .  20 LEU HB2  1 1 
        3  5295 1 1  20 LEU HB3  H  -6.295  -2.022 -11.618 1.00 . A A .  20 LEU HB3  1 1 
        3  5296 1 1  20 LEU HD11 H  -3.833  -4.092 -13.346 1.00 . A A .  20 LEU HD11 1 1 
        3  5297 1 1  20 LEU HD12 H  -3.020  -2.527 -13.388 1.00 . A A .  20 LEU HD12 1 1 
        3  5298 1 1  20 LEU HD13 H  -3.794  -3.158 -14.842 1.00 . A A .  20 LEU HD13 1 1 
        3  5299 1 1  20 LEU HD21 H  -6.372  -4.165 -13.520 1.00 . A A .  20 LEU HD21 1 1 
        3  5300 1 1  20 LEU HD22 H  -6.270  -3.222 -15.007 1.00 . A A .  20 LEU HD22 1 1 
        3  5301 1 1  20 LEU HD23 H  -7.259  -2.646 -13.665 1.00 . A A .  20 LEU HD23 1 1 
        3  5302 1 1  20 LEU HG   H  -5.151  -1.425 -13.809 1.00 . A A .  20 LEU HG   1 1 
        3  5303 1 1  20 LEU N    N  -3.025  -1.795 -10.923 1.00 . A A .  20 LEU N    1 1 
        3  5304 1 1  20 LEU O    O  -4.862  -1.464  -8.866 1.00 . A A .  20 LEU O    1 1 
        3  5305 1 1  21 LEU C    C  -7.446   1.730  -8.972 1.00 . A A .  21 LEU C    1 1 
        3  5306 1 1  21 LEU CA   C  -6.169   0.946  -8.695 1.00 . A A .  21 LEU CA   1 1 
        3  5307 1 1  21 LEU CB   C  -5.123   1.823  -7.947 1.00 . A A .  21 LEU CB   1 1 
        3  5308 1 1  21 LEU CD1  C  -3.971   2.791 -10.018 1.00 . A A .  21 LEU CD1  1 1 
        3  5309 1 1  21 LEU CD2  C  -5.598   4.201  -8.735 1.00 . A A .  21 LEU CD2  1 1 
        3  5310 1 1  21 LEU CG   C  -4.557   3.091  -8.646 1.00 . A A .  21 LEU CG   1 1 
        3  5311 1 1  21 LEU H    H  -5.720   0.854 -10.768 1.00 . A A .  21 LEU H    1 1 
        3  5312 1 1  21 LEU HA   H  -6.428   0.117  -8.053 1.00 . A A .  21 LEU HA   1 1 
        3  5313 1 1  21 LEU HB2  H  -5.571   2.142  -7.019 1.00 . A A .  21 LEU HB2  1 1 
        3  5314 1 1  21 LEU HB3  H  -4.285   1.184  -7.704 1.00 . A A .  21 LEU HB3  1 1 
        3  5315 1 1  21 LEU HD11 H  -3.586   3.701 -10.452 1.00 . A A .  21 LEU HD11 1 1 
        3  5316 1 1  21 LEU HD12 H  -4.741   2.384 -10.658 1.00 . A A .  21 LEU HD12 1 1 
        3  5317 1 1  21 LEU HD13 H  -3.170   2.072  -9.917 1.00 . A A .  21 LEU HD13 1 1 
        3  5318 1 1  21 LEU HD21 H  -5.894   4.497  -7.739 1.00 . A A .  21 LEU HD21 1 1 
        3  5319 1 1  21 LEU HD22 H  -6.462   3.840  -9.275 1.00 . A A .  21 LEU HD22 1 1 
        3  5320 1 1  21 LEU HD23 H  -5.177   5.049  -9.253 1.00 . A A .  21 LEU HD23 1 1 
        3  5321 1 1  21 LEU HG   H  -3.745   3.468  -8.037 1.00 . A A .  21 LEU HG   1 1 
        3  5322 1 1  21 LEU N    N  -5.614   0.375  -9.912 1.00 . A A .  21 LEU N    1 1 
        3  5323 1 1  21 LEU O    O  -7.692   2.168 -10.095 1.00 . A A .  21 LEU O    1 1 
        3  5324 1 1  22 ILE C    C  -9.149   3.997  -7.189 1.00 . A A .  22 ILE C    1 1 
        3  5325 1 1  22 ILE CA   C  -9.429   2.738  -7.994 1.00 . A A .  22 ILE CA   1 1 
        3  5326 1 1  22 ILE CB   C -10.694   2.049  -7.436 1.00 . A A .  22 ILE CB   1 1 
        3  5327 1 1  22 ILE CD1  C -12.178  -0.012  -7.664 1.00 . A A .  22 ILE CD1  1 1 
        3  5328 1 1  22 ILE CG1  C -10.968   0.742  -8.182 1.00 . A A .  22 ILE CG1  1 1 
        3  5329 1 1  22 ILE CG2  C -11.894   2.981  -7.537 1.00 . A A .  22 ILE CG2  1 1 
        3  5330 1 1  22 ILE H    H  -8.073   1.390  -7.111 1.00 . A A .  22 ILE H    1 1 
        3  5331 1 1  22 ILE HA   H  -9.603   3.006  -9.027 1.00 . A A .  22 ILE HA   1 1 
        3  5332 1 1  22 ILE HB   H -10.527   1.830  -6.392 1.00 . A A .  22 ILE HB   1 1 
        3  5333 1 1  22 ILE HD11 H -13.059   0.601  -7.777 1.00 . A A .  22 ILE HD11 1 1 
        3  5334 1 1  22 ILE HD12 H -12.034  -0.248  -6.620 1.00 . A A .  22 ILE HD12 1 1 
        3  5335 1 1  22 ILE HD13 H -12.301  -0.926  -8.226 1.00 . A A .  22 ILE HD13 1 1 
        3  5336 1 1  22 ILE HG12 H -11.136   0.958  -9.227 1.00 . A A .  22 ILE HG12 1 1 
        3  5337 1 1  22 ILE HG13 H -10.109   0.095  -8.087 1.00 . A A .  22 ILE HG13 1 1 
        3  5338 1 1  22 ILE HG21 H -12.062   3.239  -8.572 1.00 . A A .  22 ILE HG21 1 1 
        3  5339 1 1  22 ILE HG22 H -11.700   3.879  -6.970 1.00 . A A .  22 ILE HG22 1 1 
        3  5340 1 1  22 ILE HG23 H -12.769   2.487  -7.142 1.00 . A A .  22 ILE HG23 1 1 
        3  5341 1 1  22 ILE N    N  -8.263   1.874  -7.938 1.00 . A A .  22 ILE N    1 1 
        3  5342 1 1  22 ILE O    O  -8.960   3.933  -5.975 1.00 . A A .  22 ILE O    1 1 
        3  5343 1 1  23 ARG C    C -10.082   6.959  -6.588 1.00 . A A .  23 ARG C    1 1 
        3  5344 1 1  23 ARG CA   C  -8.816   6.396  -7.217 1.00 . A A .  23 ARG CA   1 1 
        3  5345 1 1  23 ARG CB   C  -8.218   7.389  -8.216 1.00 . A A .  23 ARG CB   1 1 
        3  5346 1 1  23 ARG CD   C  -8.355   8.505 -10.454 1.00 . A A .  23 ARG CD   1 1 
        3  5347 1 1  23 ARG CG   C  -8.978   7.480  -9.529 1.00 . A A .  23 ARG CG   1 1 
        3  5348 1 1  23 ARG CZ   C  -8.595   9.297 -12.774 1.00 . A A .  23 ARG CZ   1 1 
        3  5349 1 1  23 ARG H    H  -9.266   5.112  -8.833 1.00 . A A .  23 ARG H    1 1 
        3  5350 1 1  23 ARG HA   H  -8.095   6.210  -6.435 1.00 . A A .  23 ARG HA   1 1 
        3  5351 1 1  23 ARG HB2  H  -8.207   8.370  -7.767 1.00 . A A .  23 ARG HB2  1 1 
        3  5352 1 1  23 ARG HB3  H  -7.203   7.094  -8.434 1.00 . A A .  23 ARG HB3  1 1 
        3  5353 1 1  23 ARG HD2  H  -8.464   9.484 -10.010 1.00 . A A .  23 ARG HD2  1 1 
        3  5354 1 1  23 ARG HD3  H  -7.304   8.280 -10.567 1.00 . A A .  23 ARG HD3  1 1 
        3  5355 1 1  23 ARG HE   H  -9.725   7.874 -11.921 1.00 . A A .  23 ARG HE   1 1 
        3  5356 1 1  23 ARG HG2  H  -8.959   6.516 -10.013 1.00 . A A .  23 ARG HG2  1 1 
        3  5357 1 1  23 ARG HG3  H -10.001   7.764  -9.326 1.00 . A A .  23 ARG HG3  1 1 
        3  5358 1 1  23 ARG HH11 H  -7.224  10.325 -11.677 1.00 . A A .  23 ARG HH11 1 1 
        3  5359 1 1  23 ARG HH12 H  -7.347  10.789 -13.352 1.00 . A A .  23 ARG HH12 1 1 
        3  5360 1 1  23 ARG HH21 H  -9.905   8.522 -14.119 1.00 . A A .  23 ARG HH21 1 1 
        3  5361 1 1  23 ARG HH22 H  -8.867   9.790 -14.718 1.00 . A A .  23 ARG HH22 1 1 
        3  5362 1 1  23 ARG N    N  -9.100   5.128  -7.869 1.00 . A A .  23 ARG N    1 1 
        3  5363 1 1  23 ARG NE   N  -8.983   8.511 -11.772 1.00 . A A .  23 ARG NE   1 1 
        3  5364 1 1  23 ARG NH1  N  -7.650  10.211 -12.583 1.00 . A A .  23 ARG NH1  1 1 
        3  5365 1 1  23 ARG NH2  N  -9.169   9.195 -13.962 1.00 . A A .  23 ARG NH2  1 1 
        3  5366 1 1  23 ARG O    O -11.004   7.387  -7.283 1.00 . A A .  23 ARG O    1 1 
        3  5367 1 1  24 THR C    C -10.973   8.397  -3.488 1.00 . A A .  24 THR C    1 1 
        3  5368 1 1  24 THR CA   C -11.321   7.360  -4.551 1.00 . A A .  24 THR CA   1 1 
        3  5369 1 1  24 THR CB   C -11.995   6.145  -3.881 1.00 . A A .  24 THR CB   1 1 
        3  5370 1 1  24 THR CG2  C -13.300   6.537  -3.207 1.00 . A A .  24 THR CG2  1 1 
        3  5371 1 1  24 THR H    H  -9.346   6.634  -4.757 1.00 . A A .  24 THR H    1 1 
        3  5372 1 1  24 THR HA   H -12.015   7.790  -5.260 1.00 . A A .  24 THR HA   1 1 
        3  5373 1 1  24 THR HB   H -11.324   5.751  -3.130 1.00 . A A .  24 THR HB   1 1 
        3  5374 1 1  24 THR HG1  H -11.574   5.172  -5.542 1.00 . A A .  24 THR HG1  1 1 
        3  5375 1 1  24 THR HG21 H -13.989   6.908  -3.949 1.00 . A A .  24 THR HG21 1 1 
        3  5376 1 1  24 THR HG22 H -13.109   7.308  -2.475 1.00 . A A .  24 THR HG22 1 1 
        3  5377 1 1  24 THR HG23 H -13.725   5.674  -2.718 1.00 . A A .  24 THR HG23 1 1 
        3  5378 1 1  24 THR N    N -10.135   6.938  -5.269 1.00 . A A .  24 THR N    1 1 
        3  5379 1 1  24 THR O    O  -9.886   8.374  -2.926 1.00 . A A .  24 THR O    1 1 
        3  5380 1 1  24 THR OG1  O -12.249   5.128  -4.859 1.00 . A A .  24 THR OG1  1 1 
        3  5381 1 1  25 GLN C    C -12.704   9.819  -1.018 1.00 . A A .  25 GLN C    1 1 
        3  5382 1 1  25 GLN CA   C -11.735  10.236  -2.116 1.00 . A A .  25 GLN CA   1 1 
        3  5383 1 1  25 GLN CB   C -12.012  11.675  -2.541 1.00 . A A .  25 GLN CB   1 1 
        3  5384 1 1  25 GLN CD   C -11.486  13.552  -4.142 1.00 . A A .  25 GLN CD   1 1 
        3  5385 1 1  25 GLN CG   C -11.325  12.077  -3.836 1.00 . A A .  25 GLN CG   1 1 
        3  5386 1 1  25 GLN H    H -12.675   9.389  -3.805 1.00 . A A .  25 GLN H    1 1 
        3  5387 1 1  25 GLN HA   H -10.721  10.157  -1.746 1.00 . A A .  25 GLN HA   1 1 
        3  5388 1 1  25 GLN HB2  H -13.077  11.799  -2.670 1.00 . A A .  25 GLN HB2  1 1 
        3  5389 1 1  25 GLN HB3  H -11.675  12.338  -1.758 1.00 . A A .  25 GLN HB3  1 1 
        3  5390 1 1  25 GLN HE21 H  -9.762  13.954  -3.243 1.00 . A A .  25 GLN HE21 1 1 
        3  5391 1 1  25 GLN HE22 H -10.603  15.311  -3.903 1.00 . A A .  25 GLN HE22 1 1 
        3  5392 1 1  25 GLN HG2  H -10.271  11.852  -3.756 1.00 . A A .  25 GLN HG2  1 1 
        3  5393 1 1  25 GLN HG3  H -11.753  11.507  -4.648 1.00 . A A .  25 GLN HG3  1 1 
        3  5394 1 1  25 GLN N    N -11.884   9.321  -3.233 1.00 . A A .  25 GLN N    1 1 
        3  5395 1 1  25 GLN NE2  N -10.521  14.353  -3.721 1.00 . A A .  25 GLN NE2  1 1 
        3  5396 1 1  25 GLN O    O -13.907   9.709  -1.260 1.00 . A A .  25 GLN O    1 1 
        3  5397 1 1  25 GLN OE1  O -12.461  13.966  -4.768 1.00 . A A .  25 GLN OE1  1 1 
        3  5398 1 1  26 THR C    C -13.036   9.986   2.448 1.00 . A A .  26 THR C    1 1 
        3  5399 1 1  26 THR CA   C -13.035   9.053   1.246 1.00 . A A .  26 THR CA   1 1 
        3  5400 1 1  26 THR CB   C -12.583   7.642   1.690 1.00 . A A .  26 THR CB   1 1 
        3  5401 1 1  26 THR CG2  C -11.201   7.690   2.321 1.00 . A A .  26 THR CG2  1 1 
        3  5402 1 1  26 THR H    H -11.241   9.741   0.345 1.00 . A A .  26 THR H    1 1 
        3  5403 1 1  26 THR HA   H -14.044   8.978   0.866 1.00 . A A .  26 THR HA   1 1 
        3  5404 1 1  26 THR HB   H -12.540   7.004   0.819 1.00 . A A .  26 THR HB   1 1 
        3  5405 1 1  26 THR HG1  H -13.111   7.060   3.502 1.00 . A A .  26 THR HG1  1 1 
        3  5406 1 1  26 THR HG21 H -11.225   8.330   3.191 1.00 . A A .  26 THR HG21 1 1 
        3  5407 1 1  26 THR HG22 H -10.492   8.081   1.606 1.00 . A A .  26 THR HG22 1 1 
        3  5408 1 1  26 THR HG23 H -10.905   6.694   2.615 1.00 . A A .  26 THR HG23 1 1 
        3  5409 1 1  26 THR N    N -12.194   9.568   0.176 1.00 . A A .  26 THR N    1 1 
        3  5410 1 1  26 THR O    O -12.139  10.819   2.605 1.00 . A A .  26 THR O    1 1 
        3  5411 1 1  26 THR OG1  O -13.516   7.088   2.628 1.00 . A A .  26 THR OG1  1 1 
        3  5412 1 1  27 ALA C    C -13.561   9.762   5.661 1.00 . A A .  27 ALA C    1 1 
        3  5413 1 1  27 ALA CA   C -14.140  10.588   4.521 1.00 . A A .  27 ALA CA   1 1 
        3  5414 1 1  27 ALA CB   C -15.579  10.973   4.820 1.00 . A A .  27 ALA CB   1 1 
        3  5415 1 1  27 ALA H    H -14.768   9.207   3.058 1.00 . A A .  27 ALA H    1 1 
        3  5416 1 1  27 ALA HA   H -13.560  11.492   4.410 1.00 . A A .  27 ALA HA   1 1 
        3  5417 1 1  27 ALA HB1  H -15.976  11.549   3.998 1.00 . A A .  27 ALA HB1  1 1 
        3  5418 1 1  27 ALA HB2  H -15.613  11.565   5.724 1.00 . A A .  27 ALA HB2  1 1 
        3  5419 1 1  27 ALA HB3  H -16.170  10.080   4.952 1.00 . A A .  27 ALA HB3  1 1 
        3  5420 1 1  27 ALA N    N -14.056   9.843   3.282 1.00 . A A .  27 ALA N    1 1 
        3  5421 1 1  27 ALA O    O -13.323   8.561   5.509 1.00 . A A .  27 ALA O    1 1 
        3  5422 1 1  28 MET C    C -13.474   8.526   8.417 1.00 . A A .  28 MET C    1 1 
        3  5423 1 1  28 MET CA   C -12.718   9.769   7.955 1.00 . A A .  28 MET CA   1 1 
        3  5424 1 1  28 MET CB   C -12.605  10.771   9.111 1.00 . A A .  28 MET CB   1 1 
        3  5425 1 1  28 MET CE   C -10.766  10.541  12.849 1.00 . A A .  28 MET CE   1 1 
        3  5426 1 1  28 MET CG   C -11.852  10.237  10.321 1.00 . A A .  28 MET CG   1 1 
        3  5427 1 1  28 MET H    H -13.635  11.343   6.874 1.00 . A A .  28 MET H    1 1 
        3  5428 1 1  28 MET HA   H -11.724   9.475   7.654 1.00 . A A .  28 MET HA   1 1 
        3  5429 1 1  28 MET HB2  H -12.093  11.654   8.757 1.00 . A A .  28 MET HB2  1 1 
        3  5430 1 1  28 MET HB3  H -13.600  11.048   9.428 1.00 . A A .  28 MET HB3  1 1 
        3  5431 1 1  28 MET HE1  H -11.371   9.694  13.137 1.00 . A A .  28 MET HE1  1 1 
        3  5432 1 1  28 MET HE2  H -10.589  11.166  13.713 1.00 . A A .  28 MET HE2  1 1 
        3  5433 1 1  28 MET HE3  H  -9.823  10.194  12.456 1.00 . A A .  28 MET HE3  1 1 
        3  5434 1 1  28 MET HG2  H -12.411   9.413  10.741 1.00 . A A .  28 MET HG2  1 1 
        3  5435 1 1  28 MET HG3  H -10.881   9.889  10.001 1.00 . A A .  28 MET HG3  1 1 
        3  5436 1 1  28 MET N    N -13.361  10.404   6.805 1.00 . A A .  28 MET N    1 1 
        3  5437 1 1  28 MET O    O -12.870   7.489   8.686 1.00 . A A .  28 MET O    1 1 
        3  5438 1 1  28 MET SD   S -11.626  11.488  11.596 1.00 . A A .  28 MET SD   1 1 
        3  5439 1 1  29 SER C    C -16.115   6.612   7.931 1.00 . A A .  29 SER C    1 1 
        3  5440 1 1  29 SER CA   C -15.594   7.534   9.035 1.00 . A A .  29 SER CA   1 1 
        3  5441 1 1  29 SER CB   C -16.756   8.104   9.856 1.00 . A A .  29 SER CB   1 1 
        3  5442 1 1  29 SER H    H -15.237   9.438   8.182 1.00 . A A .  29 SER H    1 1 
        3  5443 1 1  29 SER HA   H -14.957   6.958   9.689 1.00 . A A .  29 SER HA   1 1 
        3  5444 1 1  29 SER HB2  H -16.378   8.852  10.538 1.00 . A A .  29 SER HB2  1 1 
        3  5445 1 1  29 SER HB3  H -17.476   8.556   9.191 1.00 . A A .  29 SER HB3  1 1 
        3  5446 1 1  29 SER HG   H -16.744   6.431  10.885 1.00 . A A .  29 SER HG   1 1 
        3  5447 1 1  29 SER N    N -14.793   8.620   8.490 1.00 . A A .  29 SER N    1 1 
        3  5448 1 1  29 SER O    O -16.711   5.572   8.206 1.00 . A A .  29 SER O    1 1 
        3  5449 1 1  29 SER OG   O -17.401   7.090  10.607 1.00 . A A .  29 SER OG   1 1 
        3  5450 1 1  30 GLU C    C -15.269   5.231   5.055 1.00 . A A .  30 GLU C    1 1 
        3  5451 1 1  30 GLU CA   C -16.354   6.180   5.554 1.00 . A A .  30 GLU CA   1 1 
        3  5452 1 1  30 GLU CB   C -16.820   7.088   4.412 1.00 . A A .  30 GLU CB   1 1 
        3  5453 1 1  30 GLU CD   C -18.518   8.765   3.595 1.00 . A A .  30 GLU CD   1 1 
        3  5454 1 1  30 GLU CG   C -17.995   7.978   4.780 1.00 . A A .  30 GLU CG   1 1 
        3  5455 1 1  30 GLU H    H -15.354   7.792   6.505 1.00 . A A .  30 GLU H    1 1 
        3  5456 1 1  30 GLU HA   H -17.191   5.596   5.901 1.00 . A A .  30 GLU HA   1 1 
        3  5457 1 1  30 GLU HB2  H -15.999   7.721   4.112 1.00 . A A .  30 GLU HB2  1 1 
        3  5458 1 1  30 GLU HB3  H -17.114   6.473   3.574 1.00 . A A .  30 GLU HB3  1 1 
        3  5459 1 1  30 GLU HG2  H -18.793   7.361   5.164 1.00 . A A .  30 GLU HG2  1 1 
        3  5460 1 1  30 GLU HG3  H -17.679   8.673   5.545 1.00 . A A .  30 GLU HG3  1 1 
        3  5461 1 1  30 GLU N    N -15.872   6.977   6.679 1.00 . A A .  30 GLU N    1 1 
        3  5462 1 1  30 GLU O    O -15.489   4.457   4.126 1.00 . A A .  30 GLU O    1 1 
        3  5463 1 1  30 GLU OE1  O -19.250   8.187   2.766 1.00 . A A .  30 GLU OE1  1 1 
        3  5464 1 1  30 GLU OE2  O -18.211   9.966   3.486 1.00 . A A .  30 GLU OE2  1 1 
        3  5465 1 1  31 LEU C    C -13.241   3.010   5.241 1.00 . A A .  31 LEU C    1 1 
        3  5466 1 1  31 LEU CA   C -12.944   4.511   5.288 1.00 . A A .  31 LEU CA   1 1 
        3  5467 1 1  31 LEU CB   C -11.784   4.787   6.247 1.00 . A A .  31 LEU CB   1 1 
        3  5468 1 1  31 LEU CD1  C  -9.930   4.746   4.557 1.00 . A A .  31 LEU CD1  1 1 
        3  5469 1 1  31 LEU CD2  C  -9.431   4.339   6.975 1.00 . A A .  31 LEU CD2  1 1 
        3  5470 1 1  31 LEU CG   C -10.447   4.154   5.860 1.00 . A A .  31 LEU CG   1 1 
        3  5471 1 1  31 LEU H    H -14.036   5.868   6.485 1.00 . A A .  31 LEU H    1 1 
        3  5472 1 1  31 LEU HA   H -12.663   4.841   4.299 1.00 . A A .  31 LEU HA   1 1 
        3  5473 1 1  31 LEU HB2  H -11.647   5.856   6.313 1.00 . A A .  31 LEU HB2  1 1 
        3  5474 1 1  31 LEU HB3  H -12.061   4.418   7.224 1.00 . A A .  31 LEU HB3  1 1 
        3  5475 1 1  31 LEU HD11 H -10.648   4.570   3.770 1.00 . A A .  31 LEU HD11 1 1 
        3  5476 1 1  31 LEU HD12 H  -8.991   4.281   4.298 1.00 . A A .  31 LEU HD12 1 1 
        3  5477 1 1  31 LEU HD13 H  -9.782   5.810   4.678 1.00 . A A .  31 LEU HD13 1 1 
        3  5478 1 1  31 LEU HD21 H  -9.784   3.851   7.870 1.00 . A A .  31 LEU HD21 1 1 
        3  5479 1 1  31 LEU HD22 H  -9.297   5.394   7.167 1.00 . A A .  31 LEU HD22 1 1 
        3  5480 1 1  31 LEU HD23 H  -8.488   3.906   6.676 1.00 . A A .  31 LEU HD23 1 1 
        3  5481 1 1  31 LEU HG   H -10.590   3.094   5.711 1.00 . A A .  31 LEU HG   1 1 
        3  5482 1 1  31 LEU N    N -14.111   5.286   5.702 1.00 . A A .  31 LEU N    1 1 
        3  5483 1 1  31 LEU O    O -12.883   2.330   4.280 1.00 . A A .  31 LEU O    1 1 
        3  5484 1 1  32 GLY C    C -15.013   0.540   5.237 1.00 . A A .  32 GLY C    1 1 
        3  5485 1 1  32 GLY CA   C -14.170   1.083   6.378 1.00 . A A .  32 GLY CA   1 1 
        3  5486 1 1  32 GLY H    H -14.256   3.117   6.958 1.00 . A A .  32 GLY H    1 1 
        3  5487 1 1  32 GLY HA2  H -13.225   0.562   6.390 1.00 . A A .  32 GLY HA2  1 1 
        3  5488 1 1  32 GLY HA3  H -14.684   0.892   7.310 1.00 . A A .  32 GLY HA3  1 1 
        3  5489 1 1  32 GLY N    N -13.916   2.510   6.270 1.00 . A A .  32 GLY N    1 1 
        3  5490 1 1  32 GLY O    O -14.612  -0.403   4.553 1.00 . A A .  32 GLY O    1 1 
        3  5491 1 1  33 SER C    C -16.523   0.986   2.592 1.00 . A A .  33 SER C    1 1 
        3  5492 1 1  33 SER CA   C -17.089   0.704   3.983 1.00 . A A .  33 SER CA   1 1 
        3  5493 1 1  33 SER CB   C -18.446   1.379   4.169 1.00 . A A .  33 SER CB   1 1 
        3  5494 1 1  33 SER H    H -16.427   1.901   5.597 1.00 . A A .  33 SER H    1 1 
        3  5495 1 1  33 SER HA   H -17.217  -0.363   4.087 1.00 . A A .  33 SER HA   1 1 
        3  5496 1 1  33 SER HB2  H -18.329   2.448   4.088 1.00 . A A .  33 SER HB2  1 1 
        3  5497 1 1  33 SER HB3  H -19.128   1.031   3.409 1.00 . A A .  33 SER HB3  1 1 
        3  5498 1 1  33 SER HG   H -19.423   1.854   5.813 1.00 . A A .  33 SER HG   1 1 
        3  5499 1 1  33 SER N    N -16.173   1.141   5.026 1.00 . A A .  33 SER N    1 1 
        3  5500 1 1  33 SER O    O -16.807   0.258   1.637 1.00 . A A .  33 SER O    1 1 
        3  5501 1 1  33 SER OG   O -18.984   1.072   5.448 1.00 . A A .  33 SER OG   1 1 
        3  5502 1 1  34 LEU C    C -14.185   1.242   0.744 1.00 . A A .  34 LEU C    1 1 
        3  5503 1 1  34 LEU CA   C -15.080   2.388   1.220 1.00 . A A .  34 LEU CA   1 1 
        3  5504 1 1  34 LEU CB   C -14.271   3.686   1.380 1.00 . A A .  34 LEU CB   1 1 
        3  5505 1 1  34 LEU CD1  C -12.809   3.752  -0.684 1.00 . A A .  34 LEU CD1  1 1 
        3  5506 1 1  34 LEU CD2  C -15.168   4.586  -0.789 1.00 . A A .  34 LEU CD2  1 1 
        3  5507 1 1  34 LEU CG   C -13.929   4.442   0.084 1.00 . A A .  34 LEU CG   1 1 
        3  5508 1 1  34 LEU H    H -15.544   2.591   3.276 1.00 . A A .  34 LEU H    1 1 
        3  5509 1 1  34 LEU HA   H -15.861   2.545   0.492 1.00 . A A .  34 LEU HA   1 1 
        3  5510 1 1  34 LEU HB2  H -14.832   4.354   2.019 1.00 . A A .  34 LEU HB2  1 1 
        3  5511 1 1  34 LEU HB3  H -13.345   3.441   1.879 1.00 . A A .  34 LEU HB3  1 1 
        3  5512 1 1  34 LEU HD11 H -12.606   4.299  -1.594 1.00 . A A .  34 LEU HD11 1 1 
        3  5513 1 1  34 LEU HD12 H -13.107   2.743  -0.929 1.00 . A A .  34 LEU HD12 1 1 
        3  5514 1 1  34 LEU HD13 H -11.919   3.726  -0.073 1.00 . A A .  34 LEU HD13 1 1 
        3  5515 1 1  34 LEU HD21 H -14.910   5.115  -1.695 1.00 . A A .  34 LEU HD21 1 1 
        3  5516 1 1  34 LEU HD22 H -15.924   5.142  -0.253 1.00 . A A .  34 LEU HD22 1 1 
        3  5517 1 1  34 LEU HD23 H -15.551   3.608  -1.039 1.00 . A A .  34 LEU HD23 1 1 
        3  5518 1 1  34 LEU HG   H -13.587   5.435   0.340 1.00 . A A .  34 LEU HG   1 1 
        3  5519 1 1  34 LEU N    N -15.714   2.035   2.485 1.00 . A A .  34 LEU N    1 1 
        3  5520 1 1  34 LEU O    O -14.169   0.904  -0.442 1.00 . A A .  34 LEU O    1 1 
        3  5521 1 1  35 PHE C    C -13.345  -1.646   0.723 1.00 . A A .  35 PHE C    1 1 
        3  5522 1 1  35 PHE CA   C -12.578  -0.491   1.357 1.00 . A A .  35 PHE CA   1 1 
        3  5523 1 1  35 PHE CB   C -11.834  -0.992   2.597 1.00 . A A .  35 PHE CB   1 1 
        3  5524 1 1  35 PHE CD1  C  -9.588  -0.030   2.027 1.00 . A A .  35 PHE CD1  1 1 
        3  5525 1 1  35 PHE CD2  C -10.487   0.401   4.193 1.00 . A A .  35 PHE CD2  1 1 
        3  5526 1 1  35 PHE CE1  C  -8.459   0.697   2.346 1.00 . A A .  35 PHE CE1  1 1 
        3  5527 1 1  35 PHE CE2  C  -9.361   1.132   4.517 1.00 . A A .  35 PHE CE2  1 1 
        3  5528 1 1  35 PHE CG   C -10.616  -0.186   2.946 1.00 . A A .  35 PHE CG   1 1 
        3  5529 1 1  35 PHE CZ   C  -8.346   1.281   3.593 1.00 . A A .  35 PHE CZ   1 1 
        3  5530 1 1  35 PHE H    H -13.515   0.944   2.610 1.00 . A A .  35 PHE H    1 1 
        3  5531 1 1  35 PHE HA   H -11.851  -0.134   0.643 1.00 . A A .  35 PHE HA   1 1 
        3  5532 1 1  35 PHE HB2  H -12.504  -0.960   3.445 1.00 . A A .  35 PHE HB2  1 1 
        3  5533 1 1  35 PHE HB3  H -11.523  -2.013   2.431 1.00 . A A .  35 PHE HB3  1 1 
        3  5534 1 1  35 PHE HD1  H  -9.679  -0.484   1.051 1.00 . A A .  35 PHE HD1  1 1 
        3  5535 1 1  35 PHE HD2  H -11.280   0.284   4.917 1.00 . A A .  35 PHE HD2  1 1 
        3  5536 1 1  35 PHE HE1  H  -7.665   0.811   1.622 1.00 . A A .  35 PHE HE1  1 1 
        3  5537 1 1  35 PHE HE2  H  -9.274   1.588   5.492 1.00 . A A .  35 PHE HE2  1 1 
        3  5538 1 1  35 PHE HZ   H  -7.463   1.850   3.845 1.00 . A A .  35 PHE HZ   1 1 
        3  5539 1 1  35 PHE N    N -13.459   0.630   1.681 1.00 . A A .  35 PHE N    1 1 
        3  5540 1 1  35 PHE O    O -12.833  -2.319  -0.169 1.00 . A A .  35 PHE O    1 1 
        3  5541 1 1  36 GLU C    C -15.713  -2.668  -0.819 1.00 . A A .  36 GLU C    1 1 
        3  5542 1 1  36 GLU CA   C -15.392  -2.952   0.642 1.00 . A A .  36 GLU CA   1 1 
        3  5543 1 1  36 GLU CB   C -16.685  -3.099   1.458 1.00 . A A .  36 GLU CB   1 1 
        3  5544 1 1  36 GLU CD   C -17.985  -4.706  -0.046 1.00 . A A .  36 GLU CD   1 1 
        3  5545 1 1  36 GLU CG   C -17.381  -4.454   1.325 1.00 . A A .  36 GLU CG   1 1 
        3  5546 1 1  36 GLU H    H -14.939  -1.290   1.878 1.00 . A A .  36 GLU H    1 1 
        3  5547 1 1  36 GLU HA   H -14.822  -3.867   0.705 1.00 . A A .  36 GLU HA   1 1 
        3  5548 1 1  36 GLU HB2  H -16.453  -2.945   2.501 1.00 . A A .  36 GLU HB2  1 1 
        3  5549 1 1  36 GLU HB3  H -17.378  -2.333   1.141 1.00 . A A .  36 GLU HB3  1 1 
        3  5550 1 1  36 GLU HG2  H -16.660  -5.233   1.525 1.00 . A A .  36 GLU HG2  1 1 
        3  5551 1 1  36 GLU HG3  H -18.170  -4.505   2.062 1.00 . A A .  36 GLU HG3  1 1 
        3  5552 1 1  36 GLU N    N -14.574  -1.870   1.176 1.00 . A A .  36 GLU N    1 1 
        3  5553 1 1  36 GLU O    O -15.466  -3.497  -1.688 1.00 . A A .  36 GLU O    1 1 
        3  5554 1 1  36 GLU OE1  O -18.935  -3.988  -0.419 1.00 . A A .  36 GLU OE1  1 1 
        3  5555 1 1  36 GLU OE2  O -17.521  -5.629  -0.750 1.00 . A A .  36 GLU OE2  1 1 
        3  5556 1 1  37 ALA C    C -15.434  -1.081  -3.379 1.00 . A A .  37 ALA C    1 1 
        3  5557 1 1  37 ALA CA   C -16.623  -1.076  -2.422 1.00 . A A .  37 ALA CA   1 1 
        3  5558 1 1  37 ALA CB   C -17.273   0.295  -2.388 1.00 . A A .  37 ALA CB   1 1 
        3  5559 1 1  37 ALA H    H -16.348  -0.835  -0.337 1.00 . A A .  37 ALA H    1 1 
        3  5560 1 1  37 ALA HA   H -17.356  -1.786  -2.775 1.00 . A A .  37 ALA HA   1 1 
        3  5561 1 1  37 ALA HB1  H -17.612   0.558  -3.378 1.00 . A A .  37 ALA HB1  1 1 
        3  5562 1 1  37 ALA HB2  H -16.555   1.027  -2.045 1.00 . A A .  37 ALA HB2  1 1 
        3  5563 1 1  37 ALA HB3  H -18.115   0.274  -1.713 1.00 . A A .  37 ALA HB3  1 1 
        3  5564 1 1  37 ALA N    N -16.228  -1.472  -1.077 1.00 . A A .  37 ALA N    1 1 
        3  5565 1 1  37 ALA O    O -15.556  -1.505  -4.527 1.00 . A A .  37 ALA O    1 1 
        3  5566 1 1  38 GLY C    C -12.548  -1.955  -4.042 1.00 . A A .  38 GLY C    1 1 
        3  5567 1 1  38 GLY CA   C -13.099  -0.575  -3.733 1.00 . A A .  38 GLY CA   1 1 
        3  5568 1 1  38 GLY H    H -14.246  -0.304  -1.969 1.00 . A A .  38 GLY H    1 1 
        3  5569 1 1  38 GLY HA2  H -13.344  -0.083  -4.663 1.00 . A A .  38 GLY HA2  1 1 
        3  5570 1 1  38 GLY HA3  H -12.337  -0.002  -3.224 1.00 . A A .  38 GLY HA3  1 1 
        3  5571 1 1  38 GLY N    N -14.287  -0.622  -2.899 1.00 . A A .  38 GLY N    1 1 
        3  5572 1 1  38 GLY O    O -12.210  -2.257  -5.186 1.00 . A A .  38 GLY O    1 1 
        3  5573 1 1  39 TYR C    C -12.934  -5.028  -3.945 1.00 . A A .  39 TYR C    1 1 
        3  5574 1 1  39 TYR CA   C -11.940  -4.154  -3.179 1.00 . A A .  39 TYR CA   1 1 
        3  5575 1 1  39 TYR CB   C -11.651  -4.746  -1.794 1.00 . A A .  39 TYR CB   1 1 
        3  5576 1 1  39 TYR CD1  C  -9.757  -6.385  -2.127 1.00 . A A .  39 TYR CD1  1 1 
        3  5577 1 1  39 TYR CD2  C -11.880  -7.241  -1.466 1.00 . A A .  39 TYR CD2  1 1 
        3  5578 1 1  39 TYR CE1  C  -9.235  -7.667  -2.122 1.00 . A A .  39 TYR CE1  1 1 
        3  5579 1 1  39 TYR CE2  C -11.366  -8.523  -1.454 1.00 . A A .  39 TYR CE2  1 1 
        3  5580 1 1  39 TYR CG   C -11.086  -6.152  -1.802 1.00 . A A .  39 TYR CG   1 1 
        3  5581 1 1  39 TYR CZ   C -10.044  -8.731  -1.783 1.00 . A A .  39 TYR CZ   1 1 
        3  5582 1 1  39 TYR H    H -12.766  -2.504  -2.133 1.00 . A A .  39 TYR H    1 1 
        3  5583 1 1  39 TYR HA   H -11.018  -4.092  -3.739 1.00 . A A .  39 TYR HA   1 1 
        3  5584 1 1  39 TYR HB2  H -10.940  -4.113  -1.288 1.00 . A A .  39 TYR HB2  1 1 
        3  5585 1 1  39 TYR HB3  H -12.570  -4.764  -1.225 1.00 . A A .  39 TYR HB3  1 1 
        3  5586 1 1  39 TYR HD1  H  -9.124  -5.550  -2.392 1.00 . A A .  39 TYR HD1  1 1 
        3  5587 1 1  39 TYR HD2  H -12.917  -7.076  -1.210 1.00 . A A .  39 TYR HD2  1 1 
        3  5588 1 1  39 TYR HE1  H  -8.199  -7.829  -2.380 1.00 . A A .  39 TYR HE1  1 1 
        3  5589 1 1  39 TYR HE2  H -12.000  -9.355  -1.190 1.00 . A A .  39 TYR HE2  1 1 
        3  5590 1 1  39 TYR HH   H  -8.654  -9.992  -1.360 1.00 . A A .  39 TYR HH   1 1 
        3  5591 1 1  39 TYR N    N -12.464  -2.799  -3.022 1.00 . A A .  39 TYR N    1 1 
        3  5592 1 1  39 TYR O    O -12.568  -6.049  -4.533 1.00 . A A .  39 TYR O    1 1 
        3  5593 1 1  39 TYR OH   O  -9.527 -10.008  -1.766 1.00 . A A .  39 TYR OH   1 1 
        3  5594 1 1  40 HIS C    C -15.068  -5.491  -6.068 1.00 . A A .  40 HIS C    1 1 
        3  5595 1 1  40 HIS CA   C -15.280  -5.335  -4.565 1.00 . A A .  40 HIS CA   1 1 
        3  5596 1 1  40 HIS CB   C -16.601  -4.604  -4.299 1.00 . A A .  40 HIS CB   1 1 
        3  5597 1 1  40 HIS CD2  C -18.454  -5.984  -5.486 1.00 . A A .  40 HIS CD2  1 1 
        3  5598 1 1  40 HIS CE1  C -19.597  -6.566  -3.709 1.00 . A A .  40 HIS CE1  1 1 
        3  5599 1 1  40 HIS CG   C -17.823  -5.461  -4.408 1.00 . A A .  40 HIS CG   1 1 
        3  5600 1 1  40 HIS H    H -14.389  -3.742  -3.507 1.00 . A A .  40 HIS H    1 1 
        3  5601 1 1  40 HIS HA   H -15.320  -6.314  -4.112 1.00 . A A .  40 HIS HA   1 1 
        3  5602 1 1  40 HIS HB2  H -16.577  -4.193  -3.301 1.00 . A A .  40 HIS HB2  1 1 
        3  5603 1 1  40 HIS HB3  H -16.700  -3.795  -5.008 1.00 . A A .  40 HIS HB3  1 1 
        3  5604 1 1  40 HIS HD1  H -18.357  -5.621  -2.368 1.00 . A A .  40 HIS HD1  1 1 
        3  5605 1 1  40 HIS HD2  H -18.147  -5.887  -6.517 1.00 . A A .  40 HIS HD2  1 1 
        3  5606 1 1  40 HIS HE1  H -20.347  -7.005  -3.066 1.00 . A A .  40 HIS HE1  1 1 
        3  5607 1 1  40 HIS HE2  H -20.181  -7.183  -5.580 1.00 . A A .  40 HIS HE2  1 1 
        3  5608 1 1  40 HIS N    N -14.187  -4.594  -3.948 1.00 . A A .  40 HIS N    1 1 
        3  5609 1 1  40 HIS ND1  N -18.565  -5.844  -3.311 1.00 . A A .  40 HIS ND1  1 1 
        3  5610 1 1  40 HIS NE2  N -19.552  -6.664  -5.022 1.00 . A A .  40 HIS NE2  1 1 
        3  5611 1 1  40 HIS O    O -15.375  -6.536  -6.635 1.00 . A A .  40 HIS O    1 1 
        3  5612 1 1  41 ASP C    C -13.023  -5.030  -8.571 1.00 . A A .  41 ASP C    1 1 
        3  5613 1 1  41 ASP CA   C -14.367  -4.457  -8.154 1.00 . A A .  41 ASP CA   1 1 
        3  5614 1 1  41 ASP CB   C -14.522  -3.050  -8.725 1.00 . A A .  41 ASP CB   1 1 
        3  5615 1 1  41 ASP CG   C -15.947  -2.553  -8.655 1.00 . A A .  41 ASP CG   1 1 
        3  5616 1 1  41 ASP H    H -14.244  -3.672  -6.187 1.00 . A A .  41 ASP H    1 1 
        3  5617 1 1  41 ASP HA   H -15.146  -5.081  -8.566 1.00 . A A .  41 ASP HA   1 1 
        3  5618 1 1  41 ASP HB2  H -13.895  -2.371  -8.167 1.00 . A A .  41 ASP HB2  1 1 
        3  5619 1 1  41 ASP HB3  H -14.211  -3.054  -9.759 1.00 . A A .  41 ASP HB3  1 1 
        3  5620 1 1  41 ASP N    N -14.532  -4.456  -6.703 1.00 . A A .  41 ASP N    1 1 
        3  5621 1 1  41 ASP O    O -12.712  -5.106  -9.758 1.00 . A A .  41 ASP O    1 1 
        3  5622 1 1  41 ASP OD1  O -16.837  -3.195  -9.251 1.00 . A A .  41 ASP OD1  1 1 
        3  5623 1 1  41 ASP OD2  O -16.181  -1.503  -8.027 1.00 . A A .  41 ASP OD2  1 1 
        3  5624 1 1  42 ILE C    C -11.110  -7.558  -8.013 1.00 . A A .  42 ILE C    1 1 
        3  5625 1 1  42 ILE CA   C -10.940  -6.049  -7.878 1.00 . A A .  42 ILE CA   1 1 
        3  5626 1 1  42 ILE CB   C  -9.911  -5.735  -6.766 1.00 . A A .  42 ILE CB   1 1 
        3  5627 1 1  42 ILE CD1  C  -9.257  -3.524  -7.872 1.00 . A A .  42 ILE CD1  1 1 
        3  5628 1 1  42 ILE CG1  C  -9.740  -4.217  -6.614 1.00 . A A .  42 ILE CG1  1 1 
        3  5629 1 1  42 ILE CG2  C  -8.570  -6.396  -7.059 1.00 . A A .  42 ILE CG2  1 1 
        3  5630 1 1  42 ILE H    H -12.510  -5.314  -6.666 1.00 . A A .  42 ILE H    1 1 
        3  5631 1 1  42 ILE HA   H -10.571  -5.648  -8.812 1.00 . A A .  42 ILE HA   1 1 
        3  5632 1 1  42 ILE HB   H -10.287  -6.139  -5.840 1.00 . A A .  42 ILE HB   1 1 
        3  5633 1 1  42 ILE HD11 H  -9.172  -2.463  -7.689 1.00 . A A .  42 ILE HD11 1 1 
        3  5634 1 1  42 ILE HD12 H  -9.962  -3.695  -8.672 1.00 . A A .  42 ILE HD12 1 1 
        3  5635 1 1  42 ILE HD13 H  -8.293  -3.918  -8.152 1.00 . A A .  42 ILE HD13 1 1 
        3  5636 1 1  42 ILE HG12 H -10.691  -3.782  -6.343 1.00 . A A .  42 ILE HG12 1 1 
        3  5637 1 1  42 ILE HG13 H  -9.023  -4.021  -5.830 1.00 . A A .  42 ILE HG13 1 1 
        3  5638 1 1  42 ILE HG21 H  -7.879  -6.183  -6.256 1.00 . A A .  42 ILE HG21 1 1 
        3  5639 1 1  42 ILE HG22 H  -8.172  -6.008  -7.985 1.00 . A A .  42 ILE HG22 1 1 
        3  5640 1 1  42 ILE HG23 H  -8.705  -7.464  -7.144 1.00 . A A .  42 ILE HG23 1 1 
        3  5641 1 1  42 ILE N    N -12.227  -5.432  -7.597 1.00 . A A .  42 ILE N    1 1 
        3  5642 1 1  42 ILE O    O -10.378  -8.223  -8.752 1.00 . A A .  42 ILE O    1 1 
        3  5643 1 1  43 LEU C    C -12.724 -10.058  -8.650 1.00 . A A .  43 LEU C    1 1 
        3  5644 1 1  43 LEU CA   C -12.360  -9.512  -7.268 1.00 . A A .  43 LEU CA   1 1 
        3  5645 1 1  43 LEU CB   C -13.476  -9.806  -6.252 1.00 . A A .  43 LEU CB   1 1 
        3  5646 1 1  43 LEU CD1  C -13.985 -12.239  -6.736 1.00 . A A .  43 LEU CD1  1 1 
        3  5647 1 1  43 LEU CD2  C -12.165 -11.636  -5.134 1.00 . A A .  43 LEU CD2  1 1 
        3  5648 1 1  43 LEU CG   C -13.526 -11.237  -5.687 1.00 . A A .  43 LEU CG   1 1 
        3  5649 1 1  43 LEU H    H -12.725  -7.477  -6.845 1.00 . A A .  43 LEU H    1 1 
        3  5650 1 1  43 LEU HA   H -11.450  -9.988  -6.937 1.00 . A A .  43 LEU HA   1 1 
        3  5651 1 1  43 LEU HB2  H -13.358  -9.125  -5.422 1.00 . A A .  43 LEU HB2  1 1 
        3  5652 1 1  43 LEU HB3  H -14.423  -9.601  -6.727 1.00 . A A .  43 LEU HB3  1 1 
        3  5653 1 1  43 LEU HD11 H -13.311 -12.213  -7.579 1.00 . A A .  43 LEU HD11 1 1 
        3  5654 1 1  43 LEU HD12 H -14.983 -11.985  -7.063 1.00 . A A .  43 LEU HD12 1 1 
        3  5655 1 1  43 LEU HD13 H -13.988 -13.229  -6.307 1.00 . A A .  43 LEU HD13 1 1 
        3  5656 1 1  43 LEU HD21 H -11.864 -10.930  -4.374 1.00 . A A .  43 LEU HD21 1 1 
        3  5657 1 1  43 LEU HD22 H -11.438 -11.637  -5.933 1.00 . A A .  43 LEU HD22 1 1 
        3  5658 1 1  43 LEU HD23 H -12.226 -12.625  -4.703 1.00 . A A .  43 LEU HD23 1 1 
        3  5659 1 1  43 LEU HG   H -14.235 -11.266  -4.872 1.00 . A A .  43 LEU HG   1 1 
        3  5660 1 1  43 LEU N    N -12.119  -8.079  -7.325 1.00 . A A .  43 LEU N    1 1 
        3  5661 1 1  43 LEU O    O -12.022 -10.915  -9.189 1.00 . A A .  43 LEU O    1 1 
        3  5662 1 1  44 GLN C    C -13.450  -9.689 -11.674 1.00 . A A .  44 GLN C    1 1 
        3  5663 1 1  44 GLN CA   C -14.326 -10.076 -10.484 1.00 . A A .  44 GLN CA   1 1 
        3  5664 1 1  44 GLN CB   C -15.778  -9.623 -10.727 1.00 . A A .  44 GLN CB   1 1 
        3  5665 1 1  44 GLN CD   C -15.758  -7.096 -10.404 1.00 . A A .  44 GLN CD   1 1 
        3  5666 1 1  44 GLN CG   C -15.920  -8.248 -11.374 1.00 . A A .  44 GLN CG   1 1 
        3  5667 1 1  44 GLN H    H -14.237  -8.750  -8.830 1.00 . A A .  44 GLN H    1 1 
        3  5668 1 1  44 GLN HA   H -14.315 -11.152 -10.393 1.00 . A A .  44 GLN HA   1 1 
        3  5669 1 1  44 GLN HB2  H -16.262 -10.344 -11.368 1.00 . A A .  44 GLN HB2  1 1 
        3  5670 1 1  44 GLN HB3  H -16.295  -9.601  -9.779 1.00 . A A .  44 GLN HB3  1 1 
        3  5671 1 1  44 GLN HE21 H -16.947  -5.969 -11.522 1.00 . A A .  44 GLN HE21 1 1 
        3  5672 1 1  44 GLN HE22 H -16.322  -5.214 -10.098 1.00 . A A .  44 GLN HE22 1 1 
        3  5673 1 1  44 GLN HG2  H -15.166  -8.152 -12.141 1.00 . A A .  44 GLN HG2  1 1 
        3  5674 1 1  44 GLN HG3  H -16.898  -8.180 -11.828 1.00 . A A .  44 GLN HG3  1 1 
        3  5675 1 1  44 GLN N    N -13.796  -9.531  -9.237 1.00 . A A .  44 GLN N    1 1 
        3  5676 1 1  44 GLN NE2  N -16.409  -5.983 -10.704 1.00 . A A .  44 GLN NE2  1 1 
        3  5677 1 1  44 GLN O    O -13.641 -10.188 -12.783 1.00 . A A .  44 GLN O    1 1 
        3  5678 1 1  44 GLN OE1  O -15.060  -7.202  -9.401 1.00 . A A .  44 GLN OE1  1 1 
        3  5679 1 1  45 LEU C    C -10.494  -9.481 -12.663 1.00 . A A .  45 LEU C    1 1 
        3  5680 1 1  45 LEU CA   C -11.564  -8.407 -12.494 1.00 . A A .  45 LEU CA   1 1 
        3  5681 1 1  45 LEU CB   C -10.922  -7.053 -12.172 1.00 . A A .  45 LEU CB   1 1 
        3  5682 1 1  45 LEU CD1  C -10.769  -6.290 -14.565 1.00 . A A .  45 LEU CD1  1 1 
        3  5683 1 1  45 LEU CD2  C  -9.389  -5.177 -12.810 1.00 . A A .  45 LEU CD2  1 1 
        3  5684 1 1  45 LEU CG   C -10.006  -6.489 -13.264 1.00 . A A .  45 LEU CG   1 1 
        3  5685 1 1  45 LEU H    H -12.421  -8.392 -10.557 1.00 . A A .  45 LEU H    1 1 
        3  5686 1 1  45 LEU HA   H -12.120  -8.323 -13.416 1.00 . A A .  45 LEU HA   1 1 
        3  5687 1 1  45 LEU HB2  H -11.712  -6.339 -11.991 1.00 . A A .  45 LEU HB2  1 1 
        3  5688 1 1  45 LEU HB3  H -10.342  -7.160 -11.266 1.00 . A A .  45 LEU HB3  1 1 
        3  5689 1 1  45 LEU HD11 H -11.573  -5.588 -14.407 1.00 . A A .  45 LEU HD11 1 1 
        3  5690 1 1  45 LEU HD12 H -11.176  -7.236 -14.893 1.00 . A A .  45 LEU HD12 1 1 
        3  5691 1 1  45 LEU HD13 H -10.100  -5.906 -15.320 1.00 . A A .  45 LEU HD13 1 1 
        3  5692 1 1  45 LEU HD21 H  -8.759  -4.784 -13.594 1.00 . A A .  45 LEU HD21 1 1 
        3  5693 1 1  45 LEU HD22 H  -8.798  -5.344 -11.922 1.00 . A A .  45 LEU HD22 1 1 
        3  5694 1 1  45 LEU HD23 H -10.175  -4.467 -12.591 1.00 . A A .  45 LEU HD23 1 1 
        3  5695 1 1  45 LEU HG   H  -9.205  -7.189 -13.450 1.00 . A A .  45 LEU HG   1 1 
        3  5696 1 1  45 LEU N    N -12.496  -8.796 -11.446 1.00 . A A .  45 LEU N    1 1 
        3  5697 1 1  45 LEU O    O -10.377 -10.094 -13.726 1.00 . A A .  45 LEU O    1 1 
        3  5698 1 1  46 LEU C    C  -9.256 -12.139 -11.786 1.00 . A A .  46 LEU C    1 1 
        3  5699 1 1  46 LEU CA   C  -8.677 -10.736 -11.631 1.00 . A A .  46 LEU CA   1 1 
        3  5700 1 1  46 LEU CB   C  -7.811 -10.662 -10.365 1.00 . A A .  46 LEU CB   1 1 
        3  5701 1 1  46 LEU CD1  C  -5.751  -9.849 -11.548 1.00 . A A .  46 LEU CD1  1 1 
        3  5702 1 1  46 LEU CD2  C  -7.260  -8.200 -10.429 1.00 . A A .  46 LEU CD2  1 1 
        3  5703 1 1  46 LEU CG   C  -6.692  -9.610 -10.378 1.00 . A A .  46 LEU CG   1 1 
        3  5704 1 1  46 LEU H    H  -9.899  -9.231 -10.767 1.00 . A A .  46 LEU H    1 1 
        3  5705 1 1  46 LEU HA   H  -8.055 -10.526 -12.488 1.00 . A A .  46 LEU HA   1 1 
        3  5706 1 1  46 LEU HB2  H  -8.458 -10.448  -9.527 1.00 . A A .  46 LEU HB2  1 1 
        3  5707 1 1  46 LEU HB3  H  -7.359 -11.630 -10.208 1.00 . A A .  46 LEU HB3  1 1 
        3  5708 1 1  46 LEU HD11 H  -4.973  -9.100 -11.543 1.00 . A A .  46 LEU HD11 1 1 
        3  5709 1 1  46 LEU HD12 H  -6.303  -9.789 -12.474 1.00 . A A .  46 LEU HD12 1 1 
        3  5710 1 1  46 LEU HD13 H  -5.306 -10.830 -11.458 1.00 . A A .  46 LEU HD13 1 1 
        3  5711 1 1  46 LEU HD21 H  -7.856  -8.084 -11.321 1.00 . A A .  46 LEU HD21 1 1 
        3  5712 1 1  46 LEU HD22 H  -6.452  -7.485 -10.440 1.00 . A A .  46 LEU HD22 1 1 
        3  5713 1 1  46 LEU HD23 H  -7.879  -8.030  -9.559 1.00 . A A .  46 LEU HD23 1 1 
        3  5714 1 1  46 LEU HG   H  -6.115  -9.703  -9.470 1.00 . A A .  46 LEU HG   1 1 
        3  5715 1 1  46 LEU N    N  -9.739  -9.733 -11.597 1.00 . A A .  46 LEU N    1 1 
        3  5716 1 1  46 LEU O    O  -8.787 -12.927 -12.612 1.00 . A A .  46 LEU O    1 1 
        3  5717 1 1  47 ALA C    C -11.704 -13.924 -12.361 1.00 . A A .  47 ALA C    1 1 
        3  5718 1 1  47 ALA CA   C -10.920 -13.754 -11.067 1.00 . A A .  47 ALA CA   1 1 
        3  5719 1 1  47 ALA CB   C -11.824 -13.964  -9.862 1.00 . A A .  47 ALA CB   1 1 
        3  5720 1 1  47 ALA H    H -10.646 -11.765 -10.389 1.00 . A A .  47 ALA H    1 1 
        3  5721 1 1  47 ALA HA   H -10.137 -14.500 -11.033 1.00 . A A .  47 ALA HA   1 1 
        3  5722 1 1  47 ALA HB1  H -11.251 -13.835  -8.956 1.00 . A A .  47 ALA HB1  1 1 
        3  5723 1 1  47 ALA HB2  H -12.237 -14.962  -9.889 1.00 . A A .  47 ALA HB2  1 1 
        3  5724 1 1  47 ALA HB3  H -12.626 -13.241  -9.887 1.00 . A A .  47 ALA HB3  1 1 
        3  5725 1 1  47 ALA N    N -10.292 -12.442 -11.012 1.00 . A A .  47 ALA N    1 1 
        3  5726 1 1  47 ALA O    O -11.862 -15.039 -12.860 1.00 . A A .  47 ALA O    1 1 
        3  5727 1 1  48 GLY C    C -12.070 -13.202 -15.333 1.00 . A A .  48 GLY C    1 1 
        3  5728 1 1  48 GLY CA   C -12.933 -12.847 -14.144 1.00 . A A .  48 GLY CA   1 1 
        3  5729 1 1  48 GLY H    H -12.011 -11.952 -12.465 1.00 . A A .  48 GLY H    1 1 
        3  5730 1 1  48 GLY HA2  H -13.719 -13.582 -14.051 1.00 . A A .  48 GLY HA2  1 1 
        3  5731 1 1  48 GLY HA3  H -13.378 -11.877 -14.312 1.00 . A A .  48 GLY HA3  1 1 
        3  5732 1 1  48 GLY N    N -12.177 -12.809 -12.908 1.00 . A A .  48 GLY N    1 1 
        3  5733 1 1  48 GLY O    O -12.437 -14.052 -16.145 1.00 . A A .  48 GLY O    1 1 
        3  5734 1 1  49 GLN C    C  -9.261 -14.170 -16.253 1.00 . A A .  49 GLN C    1 1 
        3  5735 1 1  49 GLN CA   C  -9.975 -12.848 -16.511 1.00 . A A .  49 GLN CA   1 1 
        3  5736 1 1  49 GLN CB   C  -8.951 -11.722 -16.665 1.00 . A A .  49 GLN CB   1 1 
        3  5737 1 1  49 GLN CD   C  -8.546  -9.345 -17.436 1.00 . A A .  49 GLN CD   1 1 
        3  5738 1 1  49 GLN CG   C  -9.574 -10.385 -17.036 1.00 . A A .  49 GLN CG   1 1 
        3  5739 1 1  49 GLN H    H -10.687 -11.868 -14.771 1.00 . A A .  49 GLN H    1 1 
        3  5740 1 1  49 GLN HA   H -10.542 -12.934 -17.426 1.00 . A A .  49 GLN HA   1 1 
        3  5741 1 1  49 GLN HB2  H  -8.421 -11.601 -15.731 1.00 . A A .  49 GLN HB2  1 1 
        3  5742 1 1  49 GLN HB3  H  -8.247 -11.995 -17.436 1.00 . A A .  49 GLN HB3  1 1 
        3  5743 1 1  49 GLN HE21 H  -9.862  -8.507 -18.666 1.00 . A A .  49 GLN HE21 1 1 
        3  5744 1 1  49 GLN HE22 H  -8.303  -7.762 -18.605 1.00 . A A .  49 GLN HE22 1 1 
        3  5745 1 1  49 GLN HG2  H -10.249 -10.538 -17.865 1.00 . A A .  49 GLN HG2  1 1 
        3  5746 1 1  49 GLN HG3  H -10.127 -10.013 -16.186 1.00 . A A .  49 GLN HG3  1 1 
        3  5747 1 1  49 GLN N    N -10.914 -12.558 -15.434 1.00 . A A .  49 GLN N    1 1 
        3  5748 1 1  49 GLN NE2  N  -8.940  -8.446 -18.324 1.00 . A A .  49 GLN NE2  1 1 
        3  5749 1 1  49 GLN O    O  -8.606 -14.720 -17.140 1.00 . A A .  49 GLN O    1 1 
        3  5750 1 1  49 GLN OE1  O  -7.412  -9.349 -16.958 1.00 . A A .  49 GLN OE1  1 1 
        3  5751 1 1  50 GLY C    C  -7.300 -15.822 -14.487 1.00 . A A .  50 GLY C    1 1 
        3  5752 1 1  50 GLY CA   C  -8.795 -15.928 -14.661 1.00 . A A .  50 GLY CA   1 1 
        3  5753 1 1  50 GLY H    H  -9.903 -14.155 -14.363 1.00 . A A .  50 GLY H    1 1 
        3  5754 1 1  50 GLY HA2  H  -9.231 -16.265 -13.730 1.00 . A A .  50 GLY HA2  1 1 
        3  5755 1 1  50 GLY HA3  H  -9.010 -16.652 -15.431 1.00 . A A .  50 GLY HA3  1 1 
        3  5756 1 1  50 GLY N    N  -9.393 -14.663 -15.028 1.00 . A A .  50 GLY N    1 1 
        3  5757 1 1  50 GLY O    O  -6.557 -16.723 -14.869 1.00 . A A .  50 GLY O    1 1 
        3  5758 1 1  51 LYS C    C  -5.164 -14.117 -12.256 1.00 . A A .  51 LYS C    1 1 
        3  5759 1 1  51 LYS CA   C  -5.437 -14.491 -13.704 1.00 . A A .  51 LYS CA   1 1 
        3  5760 1 1  51 LYS CB   C  -4.918 -13.397 -14.639 1.00 . A A .  51 LYS CB   1 1 
        3  5761 1 1  51 LYS CD   C  -4.326 -12.794 -17.008 1.00 . A A .  51 LYS CD   1 1 
        3  5762 1 1  51 LYS CE   C  -2.838 -13.017 -16.801 1.00 . A A .  51 LYS CE   1 1 
        3  5763 1 1  51 LYS CG   C  -5.151 -13.698 -16.109 1.00 . A A .  51 LYS CG   1 1 
        3  5764 1 1  51 LYS H    H  -7.501 -14.047 -13.596 1.00 . A A .  51 LYS H    1 1 
        3  5765 1 1  51 LYS HA   H  -4.920 -15.414 -13.925 1.00 . A A .  51 LYS HA   1 1 
        3  5766 1 1  51 LYS HB2  H  -5.417 -12.468 -14.398 1.00 . A A .  51 LYS HB2  1 1 
        3  5767 1 1  51 LYS HB3  H  -3.857 -13.276 -14.481 1.00 . A A .  51 LYS HB3  1 1 
        3  5768 1 1  51 LYS HD2  H  -4.571 -13.006 -18.034 1.00 . A A .  51 LYS HD2  1 1 
        3  5769 1 1  51 LYS HD3  H  -4.562 -11.763 -16.784 1.00 . A A .  51 LYS HD3  1 1 
        3  5770 1 1  51 LYS HE2  H  -2.570 -12.673 -15.814 1.00 . A A .  51 LYS HE2  1 1 
        3  5771 1 1  51 LYS HE3  H  -2.632 -14.075 -16.880 1.00 . A A .  51 LYS HE3  1 1 
        3  5772 1 1  51 LYS HG2  H  -4.881 -14.724 -16.303 1.00 . A A .  51 LYS HG2  1 1 
        3  5773 1 1  51 LYS HG3  H  -6.199 -13.553 -16.333 1.00 . A A .  51 LYS HG3  1 1 
        3  5774 1 1  51 LYS HZ1  H  -1.002 -12.448 -17.609 1.00 . A A .  51 LYS HZ1  1 1 
        3  5775 1 1  51 LYS HZ2  H  -2.210 -11.269 -17.758 1.00 . A A .  51 LYS HZ2  1 1 
        3  5776 1 1  51 LYS HZ3  H  -2.232 -12.634 -18.764 1.00 . A A .  51 LYS HZ3  1 1 
        3  5777 1 1  51 LYS N    N  -6.855 -14.719 -13.910 1.00 . A A .  51 LYS N    1 1 
        3  5778 1 1  51 LYS NZ   N  -2.017 -12.289 -17.801 1.00 . A A .  51 LYS NZ   1 1 
        3  5779 1 1  51 LYS O    O  -6.077 -14.091 -11.430 1.00 . A A .  51 LYS O    1 1 
        3  5780 1 1  52 SER C    C  -2.608 -12.269 -10.566 1.00 . A A .  52 SER C    1 1 
        3  5781 1 1  52 SER CA   C  -3.509 -13.500 -10.599 1.00 . A A .  52 SER CA   1 1 
        3  5782 1 1  52 SER CB   C  -2.777 -14.693  -9.982 1.00 . A A .  52 SER CB   1 1 
        3  5783 1 1  52 SER H    H  -3.241 -13.807 -12.672 1.00 . A A .  52 SER H    1 1 
        3  5784 1 1  52 SER HA   H  -4.400 -13.298 -10.024 1.00 . A A .  52 SER HA   1 1 
        3  5785 1 1  52 SER HB2  H  -1.929 -14.948 -10.599 1.00 . A A .  52 SER HB2  1 1 
        3  5786 1 1  52 SER HB3  H  -2.436 -14.428  -8.992 1.00 . A A .  52 SER HB3  1 1 
        3  5787 1 1  52 SER HG   H  -3.817 -16.156 -10.781 1.00 . A A .  52 SER HG   1 1 
        3  5788 1 1  52 SER N    N  -3.913 -13.819 -11.959 1.00 . A A .  52 SER N    1 1 
        3  5789 1 1  52 SER O    O  -1.938 -11.953 -11.555 1.00 . A A .  52 SER O    1 1 
        3  5790 1 1  52 SER OG   O  -3.625 -15.824  -9.887 1.00 . A A .  52 SER OG   1 1 
        3  5791 1 1  53 PRO C    C  -0.232 -10.916  -9.150 1.00 . A A .  53 PRO C    1 1 
        3  5792 1 1  53 PRO CA   C  -1.678 -10.433  -9.209 1.00 . A A .  53 PRO CA   1 1 
        3  5793 1 1  53 PRO CB   C  -2.106  -9.866  -7.847 1.00 . A A .  53 PRO CB   1 1 
        3  5794 1 1  53 PRO CD   C  -3.506 -11.743  -8.294 1.00 . A A .  53 PRO CD   1 1 
        3  5795 1 1  53 PRO CG   C  -3.474 -10.410  -7.610 1.00 . A A .  53 PRO CG   1 1 
        3  5796 1 1  53 PRO HA   H  -1.778  -9.673  -9.972 1.00 . A A .  53 PRO HA   1 1 
        3  5797 1 1  53 PRO HB2  H  -1.413 -10.195  -7.086 1.00 . A A .  53 PRO HB2  1 1 
        3  5798 1 1  53 PRO HB3  H  -2.115  -8.788  -7.893 1.00 . A A .  53 PRO HB3  1 1 
        3  5799 1 1  53 PRO HD2  H  -3.137 -12.517  -7.637 1.00 . A A .  53 PRO HD2  1 1 
        3  5800 1 1  53 PRO HD3  H  -4.506 -11.974  -8.631 1.00 . A A .  53 PRO HD3  1 1 
        3  5801 1 1  53 PRO HG2  H  -3.642 -10.529  -6.550 1.00 . A A .  53 PRO HG2  1 1 
        3  5802 1 1  53 PRO HG3  H  -4.213  -9.750  -8.039 1.00 . A A .  53 PRO HG3  1 1 
        3  5803 1 1  53 PRO N    N  -2.602 -11.546  -9.436 1.00 . A A .  53 PRO N    1 1 
        3  5804 1 1  53 PRO O    O   0.030 -12.087  -8.865 1.00 . A A .  53 PRO O    1 1 
        3  5805 1 1  54 SER C    C   2.807  -9.809  -8.184 1.00 . A A .  54 SER C    1 1 
        3  5806 1 1  54 SER CA   C   2.114 -10.365  -9.427 1.00 . A A .  54 SER CA   1 1 
        3  5807 1 1  54 SER CB   C   2.767  -9.825 -10.705 1.00 . A A .  54 SER CB   1 1 
        3  5808 1 1  54 SER H    H   0.435  -9.084  -9.572 1.00 . A A .  54 SER H    1 1 
        3  5809 1 1  54 SER HA   H   2.189 -11.442  -9.418 1.00 . A A .  54 SER HA   1 1 
        3  5810 1 1  54 SER HB2  H   2.133 -10.047 -11.552 1.00 . A A .  54 SER HB2  1 1 
        3  5811 1 1  54 SER HB3  H   2.886  -8.755 -10.620 1.00 . A A .  54 SER HB3  1 1 
        3  5812 1 1  54 SER HG   H   4.696  -9.701 -11.061 1.00 . A A .  54 SER HG   1 1 
        3  5813 1 1  54 SER N    N   0.701 -10.015  -9.405 1.00 . A A .  54 SER N    1 1 
        3  5814 1 1  54 SER O    O   4.023  -9.614  -8.162 1.00 . A A .  54 SER O    1 1 
        3  5815 1 1  54 SER OG   O   4.041 -10.409 -10.931 1.00 . A A .  54 SER OG   1 1 
        3  5816 1 1  55 GLY C    C   1.479  -8.886  -4.858 1.00 . A A .  55 GLY C    1 1 
        3  5817 1 1  55 GLY CA   C   2.556  -9.058  -5.906 1.00 . A A .  55 GLY CA   1 1 
        3  5818 1 1  55 GLY H    H   1.057  -9.742  -7.220 1.00 . A A .  55 GLY H    1 1 
        3  5819 1 1  55 GLY HA2  H   3.300  -9.747  -5.535 1.00 . A A .  55 GLY HA2  1 1 
        3  5820 1 1  55 GLY HA3  H   3.022  -8.101  -6.089 1.00 . A A .  55 GLY HA3  1 1 
        3  5821 1 1  55 GLY N    N   2.019  -9.567  -7.147 1.00 . A A .  55 GLY N    1 1 
        3  5822 1 1  55 GLY O    O   0.314  -9.203  -5.114 1.00 . A A .  55 GLY O    1 1 
        3  5823 1 1  56 PRO C    C   0.071  -6.895  -2.775 1.00 . A A .  56 PRO C    1 1 
        3  5824 1 1  56 PRO CA   C   0.896  -8.165  -2.576 1.00 . A A .  56 PRO CA   1 1 
        3  5825 1 1  56 PRO CB   C   1.816  -8.029  -1.366 1.00 . A A .  56 PRO CB   1 1 
        3  5826 1 1  56 PRO CD   C   3.214  -7.981  -3.305 1.00 . A A .  56 PRO CD   1 1 
        3  5827 1 1  56 PRO CG   C   3.066  -7.434  -1.911 1.00 . A A .  56 PRO CG   1 1 
        3  5828 1 1  56 PRO HA   H   0.235  -9.009  -2.445 1.00 . A A .  56 PRO HA   1 1 
        3  5829 1 1  56 PRO HB2  H   1.358  -7.383  -0.630 1.00 . A A .  56 PRO HB2  1 1 
        3  5830 1 1  56 PRO HB3  H   1.999  -9.002  -0.935 1.00 . A A .  56 PRO HB3  1 1 
        3  5831 1 1  56 PRO HD2  H   3.581  -7.215  -3.972 1.00 . A A .  56 PRO HD2  1 1 
        3  5832 1 1  56 PRO HD3  H   3.877  -8.834  -3.308 1.00 . A A .  56 PRO HD3  1 1 
        3  5833 1 1  56 PRO HG2  H   2.977  -6.358  -1.940 1.00 . A A .  56 PRO HG2  1 1 
        3  5834 1 1  56 PRO HG3  H   3.909  -7.727  -1.301 1.00 . A A .  56 PRO HG3  1 1 
        3  5835 1 1  56 PRO N    N   1.841  -8.384  -3.672 1.00 . A A .  56 PRO N    1 1 
        3  5836 1 1  56 PRO O    O   0.443  -6.033  -3.565 1.00 . A A .  56 PRO O    1 1 
        3  5837 1 1  57 PRO C    C  -1.225  -4.332  -1.622 1.00 . A A .  57 PRO C    1 1 
        3  5838 1 1  57 PRO CA   C  -1.920  -5.579  -2.168 1.00 . A A .  57 PRO CA   1 1 
        3  5839 1 1  57 PRO CB   C  -3.134  -5.928  -1.301 1.00 . A A .  57 PRO CB   1 1 
        3  5840 1 1  57 PRO CD   C  -1.646  -7.798  -1.196 1.00 . A A .  57 PRO CD   1 1 
        3  5841 1 1  57 PRO CG   C  -2.678  -7.034  -0.413 1.00 . A A .  57 PRO CG   1 1 
        3  5842 1 1  57 PRO HA   H  -2.242  -5.391  -3.180 1.00 . A A .  57 PRO HA   1 1 
        3  5843 1 1  57 PRO HB2  H  -3.429  -5.061  -0.727 1.00 . A A .  57 PRO HB2  1 1 
        3  5844 1 1  57 PRO HB3  H  -3.951  -6.242  -1.932 1.00 . A A .  57 PRO HB3  1 1 
        3  5845 1 1  57 PRO HD2  H  -0.892  -8.198  -0.534 1.00 . A A .  57 PRO HD2  1 1 
        3  5846 1 1  57 PRO HD3  H  -2.112  -8.588  -1.763 1.00 . A A .  57 PRO HD3  1 1 
        3  5847 1 1  57 PRO HG2  H  -2.239  -6.624   0.485 1.00 . A A .  57 PRO HG2  1 1 
        3  5848 1 1  57 PRO HG3  H  -3.511  -7.675  -0.168 1.00 . A A .  57 PRO HG3  1 1 
        3  5849 1 1  57 PRO N    N  -1.075  -6.775  -2.087 1.00 . A A .  57 PRO N    1 1 
        3  5850 1 1  57 PRO O    O  -0.457  -4.406  -0.654 1.00 . A A .  57 PRO O    1 1 
        3  5851 1 1  58 PHE C    C  -2.037  -1.022  -1.253 1.00 . A A .  58 PHE C    1 1 
        3  5852 1 1  58 PHE CA   C  -0.939  -1.921  -1.803 1.00 . A A .  58 PHE CA   1 1 
        3  5853 1 1  58 PHE CB   C  -0.254  -1.201  -2.980 1.00 . A A .  58 PHE CB   1 1 
        3  5854 1 1  58 PHE CD1  C   1.125  -3.129  -3.830 1.00 . A A .  58 PHE CD1  1 1 
        3  5855 1 1  58 PHE CD2  C   2.185  -1.019  -3.541 1.00 . A A .  58 PHE CD2  1 1 
        3  5856 1 1  58 PHE CE1  C   2.317  -3.668  -4.275 1.00 . A A .  58 PHE CE1  1 1 
        3  5857 1 1  58 PHE CE2  C   3.380  -1.553  -3.986 1.00 . A A .  58 PHE CE2  1 1 
        3  5858 1 1  58 PHE CG   C   1.044  -1.801  -3.455 1.00 . A A .  58 PHE CG   1 1 
        3  5859 1 1  58 PHE CZ   C   3.445  -2.880  -4.353 1.00 . A A .  58 PHE CZ   1 1 
        3  5860 1 1  58 PHE H    H  -2.138  -3.191  -2.995 1.00 . A A .  58 PHE H    1 1 
        3  5861 1 1  58 PHE HA   H  -0.214  -2.117  -1.028 1.00 . A A .  58 PHE HA   1 1 
        3  5862 1 1  58 PHE HB2  H  -0.931  -1.198  -3.820 1.00 . A A .  58 PHE HB2  1 1 
        3  5863 1 1  58 PHE HB3  H  -0.057  -0.179  -2.690 1.00 . A A .  58 PHE HB3  1 1 
        3  5864 1 1  58 PHE HD1  H   0.245  -3.750  -3.769 1.00 . A A .  58 PHE HD1  1 1 
        3  5865 1 1  58 PHE HD2  H   2.137   0.022  -3.254 1.00 . A A .  58 PHE HD2  1 1 
        3  5866 1 1  58 PHE HE1  H   2.363  -4.706  -4.566 1.00 . A A .  58 PHE HE1  1 1 
        3  5867 1 1  58 PHE HE2  H   4.259  -0.932  -4.047 1.00 . A A .  58 PHE HE2  1 1 
        3  5868 1 1  58 PHE HZ   H   4.377  -3.301  -4.700 1.00 . A A .  58 PHE HZ   1 1 
        3  5869 1 1  58 PHE N    N  -1.514  -3.189  -2.230 1.00 . A A .  58 PHE N    1 1 
        3  5870 1 1  58 PHE O    O  -3.221  -1.350  -1.352 1.00 . A A .  58 PHE O    1 1 
        3  5871 1 1  59 ALA C    C  -1.850   2.436   0.002 1.00 . A A .  59 ALA C    1 1 
        3  5872 1 1  59 ALA CA   C  -2.576   1.113  -0.222 1.00 . A A .  59 ALA CA   1 1 
        3  5873 1 1  59 ALA CB   C  -3.294   0.680   1.048 1.00 . A A .  59 ALA CB   1 1 
        3  5874 1 1  59 ALA H    H  -0.681   0.214  -0.465 1.00 . A A .  59 ALA H    1 1 
        3  5875 1 1  59 ALA HA   H  -3.312   1.243  -1.001 1.00 . A A .  59 ALA HA   1 1 
        3  5876 1 1  59 ALA HB1  H  -2.575   0.568   1.846 1.00 . A A .  59 ALA HB1  1 1 
        3  5877 1 1  59 ALA HB2  H  -3.791  -0.263   0.875 1.00 . A A .  59 ALA HB2  1 1 
        3  5878 1 1  59 ALA HB3  H  -4.024   1.427   1.322 1.00 . A A .  59 ALA HB3  1 1 
        3  5879 1 1  59 ALA N    N  -1.638   0.090  -0.654 1.00 . A A .  59 ALA N    1 1 
        3  5880 1 1  59 ALA O    O  -1.003   2.544   0.890 1.00 . A A .  59 ALA O    1 1 
        3  5881 1 1  60 ARG C    C  -2.629   5.765  -0.251 1.00 . A A .  60 ARG C    1 1 
        3  5882 1 1  60 ARG CA   C  -1.561   4.748  -0.638 1.00 . A A .  60 ARG CA   1 1 
        3  5883 1 1  60 ARG CB   C  -0.816   5.220  -1.895 1.00 . A A .  60 ARG CB   1 1 
        3  5884 1 1  60 ARG CD   C  -1.101   6.871  -3.761 1.00 . A A .  60 ARG CD   1 1 
        3  5885 1 1  60 ARG CG   C  -1.718   5.694  -3.025 1.00 . A A .  60 ARG CG   1 1 
        3  5886 1 1  60 ARG CZ   C   0.215   8.829  -3.006 1.00 . A A .  60 ARG CZ   1 1 
        3  5887 1 1  60 ARG H    H  -2.781   3.281  -1.559 1.00 . A A .  60 ARG H    1 1 
        3  5888 1 1  60 ARG HA   H  -0.854   4.676   0.175 1.00 . A A .  60 ARG HA   1 1 
        3  5889 1 1  60 ARG HB2  H  -0.164   6.036  -1.624 1.00 . A A .  60 ARG HB2  1 1 
        3  5890 1 1  60 ARG HB3  H  -0.214   4.402  -2.266 1.00 . A A .  60 ARG HB3  1 1 
        3  5891 1 1  60 ARG HD2  H  -0.190   6.545  -4.241 1.00 . A A .  60 ARG HD2  1 1 
        3  5892 1 1  60 ARG HD3  H  -1.798   7.222  -4.507 1.00 . A A .  60 ARG HD3  1 1 
        3  5893 1 1  60 ARG HE   H  -1.357   8.054  -2.044 1.00 . A A .  60 ARG HE   1 1 
        3  5894 1 1  60 ARG HG2  H  -1.865   4.882  -3.722 1.00 . A A .  60 ARG HG2  1 1 
        3  5895 1 1  60 ARG HG3  H  -2.669   5.994  -2.612 1.00 . A A .  60 ARG HG3  1 1 
        3  5896 1 1  60 ARG HH11 H   0.755   8.125  -4.824 1.00 . A A .  60 ARG HH11 1 1 
        3  5897 1 1  60 ARG HH12 H   1.721   9.443  -4.230 1.00 . A A .  60 ARG HH12 1 1 
        3  5898 1 1  60 ARG HH21 H  -0.104   9.787  -1.248 1.00 . A A .  60 ARG HH21 1 1 
        3  5899 1 1  60 ARG HH22 H   1.239  10.390  -2.181 1.00 . A A .  60 ARG HH22 1 1 
        3  5900 1 1  60 ARG N    N  -2.151   3.433  -0.820 1.00 . A A .  60 ARG N    1 1 
        3  5901 1 1  60 ARG NE   N  -0.792   7.969  -2.840 1.00 . A A .  60 ARG NE   1 1 
        3  5902 1 1  60 ARG NH1  N   0.954   8.793  -4.107 1.00 . A A .  60 ARG NH1  1 1 
        3  5903 1 1  60 ARG NH2  N   0.463   9.739  -2.070 1.00 . A A .  60 ARG NH2  1 1 
        3  5904 1 1  60 ARG O    O  -3.758   5.726  -0.750 1.00 . A A .  60 ARG O    1 1 
        3  5905 1 1  61 TYR C    C  -2.542   9.070   0.891 1.00 . A A .  61 TYR C    1 1 
        3  5906 1 1  61 TYR CA   C  -3.170   7.703   1.115 1.00 . A A .  61 TYR CA   1 1 
        3  5907 1 1  61 TYR CB   C  -3.483   7.509   2.603 1.00 . A A .  61 TYR CB   1 1 
        3  5908 1 1  61 TYR CD1  C  -2.938   5.115   3.202 1.00 . A A .  61 TYR CD1  1 1 
        3  5909 1 1  61 TYR CD2  C  -5.235   5.740   3.067 1.00 . A A .  61 TYR CD2  1 1 
        3  5910 1 1  61 TYR CE1  C  -3.301   3.827   3.527 1.00 . A A .  61 TYR CE1  1 1 
        3  5911 1 1  61 TYR CE2  C  -5.606   4.449   3.394 1.00 . A A .  61 TYR CE2  1 1 
        3  5912 1 1  61 TYR CG   C  -3.895   6.095   2.965 1.00 . A A .  61 TYR CG   1 1 
        3  5913 1 1  61 TYR CZ   C  -4.634   3.497   3.623 1.00 . A A .  61 TYR CZ   1 1 
        3  5914 1 1  61 TYR H    H  -1.347   6.635   1.009 1.00 . A A .  61 TYR H    1 1 
        3  5915 1 1  61 TYR HA   H  -4.085   7.633   0.544 1.00 . A A .  61 TYR HA   1 1 
        3  5916 1 1  61 TYR HB2  H  -2.607   7.758   3.183 1.00 . A A .  61 TYR HB2  1 1 
        3  5917 1 1  61 TYR HB3  H  -4.291   8.171   2.881 1.00 . A A .  61 TYR HB3  1 1 
        3  5918 1 1  61 TYR HD1  H  -1.892   5.376   3.126 1.00 . A A .  61 TYR HD1  1 1 
        3  5919 1 1  61 TYR HD2  H  -5.992   6.488   2.886 1.00 . A A .  61 TYR HD2  1 1 
        3  5920 1 1  61 TYR HE1  H  -2.540   3.081   3.705 1.00 . A A .  61 TYR HE1  1 1 
        3  5921 1 1  61 TYR HE2  H  -6.652   4.190   3.469 1.00 . A A .  61 TYR HE2  1 1 
        3  5922 1 1  61 TYR HH   H  -4.341   1.839   4.563 1.00 . A A .  61 TYR HH   1 1 
        3  5923 1 1  61 TYR N    N  -2.262   6.668   0.645 1.00 . A A .  61 TYR N    1 1 
        3  5924 1 1  61 TYR O    O  -1.416   9.325   1.334 1.00 . A A .  61 TYR O    1 1 
        3  5925 1 1  61 TYR OH   O  -4.996   2.212   3.947 1.00 . A A .  61 TYR OH   1 1 
        3  5926 1 1  62 PHE C    C  -3.609  12.342   0.511 1.00 . A A .  62 PHE C    1 1 
        3  5927 1 1  62 PHE CA   C  -2.741  11.262  -0.126 1.00 . A A .  62 PHE CA   1 1 
        3  5928 1 1  62 PHE CB   C  -2.669  11.459  -1.645 1.00 . A A .  62 PHE CB   1 1 
        3  5929 1 1  62 PHE CD1  C  -0.740  13.044  -1.919 1.00 . A A .  62 PHE CD1  1 1 
        3  5930 1 1  62 PHE CD2  C  -2.913  13.775  -2.578 1.00 . A A .  62 PHE CD2  1 1 
        3  5931 1 1  62 PHE CE1  C  -0.213  14.264  -2.296 1.00 . A A .  62 PHE CE1  1 1 
        3  5932 1 1  62 PHE CE2  C  -2.392  14.996  -2.956 1.00 . A A .  62 PHE CE2  1 1 
        3  5933 1 1  62 PHE CG   C  -2.095  12.785  -2.055 1.00 . A A .  62 PHE CG   1 1 
        3  5934 1 1  62 PHE CZ   C  -1.040  15.241  -2.814 1.00 . A A .  62 PHE CZ   1 1 
        3  5935 1 1  62 PHE H    H  -4.154   9.683  -0.122 1.00 . A A .  62 PHE H    1 1 
        3  5936 1 1  62 PHE HA   H  -1.743  11.334   0.283 1.00 . A A .  62 PHE HA   1 1 
        3  5937 1 1  62 PHE HB2  H  -2.053  10.684  -2.073 1.00 . A A .  62 PHE HB2  1 1 
        3  5938 1 1  62 PHE HB3  H  -3.666  11.386  -2.057 1.00 . A A .  62 PHE HB3  1 1 
        3  5939 1 1  62 PHE HD1  H  -0.094  12.281  -1.513 1.00 . A A .  62 PHE HD1  1 1 
        3  5940 1 1  62 PHE HD2  H  -3.971  13.584  -2.688 1.00 . A A .  62 PHE HD2  1 1 
        3  5941 1 1  62 PHE HE1  H   0.844  14.455  -2.186 1.00 . A A .  62 PHE HE1  1 1 
        3  5942 1 1  62 PHE HE2  H  -3.041  15.758  -3.361 1.00 . A A .  62 PHE HE2  1 1 
        3  5943 1 1  62 PHE HZ   H  -0.628  16.196  -3.111 1.00 . A A .  62 PHE HZ   1 1 
        3  5944 1 1  62 PHE N    N  -3.252   9.938   0.189 1.00 . A A .  62 PHE N    1 1 
        3  5945 1 1  62 PHE O    O  -4.837  12.243   0.520 1.00 . A A .  62 PHE O    1 1 
        3  5946 1 1  63 GLY C    C  -3.634  14.355   3.196 1.00 . A A .  63 GLY C    1 1 
        3  5947 1 1  63 GLY CA   C  -3.678  14.447   1.687 1.00 . A A .  63 GLY CA   1 1 
        3  5948 1 1  63 GLY H    H  -1.980  13.371   1.038 1.00 . A A .  63 GLY H    1 1 
        3  5949 1 1  63 GLY HA2  H  -3.238  15.384   1.379 1.00 . A A .  63 GLY HA2  1 1 
        3  5950 1 1  63 GLY HA3  H  -4.708  14.419   1.367 1.00 . A A .  63 GLY HA3  1 1 
        3  5951 1 1  63 GLY N    N  -2.960  13.359   1.059 1.00 . A A .  63 GLY N    1 1 
        3  5952 1 1  63 GLY O    O  -3.184  15.280   3.866 1.00 . A A .  63 GLY O    1 1 
        3  5953 1 1  64 MET C    C  -4.931  14.035   5.899 1.00 . A A .  64 MET C    1 1 
        3  5954 1 1  64 MET CA   C  -4.122  12.969   5.165 1.00 . A A .  64 MET CA   1 1 
        3  5955 1 1  64 MET CB   C  -2.697  12.900   5.727 1.00 . A A .  64 MET CB   1 1 
        3  5956 1 1  64 MET CE   C  -2.770  10.003   7.049 1.00 . A A .  64 MET CE   1 1 
        3  5957 1 1  64 MET CG   C  -1.860  11.784   5.123 1.00 . A A .  64 MET CG   1 1 
        3  5958 1 1  64 MET H    H  -4.435  12.529   3.116 1.00 . A A .  64 MET H    1 1 
        3  5959 1 1  64 MET HA   H  -4.600  12.014   5.318 1.00 . A A .  64 MET HA   1 1 
        3  5960 1 1  64 MET HB2  H  -2.199  13.839   5.536 1.00 . A A .  64 MET HB2  1 1 
        3  5961 1 1  64 MET HB3  H  -2.751  12.742   6.795 1.00 . A A .  64 MET HB3  1 1 
        3  5962 1 1  64 MET HE1  H  -3.192   9.040   7.294 1.00 . A A .  64 MET HE1  1 1 
        3  5963 1 1  64 MET HE2  H  -3.407  10.785   7.436 1.00 . A A .  64 MET HE2  1 1 
        3  5964 1 1  64 MET HE3  H  -1.788  10.089   7.487 1.00 . A A .  64 MET HE3  1 1 
        3  5965 1 1  64 MET HG2  H  -1.700  11.998   4.076 1.00 . A A .  64 MET HG2  1 1 
        3  5966 1 1  64 MET HG3  H  -0.907  11.753   5.629 1.00 . A A .  64 MET HG3  1 1 
        3  5967 1 1  64 MET N    N  -4.099  13.222   3.722 1.00 . A A .  64 MET N    1 1 
        3  5968 1 1  64 MET O    O  -4.663  14.353   7.057 1.00 . A A .  64 MET O    1 1 
        3  5969 1 1  64 MET SD   S  -2.644  10.165   5.268 1.00 . A A .  64 MET SD   1 1 
        3  5970 1 1  65 SER C    C  -7.797  14.942   6.772 1.00 . A A .  65 SER C    1 1 
        3  5971 1 1  65 SER CA   C  -6.815  15.575   5.786 1.00 . A A .  65 SER CA   1 1 
        3  5972 1 1  65 SER CB   C  -7.565  16.294   4.657 1.00 . A A .  65 SER CB   1 1 
        3  5973 1 1  65 SER H    H  -6.094  14.262   4.301 1.00 . A A .  65 SER H    1 1 
        3  5974 1 1  65 SER HA   H  -6.202  16.289   6.312 1.00 . A A .  65 SER HA   1 1 
        3  5975 1 1  65 SER HB2  H  -6.850  16.681   3.946 1.00 . A A .  65 SER HB2  1 1 
        3  5976 1 1  65 SER HB3  H  -8.219  15.593   4.160 1.00 . A A .  65 SER HB3  1 1 
        3  5977 1 1  65 SER HG   H  -7.871  17.809   5.873 1.00 . A A .  65 SER HG   1 1 
        3  5978 1 1  65 SER N    N  -5.940  14.559   5.218 1.00 . A A .  65 SER N    1 1 
        3  5979 1 1  65 SER O    O  -8.428  15.639   7.571 1.00 . A A .  65 SER O    1 1 
        3  5980 1 1  65 SER OG   O  -8.344  17.373   5.144 1.00 . A A .  65 SER OG   1 1 
        3  5981 1 1  66 ALA C    C -10.262  13.031   7.167 1.00 . A A .  66 ALA C    1 1 
        3  5982 1 1  66 ALA CA   C  -8.802  12.823   7.554 1.00 . A A .  66 ALA CA   1 1 
        3  5983 1 1  66 ALA CB   C  -8.580  13.124   9.032 1.00 . A A .  66 ALA CB   1 1 
        3  5984 1 1  66 ALA H    H  -7.351  13.137   6.052 1.00 . A A .  66 ALA H    1 1 
        3  5985 1 1  66 ALA HA   H  -8.558  11.782   7.394 1.00 . A A .  66 ALA HA   1 1 
        3  5986 1 1  66 ALA HB1  H  -9.224  12.494   9.627 1.00 . A A .  66 ALA HB1  1 1 
        3  5987 1 1  66 ALA HB2  H  -8.811  14.161   9.226 1.00 . A A .  66 ALA HB2  1 1 
        3  5988 1 1  66 ALA HB3  H  -7.549  12.931   9.288 1.00 . A A .  66 ALA HB3  1 1 
        3  5989 1 1  66 ALA N    N  -7.904  13.610   6.703 1.00 . A A .  66 ALA N    1 1 
        3  5990 1 1  66 ALA O    O -10.949  12.073   6.832 1.00 . A A .  66 ALA O    1 1 
        3  5991 1 1  67 GLY C    C -12.429  14.085   5.435 1.00 . A A .  67 GLY C    1 1 
        3  5992 1 1  67 GLY CA   C -12.095  14.589   6.825 1.00 . A A .  67 GLY CA   1 1 
        3  5993 1 1  67 GLY H    H -10.120  15.006   7.481 1.00 . A A .  67 GLY H    1 1 
        3  5994 1 1  67 GLY HA2  H -12.766  14.129   7.537 1.00 . A A .  67 GLY HA2  1 1 
        3  5995 1 1  67 GLY HA3  H -12.233  15.660   6.852 1.00 . A A .  67 GLY HA3  1 1 
        3  5996 1 1  67 GLY N    N -10.723  14.281   7.201 1.00 . A A .  67 GLY N    1 1 
        3  5997 1 1  67 GLY O    O -13.455  13.440   5.227 1.00 . A A .  67 GLY O    1 1 
        3  5998 1 1  68 THR C    C -10.269  13.836   2.508 1.00 . A A .  68 THR C    1 1 
        3  5999 1 1  68 THR CA   C -11.658  13.856   3.137 1.00 . A A .  68 THR CA   1 1 
        3  6000 1 1  68 THR CB   C -12.612  14.693   2.259 1.00 . A A .  68 THR CB   1 1 
        3  6001 1 1  68 THR CG2  C -12.740  14.097   0.862 1.00 . A A .  68 THR CG2  1 1 
        3  6002 1 1  68 THR H    H -10.822  14.999   4.696 1.00 . A A .  68 THR H    1 1 
        3  6003 1 1  68 THR HA   H -12.037  12.845   3.197 1.00 . A A .  68 THR HA   1 1 
        3  6004 1 1  68 THR HB   H -12.212  15.693   2.171 1.00 . A A .  68 THR HB   1 1 
        3  6005 1 1  68 THR HG1  H -13.889  14.279   3.709 1.00 . A A .  68 THR HG1  1 1 
        3  6006 1 1  68 THR HG21 H -13.113  13.087   0.935 1.00 . A A .  68 THR HG21 1 1 
        3  6007 1 1  68 THR HG22 H -11.772  14.090   0.385 1.00 . A A .  68 THR HG22 1 1 
        3  6008 1 1  68 THR HG23 H -13.425  14.693   0.277 1.00 . A A .  68 THR HG23 1 1 
        3  6009 1 1  68 THR N    N -11.560  14.389   4.486 1.00 . A A .  68 THR N    1 1 
        3  6010 1 1  68 THR O    O  -9.549  14.829   2.571 1.00 . A A .  68 THR O    1 1 
        3  6011 1 1  68 THR OG1  O -13.908  14.760   2.868 1.00 . A A .  68 THR OG1  1 1 
        3  6012 1 1  69 PHE C    C  -8.555  11.513   0.240 1.00 . A A .  69 PHE C    1 1 
        3  6013 1 1  69 PHE CA   C  -8.564  12.583   1.326 1.00 . A A .  69 PHE CA   1 1 
        3  6014 1 1  69 PHE CB   C  -7.486  12.298   2.388 1.00 . A A .  69 PHE CB   1 1 
        3  6015 1 1  69 PHE CD1  C  -8.651  11.016   4.211 1.00 . A A .  69 PHE CD1  1 1 
        3  6016 1 1  69 PHE CD2  C  -6.943   9.916   2.964 1.00 . A A .  69 PHE CD2  1 1 
        3  6017 1 1  69 PHE CE1  C  -8.837   9.877   4.968 1.00 . A A .  69 PHE CE1  1 1 
        3  6018 1 1  69 PHE CE2  C  -7.126   8.773   3.717 1.00 . A A .  69 PHE CE2  1 1 
        3  6019 1 1  69 PHE CG   C  -7.704  11.049   3.200 1.00 . A A .  69 PHE CG   1 1 
        3  6020 1 1  69 PHE CZ   C  -8.074   8.754   4.721 1.00 . A A .  69 PHE CZ   1 1 
        3  6021 1 1  69 PHE H    H -10.493  11.936   1.921 1.00 . A A .  69 PHE H    1 1 
        3  6022 1 1  69 PHE HA   H  -8.342  13.533   0.863 1.00 . A A .  69 PHE HA   1 1 
        3  6023 1 1  69 PHE HB2  H  -6.530  12.203   1.896 1.00 . A A .  69 PHE HB2  1 1 
        3  6024 1 1  69 PHE HB3  H  -7.445  13.134   3.072 1.00 . A A .  69 PHE HB3  1 1 
        3  6025 1 1  69 PHE HD1  H  -9.251  11.893   4.403 1.00 . A A .  69 PHE HD1  1 1 
        3  6026 1 1  69 PHE HD2  H  -6.201   9.930   2.179 1.00 . A A .  69 PHE HD2  1 1 
        3  6027 1 1  69 PHE HE1  H  -9.577   9.866   5.754 1.00 . A A .  69 PHE HE1  1 1 
        3  6028 1 1  69 PHE HE2  H  -6.529   7.896   3.522 1.00 . A A .  69 PHE HE2  1 1 
        3  6029 1 1  69 PHE HZ   H  -8.217   7.861   5.312 1.00 . A A .  69 PHE HZ   1 1 
        3  6030 1 1  69 PHE N    N  -9.880  12.703   1.937 1.00 . A A .  69 PHE N    1 1 
        3  6031 1 1  69 PHE O    O  -9.512  10.743   0.103 1.00 . A A .  69 PHE O    1 1 
        3  6032 1 1  70 GLU C    C  -6.844   9.221  -1.269 1.00 . A A .  70 GLU C    1 1 
        3  6033 1 1  70 GLU CA   C  -7.351  10.599  -1.682 1.00 . A A .  70 GLU CA   1 1 
        3  6034 1 1  70 GLU CB   C  -6.389  11.228  -2.698 1.00 . A A .  70 GLU CB   1 1 
        3  6035 1 1  70 GLU CD   C  -7.679  10.982  -4.866 1.00 . A A .  70 GLU CD   1 1 
        3  6036 1 1  70 GLU CG   C  -6.432  10.605  -4.088 1.00 . A A .  70 GLU CG   1 1 
        3  6037 1 1  70 GLU H    H  -6.691  12.028  -0.269 1.00 . A A .  70 GLU H    1 1 
        3  6038 1 1  70 GLU HA   H  -8.329  10.502  -2.128 1.00 . A A .  70 GLU HA   1 1 
        3  6039 1 1  70 GLU HB2  H  -6.629  12.276  -2.798 1.00 . A A .  70 GLU HB2  1 1 
        3  6040 1 1  70 GLU HB3  H  -5.381  11.136  -2.319 1.00 . A A .  70 GLU HB3  1 1 
        3  6041 1 1  70 GLU HG2  H  -5.568  10.936  -4.645 1.00 . A A .  70 GLU HG2  1 1 
        3  6042 1 1  70 GLU HG3  H  -6.400   9.529  -3.986 1.00 . A A .  70 GLU HG3  1 1 
        3  6043 1 1  70 GLU N    N  -7.462  11.468  -0.515 1.00 . A A .  70 GLU N    1 1 
        3  6044 1 1  70 GLU O    O  -5.803   9.103  -0.614 1.00 . A A .  70 GLU O    1 1 
        3  6045 1 1  70 GLU OE1  O  -8.045  12.180  -4.869 1.00 . A A .  70 GLU OE1  1 1 
        3  6046 1 1  70 GLU OE2  O  -8.280  10.092  -5.506 1.00 . A A .  70 GLU OE2  1 1 
        3  6047 1 1  71 VAL C    C  -7.105   5.979  -2.589 1.00 . A A .  71 VAL C    1 1 
        3  6048 1 1  71 VAL CA   C  -7.211   6.821  -1.321 1.00 . A A .  71 VAL CA   1 1 
        3  6049 1 1  71 VAL CB   C  -8.196   6.160  -0.326 1.00 . A A .  71 VAL CB   1 1 
        3  6050 1 1  71 VAL CG1  C  -8.147   6.873   1.010 1.00 . A A .  71 VAL CG1  1 1 
        3  6051 1 1  71 VAL CG2  C  -9.621   6.143  -0.864 1.00 . A A .  71 VAL CG2  1 1 
        3  6052 1 1  71 VAL H    H  -8.408   8.349  -2.157 1.00 . A A .  71 VAL H    1 1 
        3  6053 1 1  71 VAL HA   H  -6.237   6.856  -0.851 1.00 . A A .  71 VAL HA   1 1 
        3  6054 1 1  71 VAL HB   H  -7.884   5.138  -0.172 1.00 . A A .  71 VAL HB   1 1 
        3  6055 1 1  71 VAL HG11 H  -7.164   6.765   1.441 1.00 . A A .  71 VAL HG11 1 1 
        3  6056 1 1  71 VAL HG12 H  -8.883   6.446   1.675 1.00 . A A .  71 VAL HG12 1 1 
        3  6057 1 1  71 VAL HG13 H  -8.361   7.923   0.864 1.00 . A A .  71 VAL HG13 1 1 
        3  6058 1 1  71 VAL HG21 H -10.271   5.664  -0.148 1.00 . A A .  71 VAL HG21 1 1 
        3  6059 1 1  71 VAL HG22 H  -9.647   5.597  -1.795 1.00 . A A .  71 VAL HG22 1 1 
        3  6060 1 1  71 VAL HG23 H  -9.955   7.155  -1.031 1.00 . A A .  71 VAL HG23 1 1 
        3  6061 1 1  71 VAL N    N  -7.586   8.188  -1.638 1.00 . A A .  71 VAL N    1 1 
        3  6062 1 1  71 VAL O    O  -8.044   5.902  -3.390 1.00 . A A .  71 VAL O    1 1 
        3  6063 1 1  72 GLU C    C  -4.915   3.293  -3.474 1.00 . A A .  72 GLU C    1 1 
        3  6064 1 1  72 GLU CA   C  -5.691   4.520  -3.927 1.00 . A A .  72 GLU CA   1 1 
        3  6065 1 1  72 GLU CB   C  -4.891   5.279  -4.993 1.00 . A A .  72 GLU CB   1 1 
        3  6066 1 1  72 GLU CD   C  -4.601   7.438  -6.270 1.00 . A A .  72 GLU CD   1 1 
        3  6067 1 1  72 GLU CG   C  -5.518   6.602  -5.405 1.00 . A A .  72 GLU CG   1 1 
        3  6068 1 1  72 GLU H    H  -5.224   5.506  -2.119 1.00 . A A .  72 GLU H    1 1 
        3  6069 1 1  72 GLU HA   H  -6.640   4.209  -4.339 1.00 . A A .  72 GLU HA   1 1 
        3  6070 1 1  72 GLU HB2  H  -3.902   5.480  -4.607 1.00 . A A .  72 GLU HB2  1 1 
        3  6071 1 1  72 GLU HB3  H  -4.804   4.657  -5.871 1.00 . A A .  72 GLU HB3  1 1 
        3  6072 1 1  72 GLU HG2  H  -6.423   6.400  -5.959 1.00 . A A .  72 GLU HG2  1 1 
        3  6073 1 1  72 GLU HG3  H  -5.761   7.164  -4.513 1.00 . A A .  72 GLU HG3  1 1 
        3  6074 1 1  72 GLU N    N  -5.943   5.373  -2.777 1.00 . A A .  72 GLU N    1 1 
        3  6075 1 1  72 GLU O    O  -3.727   3.387  -3.168 1.00 . A A .  72 GLU O    1 1 
        3  6076 1 1  72 GLU OE1  O  -3.527   7.843  -5.780 1.00 . A A .  72 GLU OE1  1 1 
        3  6077 1 1  72 GLU OE2  O  -4.951   7.693  -7.442 1.00 . A A .  72 GLU OE2  1 1 
        3  6078 1 1  73 PHE C    C  -3.983   0.353  -3.934 1.00 . A A .  73 PHE C    1 1 
        3  6079 1 1  73 PHE CA   C  -4.929   0.952  -2.891 1.00 . A A .  73 PHE CA   1 1 
        3  6080 1 1  73 PHE CB   C  -5.980  -0.076  -2.436 1.00 . A A .  73 PHE CB   1 1 
        3  6081 1 1  73 PHE CD1  C  -8.274   0.726  -3.086 1.00 . A A .  73 PHE CD1  1 1 
        3  6082 1 1  73 PHE CD2  C  -7.310  -1.063  -4.335 1.00 . A A .  73 PHE CD2  1 1 
        3  6083 1 1  73 PHE CE1  C  -9.406   0.671  -3.876 1.00 . A A .  73 PHE CE1  1 1 
        3  6084 1 1  73 PHE CE2  C  -8.440  -1.122  -5.127 1.00 . A A .  73 PHE CE2  1 1 
        3  6085 1 1  73 PHE CG   C  -7.212  -0.139  -3.305 1.00 . A A .  73 PHE CG   1 1 
        3  6086 1 1  73 PHE CZ   C  -9.489  -0.254  -4.898 1.00 . A A .  73 PHE CZ   1 1 
        3  6087 1 1  73 PHE H    H  -6.519   2.121  -3.666 1.00 . A A .  73 PHE H    1 1 
        3  6088 1 1  73 PHE HA   H  -4.342   1.242  -2.031 1.00 . A A .  73 PHE HA   1 1 
        3  6089 1 1  73 PHE HB2  H  -5.529  -1.057  -2.435 1.00 . A A .  73 PHE HB2  1 1 
        3  6090 1 1  73 PHE HB3  H  -6.295   0.166  -1.431 1.00 . A A .  73 PHE HB3  1 1 
        3  6091 1 1  73 PHE HD1  H  -8.211   1.450  -2.289 1.00 . A A .  73 PHE HD1  1 1 
        3  6092 1 1  73 PHE HD2  H  -6.490  -1.743  -4.516 1.00 . A A .  73 PHE HD2  1 1 
        3  6093 1 1  73 PHE HE1  H -10.226   1.351  -3.696 1.00 . A A .  73 PHE HE1  1 1 
        3  6094 1 1  73 PHE HE2  H  -8.503  -1.847  -5.926 1.00 . A A .  73 PHE HE2  1 1 
        3  6095 1 1  73 PHE HZ   H -10.374  -0.299  -5.517 1.00 . A A .  73 PHE HZ   1 1 
        3  6096 1 1  73 PHE N    N  -5.580   2.153  -3.392 1.00 . A A .  73 PHE N    1 1 
        3  6097 1 1  73 PHE O    O  -2.774   0.350  -3.742 1.00 . A A .  73 PHE O    1 1 
        3  6098 1 1  74 GLY C    C  -3.251  -2.060  -5.861 1.00 . A A .  74 GLY C    1 1 
        3  6099 1 1  74 GLY CA   C  -3.680  -0.620  -6.114 1.00 . A A .  74 GLY CA   1 1 
        3  6100 1 1  74 GLY H    H  -5.486  -0.016  -5.191 1.00 . A A .  74 GLY H    1 1 
        3  6101 1 1  74 GLY HA2  H  -4.221  -0.582  -7.048 1.00 . A A .  74 GLY HA2  1 1 
        3  6102 1 1  74 GLY HA3  H  -2.795  -0.007  -6.202 1.00 . A A .  74 GLY HA3  1 1 
        3  6103 1 1  74 GLY N    N  -4.520  -0.067  -5.069 1.00 . A A .  74 GLY N    1 1 
        3  6104 1 1  74 GLY O    O  -2.978  -2.463  -4.723 1.00 . A A .  74 GLY O    1 1 
        3  6105 1 1  75 PHE C    C  -1.729  -4.393  -8.059 1.00 . A A .  75 PHE C    1 1 
        3  6106 1 1  75 PHE CA   C  -2.688  -4.197  -6.892 1.00 . A A .  75 PHE CA   1 1 
        3  6107 1 1  75 PHE CB   C  -3.825  -5.225  -6.998 1.00 . A A .  75 PHE CB   1 1 
        3  6108 1 1  75 PHE CD1  C  -5.755  -4.356  -5.637 1.00 . A A .  75 PHE CD1  1 1 
        3  6109 1 1  75 PHE CD2  C  -4.592  -6.285  -4.855 1.00 . A A .  75 PHE CD2  1 1 
        3  6110 1 1  75 PHE CE1  C  -6.601  -4.421  -4.547 1.00 . A A .  75 PHE CE1  1 1 
        3  6111 1 1  75 PHE CE2  C  -5.439  -6.356  -3.765 1.00 . A A .  75 PHE CE2  1 1 
        3  6112 1 1  75 PHE CG   C  -4.740  -5.286  -5.804 1.00 . A A .  75 PHE CG   1 1 
        3  6113 1 1  75 PHE CZ   C  -6.443  -5.421  -3.611 1.00 . A A .  75 PHE CZ   1 1 
        3  6114 1 1  75 PHE H    H  -3.537  -2.484  -7.789 1.00 . A A .  75 PHE H    1 1 
        3  6115 1 1  75 PHE HA   H  -2.158  -4.336  -5.963 1.00 . A A .  75 PHE HA   1 1 
        3  6116 1 1  75 PHE HB2  H  -4.431  -4.986  -7.860 1.00 . A A .  75 PHE HB2  1 1 
        3  6117 1 1  75 PHE HB3  H  -3.395  -6.207  -7.137 1.00 . A A .  75 PHE HB3  1 1 
        3  6118 1 1  75 PHE HD1  H  -5.879  -3.573  -6.369 1.00 . A A .  75 PHE HD1  1 1 
        3  6119 1 1  75 PHE HD2  H  -3.804  -7.015  -4.973 1.00 . A A .  75 PHE HD2  1 1 
        3  6120 1 1  75 PHE HE1  H  -7.387  -3.689  -4.428 1.00 . A A .  75 PHE HE1  1 1 
        3  6121 1 1  75 PHE HE2  H  -5.312  -7.139  -3.034 1.00 . A A .  75 PHE HE2  1 1 
        3  6122 1 1  75 PHE HZ   H  -7.105  -5.476  -2.760 1.00 . A A .  75 PHE HZ   1 1 
        3  6123 1 1  75 PHE N    N  -3.210  -2.839  -6.933 1.00 . A A .  75 PHE N    1 1 
        3  6124 1 1  75 PHE O    O  -1.997  -3.915  -9.163 1.00 . A A .  75 PHE O    1 1 
        3  6125 1 1  76 PRO C    C  -0.093  -6.486  -9.818 1.00 . A A .  76 PRO C    1 1 
        3  6126 1 1  76 PRO CA   C   0.364  -5.371  -8.894 1.00 . A A .  76 PRO CA   1 1 
        3  6127 1 1  76 PRO CB   C   1.624  -5.799  -8.129 1.00 . A A .  76 PRO CB   1 1 
        3  6128 1 1  76 PRO CD   C  -0.225  -5.736  -6.585 1.00 . A A .  76 PRO CD   1 1 
        3  6129 1 1  76 PRO CG   C   1.275  -5.720  -6.675 1.00 . A A .  76 PRO CG   1 1 
        3  6130 1 1  76 PRO HA   H   0.570  -4.481  -9.472 1.00 . A A .  76 PRO HA   1 1 
        3  6131 1 1  76 PRO HB2  H   1.888  -6.807  -8.413 1.00 . A A .  76 PRO HB2  1 1 
        3  6132 1 1  76 PRO HB3  H   2.436  -5.131  -8.372 1.00 . A A .  76 PRO HB3  1 1 
        3  6133 1 1  76 PRO HD2  H  -0.591  -6.750  -6.517 1.00 . A A .  76 PRO HD2  1 1 
        3  6134 1 1  76 PRO HD3  H  -0.562  -5.150  -5.743 1.00 . A A .  76 PRO HD3  1 1 
        3  6135 1 1  76 PRO HG2  H   1.687  -6.573  -6.154 1.00 . A A .  76 PRO HG2  1 1 
        3  6136 1 1  76 PRO HG3  H   1.664  -4.804  -6.257 1.00 . A A .  76 PRO HG3  1 1 
        3  6137 1 1  76 PRO N    N  -0.621  -5.116  -7.849 1.00 . A A .  76 PRO N    1 1 
        3  6138 1 1  76 PRO O    O  -0.552  -7.532  -9.360 1.00 . A A .  76 PRO O    1 1 
        3  6139 1 1  77 VAL C    C   0.706  -7.845 -12.882 1.00 . A A .  77 VAL C    1 1 
        3  6140 1 1  77 VAL CA   C  -0.440  -7.253 -12.077 1.00 . A A .  77 VAL CA   1 1 
        3  6141 1 1  77 VAL CB   C  -1.484  -6.639 -13.035 1.00 . A A .  77 VAL CB   1 1 
        3  6142 1 1  77 VAL CG1  C  -2.736  -6.229 -12.271 1.00 . A A .  77 VAL CG1  1 1 
        3  6143 1 1  77 VAL CG2  C  -0.896  -5.452 -13.791 1.00 . A A .  77 VAL CG2  1 1 
        3  6144 1 1  77 VAL H    H   0.481  -5.460 -11.432 1.00 . A A .  77 VAL H    1 1 
        3  6145 1 1  77 VAL HA   H  -0.919  -8.049 -11.526 1.00 . A A .  77 VAL HA   1 1 
        3  6146 1 1  77 VAL HB   H  -1.765  -7.393 -13.755 1.00 . A A .  77 VAL HB   1 1 
        3  6147 1 1  77 VAL HG11 H  -3.455  -5.804 -12.957 1.00 . A A .  77 VAL HG11 1 1 
        3  6148 1 1  77 VAL HG12 H  -2.478  -5.496 -11.521 1.00 . A A .  77 VAL HG12 1 1 
        3  6149 1 1  77 VAL HG13 H  -3.168  -7.096 -11.794 1.00 . A A .  77 VAL HG13 1 1 
        3  6150 1 1  77 VAL HG21 H  -0.570  -4.701 -13.086 1.00 . A A .  77 VAL HG21 1 1 
        3  6151 1 1  77 VAL HG22 H  -1.646  -5.031 -14.442 1.00 . A A .  77 VAL HG22 1 1 
        3  6152 1 1  77 VAL HG23 H  -0.054  -5.783 -14.379 1.00 . A A .  77 VAL HG23 1 1 
        3  6153 1 1  77 VAL N    N   0.041  -6.279 -11.114 1.00 . A A .  77 VAL N    1 1 
        3  6154 1 1  77 VAL O    O   1.753  -7.219 -13.051 1.00 . A A .  77 VAL O    1 1 
        3  6155 1 1  78 GLU C    C   1.733  -9.059 -15.474 1.00 . A A .  78 GLU C    1 1 
        3  6156 1 1  78 GLU CA   C   1.502  -9.772 -14.148 1.00 . A A .  78 GLU CA   1 1 
        3  6157 1 1  78 GLU CB   C   1.037 -11.203 -14.420 1.00 . A A .  78 GLU CB   1 1 
        3  6158 1 1  78 GLU CD   C   1.237 -13.135 -16.025 1.00 . A A .  78 GLU CD   1 1 
        3  6159 1 1  78 GLU CG   C   1.943 -11.970 -15.371 1.00 . A A .  78 GLU CG   1 1 
        3  6160 1 1  78 GLU H    H  -0.346  -9.519 -13.152 1.00 . A A .  78 GLU H    1 1 
        3  6161 1 1  78 GLU HA   H   2.425  -9.797 -13.591 1.00 . A A .  78 GLU HA   1 1 
        3  6162 1 1  78 GLU HB2  H   0.999 -11.739 -13.484 1.00 . A A .  78 GLU HB2  1 1 
        3  6163 1 1  78 GLU HB3  H   0.046 -11.172 -14.847 1.00 . A A .  78 GLU HB3  1 1 
        3  6164 1 1  78 GLU HG2  H   2.286 -11.298 -16.144 1.00 . A A .  78 GLU HG2  1 1 
        3  6165 1 1  78 GLU HG3  H   2.790 -12.345 -14.819 1.00 . A A .  78 GLU HG3  1 1 
        3  6166 1 1  78 GLU N    N   0.504  -9.070 -13.352 1.00 . A A .  78 GLU N    1 1 
        3  6167 1 1  78 GLU O    O   2.865  -8.929 -15.942 1.00 . A A .  78 GLU O    1 1 
        3  6168 1 1  78 GLU OE1  O   0.412 -12.895 -16.933 1.00 . A A .  78 GLU OE1  1 1 
        3  6169 1 1  78 GLU OE2  O   1.507 -14.289 -15.646 1.00 . A A .  78 GLU OE2  1 1 
        3  6170 1 1  79 GLY C    C  -0.387  -8.427 -18.275 1.00 . A A .  79 GLY C    1 1 
        3  6171 1 1  79 GLY CA   C   0.729  -7.972 -17.367 1.00 . A A .  79 GLY CA   1 1 
        3  6172 1 1  79 GLY H    H  -0.221  -8.707 -15.637 1.00 . A A .  79 GLY H    1 1 
        3  6173 1 1  79 GLY HA2  H   0.669  -6.900 -17.239 1.00 . A A .  79 GLY HA2  1 1 
        3  6174 1 1  79 GLY HA3  H   1.676  -8.222 -17.822 1.00 . A A .  79 GLY HA3  1 1 
        3  6175 1 1  79 GLY N    N   0.648  -8.606 -16.076 1.00 . A A .  79 GLY N    1 1 
        3  6176 1 1  79 GLY O    O  -0.914  -9.532 -18.110 1.00 . A A .  79 GLY O    1 1 
        3  6177 1 1  80 GLY C    C  -3.183  -7.761 -19.458 1.00 . A A .  80 GLY C    1 1 
        3  6178 1 1  80 GLY CA   C  -1.837  -7.903 -20.129 1.00 . A A .  80 GLY CA   1 1 
        3  6179 1 1  80 GLY H    H  -0.293  -6.714 -19.303 1.00 . A A .  80 GLY H    1 1 
        3  6180 1 1  80 GLY HA2  H  -1.796  -7.239 -20.980 1.00 . A A .  80 GLY HA2  1 1 
        3  6181 1 1  80 GLY HA3  H  -1.721  -8.924 -20.468 1.00 . A A .  80 GLY HA3  1 1 
        3  6182 1 1  80 GLY N    N  -0.754  -7.580 -19.223 1.00 . A A .  80 GLY N    1 1 
        3  6183 1 1  80 GLY O    O  -4.140  -8.451 -19.810 1.00 . A A .  80 GLY O    1 1 
        3  6184 1 1  81 VAL C    C  -5.128  -5.356 -18.182 1.00 . A A .  81 VAL C    1 1 
        3  6185 1 1  81 VAL CA   C  -4.483  -6.658 -17.735 1.00 . A A .  81 VAL CA   1 1 
        3  6186 1 1  81 VAL CB   C  -4.231  -6.620 -16.211 1.00 . A A .  81 VAL CB   1 1 
        3  6187 1 1  81 VAL CG1  C  -5.541  -6.652 -15.434 1.00 . A A .  81 VAL CG1  1 1 
        3  6188 1 1  81 VAL CG2  C  -3.334  -7.773 -15.787 1.00 . A A .  81 VAL CG2  1 1 
        3  6189 1 1  81 VAL H    H  -2.467  -6.320 -18.276 1.00 . A A .  81 VAL H    1 1 
        3  6190 1 1  81 VAL HA   H  -5.154  -7.476 -17.953 1.00 . A A .  81 VAL HA   1 1 
        3  6191 1 1  81 VAL HB   H  -3.728  -5.695 -15.978 1.00 . A A .  81 VAL HB   1 1 
        3  6192 1 1  81 VAL HG11 H  -6.138  -5.793 -15.702 1.00 . A A .  81 VAL HG11 1 1 
        3  6193 1 1  81 VAL HG12 H  -5.332  -6.630 -14.374 1.00 . A A .  81 VAL HG12 1 1 
        3  6194 1 1  81 VAL HG13 H  -6.081  -7.556 -15.676 1.00 . A A .  81 VAL HG13 1 1 
        3  6195 1 1  81 VAL HG21 H  -3.174  -7.734 -14.720 1.00 . A A .  81 VAL HG21 1 1 
        3  6196 1 1  81 VAL HG22 H  -2.383  -7.698 -16.297 1.00 . A A .  81 VAL HG22 1 1 
        3  6197 1 1  81 VAL HG23 H  -3.806  -8.709 -16.046 1.00 . A A .  81 VAL HG23 1 1 
        3  6198 1 1  81 VAL N    N  -3.254  -6.871 -18.481 1.00 . A A .  81 VAL N    1 1 
        3  6199 1 1  81 VAL O    O  -4.438  -4.417 -18.582 1.00 . A A .  81 VAL O    1 1 
        3  6200 1 1  82 GLU C    C  -8.096  -3.570 -17.606 1.00 . A A .  82 GLU C    1 1 
        3  6201 1 1  82 GLU CA   C  -7.187  -4.186 -18.659 1.00 . A A .  82 GLU CA   1 1 
        3  6202 1 1  82 GLU CB   C  -8.010  -4.659 -19.858 1.00 . A A .  82 GLU CB   1 1 
        3  6203 1 1  82 GLU CD   C  -8.026  -5.988 -22.007 1.00 . A A .  82 GLU CD   1 1 
        3  6204 1 1  82 GLU CG   C  -7.185  -5.407 -20.896 1.00 . A A .  82 GLU CG   1 1 
        3  6205 1 1  82 GLU H    H  -6.921  -6.018 -17.643 1.00 . A A .  82 GLU H    1 1 
        3  6206 1 1  82 GLU HA   H  -6.479  -3.442 -18.989 1.00 . A A .  82 GLU HA   1 1 
        3  6207 1 1  82 GLU HB2  H  -8.796  -5.312 -19.510 1.00 . A A .  82 GLU HB2  1 1 
        3  6208 1 1  82 GLU HB3  H  -8.453  -3.797 -20.336 1.00 . A A .  82 GLU HB3  1 1 
        3  6209 1 1  82 GLU HG2  H  -6.472  -4.723 -21.330 1.00 . A A .  82 GLU HG2  1 1 
        3  6210 1 1  82 GLU HG3  H  -6.657  -6.212 -20.406 1.00 . A A .  82 GLU HG3  1 1 
        3  6211 1 1  82 GLU N    N  -6.442  -5.302 -18.106 1.00 . A A .  82 GLU N    1 1 
        3  6212 1 1  82 GLU O    O  -8.715  -4.284 -16.813 1.00 . A A .  82 GLU O    1 1 
        3  6213 1 1  82 GLU OE1  O  -8.788  -6.943 -21.745 1.00 . A A .  82 GLU OE1  1 1 
        3  6214 1 1  82 GLU OE2  O  -7.923  -5.504 -23.154 1.00 . A A .  82 GLU OE2  1 1 
        3  6215 1 1  83 GLY C    C -10.477  -1.750 -16.984 1.00 . A A .  83 GLY C    1 1 
        3  6216 1 1  83 GLY CA   C  -9.012  -1.547 -16.663 1.00 . A A .  83 GLY CA   1 1 
        3  6217 1 1  83 GLY H    H  -7.609  -1.736 -18.231 1.00 . A A .  83 GLY H    1 1 
        3  6218 1 1  83 GLY HA2  H  -8.818  -1.911 -15.664 1.00 . A A .  83 GLY HA2  1 1 
        3  6219 1 1  83 GLY HA3  H  -8.786  -0.492 -16.703 1.00 . A A .  83 GLY HA3  1 1 
        3  6220 1 1  83 GLY N    N  -8.155  -2.248 -17.592 1.00 . A A .  83 GLY N    1 1 
        3  6221 1 1  83 GLY O    O -10.877  -1.708 -18.147 1.00 . A A .  83 GLY O    1 1 
        3  6222 1 1  84 SER C    C -13.485  -0.916 -16.226 1.00 . A A .  84 SER C    1 1 
        3  6223 1 1  84 SER CA   C -12.697  -2.223 -16.124 1.00 . A A .  84 SER CA   1 1 
        3  6224 1 1  84 SER CB   C -13.205  -3.066 -14.955 1.00 . A A .  84 SER CB   1 1 
        3  6225 1 1  84 SER H    H -10.902  -1.967 -15.046 1.00 . A A .  84 SER H    1 1 
        3  6226 1 1  84 SER HA   H -12.828  -2.779 -17.041 1.00 . A A .  84 SER HA   1 1 
        3  6227 1 1  84 SER HB2  H -14.285  -3.027 -14.925 1.00 . A A .  84 SER HB2  1 1 
        3  6228 1 1  84 SER HB3  H -12.885  -4.090 -15.084 1.00 . A A .  84 SER HB3  1 1 
        3  6229 1 1  84 SER HG   H -12.854  -3.229 -13.033 1.00 . A A .  84 SER HG   1 1 
        3  6230 1 1  84 SER N    N -11.276  -1.971 -15.952 1.00 . A A .  84 SER N    1 1 
        3  6231 1 1  84 SER O    O -14.633  -0.903 -16.674 1.00 . A A .  84 SER O    1 1 
        3  6232 1 1  84 SER OG   O -12.693  -2.579 -13.724 1.00 . A A .  84 SER OG   1 1 
        3  6233 1 1  85 GLY C    C -13.021   2.371 -14.746 1.00 . A A .  85 GLY C    1 1 
        3  6234 1 1  85 GLY CA   C -13.519   1.468 -15.850 1.00 . A A .  85 GLY CA   1 1 
        3  6235 1 1  85 GLY H    H -11.923   0.118 -15.531 1.00 . A A .  85 GLY H    1 1 
        3  6236 1 1  85 GLY HA2  H -13.336   1.943 -16.803 1.00 . A A .  85 GLY HA2  1 1 
        3  6237 1 1  85 GLY HA3  H -14.581   1.317 -15.728 1.00 . A A .  85 GLY HA3  1 1 
        3  6238 1 1  85 GLY N    N -12.854   0.181 -15.831 1.00 . A A .  85 GLY N    1 1 
        3  6239 1 1  85 GLY O    O -12.162   3.223 -14.972 1.00 . A A .  85 GLY O    1 1 
        3  6240 1 1  86 ARG C    C -11.791   2.383 -11.856 1.00 . A A .  86 ARG C    1 1 
        3  6241 1 1  86 ARG CA   C -13.101   2.950 -12.390 1.00 . A A .  86 ARG CA   1 1 
        3  6242 1 1  86 ARG CB   C -14.175   2.992 -11.295 1.00 . A A .  86 ARG CB   1 1 
        3  6243 1 1  86 ARG CD   C -15.907   1.765  -9.961 1.00 . A A .  86 ARG CD   1 1 
        3  6244 1 1  86 ARG CG   C -14.707   1.629 -10.885 1.00 . A A .  86 ARG CG   1 1 
        3  6245 1 1  86 ARG CZ   C -17.819   0.229 -10.240 1.00 . A A .  86 ARG CZ   1 1 
        3  6246 1 1  86 ARG H    H -14.280   1.523 -13.438 1.00 . A A .  86 ARG H    1 1 
        3  6247 1 1  86 ARG HA   H -12.915   3.959 -12.728 1.00 . A A .  86 ARG HA   1 1 
        3  6248 1 1  86 ARG HB2  H -13.757   3.467 -10.420 1.00 . A A .  86 ARG HB2  1 1 
        3  6249 1 1  86 ARG HB3  H -15.005   3.587 -11.650 1.00 . A A .  86 ARG HB3  1 1 
        3  6250 1 1  86 ARG HD2  H -15.567   2.129  -9.002 1.00 . A A .  86 ARG HD2  1 1 
        3  6251 1 1  86 ARG HD3  H -16.596   2.476 -10.391 1.00 . A A .  86 ARG HD3  1 1 
        3  6252 1 1  86 ARG HE   H -16.132  -0.207  -9.243 1.00 . A A .  86 ARG HE   1 1 
        3  6253 1 1  86 ARG HG2  H -15.006   1.088 -11.769 1.00 . A A .  86 ARG HG2  1 1 
        3  6254 1 1  86 ARG HG3  H -13.928   1.086 -10.371 1.00 . A A .  86 ARG HG3  1 1 
        3  6255 1 1  86 ARG HH11 H -18.099   2.063 -11.069 1.00 . A A .  86 ARG HH11 1 1 
        3  6256 1 1  86 ARG HH12 H -19.414   0.938 -11.271 1.00 . A A .  86 ARG HH12 1 1 
        3  6257 1 1  86 ARG HH21 H -17.862  -1.670  -9.512 1.00 . A A .  86 ARG HH21 1 1 
        3  6258 1 1  86 ARG HH22 H -19.283  -1.162 -10.385 1.00 . A A .  86 ARG HH22 1 1 
        3  6259 1 1  86 ARG N    N -13.555   2.185 -13.545 1.00 . A A .  86 ARG N    1 1 
        3  6260 1 1  86 ARG NE   N -16.601   0.494  -9.764 1.00 . A A .  86 ARG NE   1 1 
        3  6261 1 1  86 ARG NH1  N -18.496   1.152 -10.913 1.00 . A A .  86 ARG NH1  1 1 
        3  6262 1 1  86 ARG NH2  N -18.366  -0.960 -10.031 1.00 . A A .  86 ARG NH2  1 1 
        3  6263 1 1  86 ARG O    O -11.098   3.023 -11.066 1.00 . A A .  86 ARG O    1 1 
        3  6264 1 1  87 VAL C    C  -9.207   0.984 -13.140 1.00 . A A .  87 VAL C    1 1 
        3  6265 1 1  87 VAL CA   C -10.161   0.600 -12.018 1.00 . A A .  87 VAL CA   1 1 
        3  6266 1 1  87 VAL CB   C -10.225  -0.941 -11.912 1.00 . A A .  87 VAL CB   1 1 
        3  6267 1 1  87 VAL CG1  C  -8.895  -1.501 -11.431 1.00 . A A .  87 VAL CG1  1 1 
        3  6268 1 1  87 VAL CG2  C -11.360  -1.377 -10.995 1.00 . A A .  87 VAL CG2  1 1 
        3  6269 1 1  87 VAL H    H -12.096   0.674 -12.842 1.00 . A A .  87 VAL H    1 1 
        3  6270 1 1  87 VAL HA   H  -9.800   1.002 -11.083 1.00 . A A .  87 VAL HA   1 1 
        3  6271 1 1  87 VAL HB   H -10.418  -1.338 -12.898 1.00 . A A .  87 VAL HB   1 1 
        3  6272 1 1  87 VAL HG11 H  -8.113  -1.207 -12.117 1.00 . A A .  87 VAL HG11 1 1 
        3  6273 1 1  87 VAL HG12 H  -8.951  -2.580 -11.392 1.00 . A A .  87 VAL HG12 1 1 
        3  6274 1 1  87 VAL HG13 H  -8.675  -1.116 -10.447 1.00 . A A .  87 VAL HG13 1 1 
        3  6275 1 1  87 VAL HG21 H -12.304  -1.058 -11.414 1.00 . A A .  87 VAL HG21 1 1 
        3  6276 1 1  87 VAL HG22 H -11.230  -0.930 -10.021 1.00 . A A .  87 VAL HG22 1 1 
        3  6277 1 1  87 VAL HG23 H -11.353  -2.452 -10.901 1.00 . A A .  87 VAL HG23 1 1 
        3  6278 1 1  87 VAL N    N -11.458   1.179 -12.300 1.00 . A A .  87 VAL N    1 1 
        3  6279 1 1  87 VAL O    O  -9.302   0.453 -14.246 1.00 . A A .  87 VAL O    1 1 
        3  6280 1 1  88 VAL C    C  -6.060   1.785 -13.797 1.00 . A A .  88 VAL C    1 1 
        3  6281 1 1  88 VAL CA   C  -7.427   2.444 -13.888 1.00 . A A .  88 VAL CA   1 1 
        3  6282 1 1  88 VAL CB   C  -7.271   3.978 -13.794 1.00 . A A .  88 VAL CB   1 1 
        3  6283 1 1  88 VAL CG1  C  -8.601   4.666 -14.072 1.00 . A A .  88 VAL CG1  1 1 
        3  6284 1 1  88 VAL CG2  C  -6.723   4.393 -12.433 1.00 . A A .  88 VAL CG2  1 1 
        3  6285 1 1  88 VAL H    H  -8.256   2.274 -11.946 1.00 . A A .  88 VAL H    1 1 
        3  6286 1 1  88 VAL HA   H  -7.859   2.209 -14.851 1.00 . A A .  88 VAL HA   1 1 
        3  6287 1 1  88 VAL HB   H  -6.567   4.293 -14.551 1.00 . A A .  88 VAL HB   1 1 
        3  6288 1 1  88 VAL HG11 H  -8.945   4.399 -15.061 1.00 . A A .  88 VAL HG11 1 1 
        3  6289 1 1  88 VAL HG12 H  -8.473   5.737 -14.012 1.00 . A A .  88 VAL HG12 1 1 
        3  6290 1 1  88 VAL HG13 H  -9.331   4.350 -13.341 1.00 . A A .  88 VAL HG13 1 1 
        3  6291 1 1  88 VAL HG21 H  -5.760   3.932 -12.277 1.00 . A A .  88 VAL HG21 1 1 
        3  6292 1 1  88 VAL HG22 H  -7.404   4.074 -11.657 1.00 . A A .  88 VAL HG22 1 1 
        3  6293 1 1  88 VAL HG23 H  -6.619   5.467 -12.400 1.00 . A A .  88 VAL HG23 1 1 
        3  6294 1 1  88 VAL N    N  -8.322   1.927 -12.864 1.00 . A A .  88 VAL N    1 1 
        3  6295 1 1  88 VAL O    O  -5.680   1.252 -12.748 1.00 . A A .  88 VAL O    1 1 
        3  6296 1 1  89 THR C    C  -2.918   2.214 -14.802 1.00 . A A .  89 THR C    1 1 
        3  6297 1 1  89 THR CA   C  -4.031   1.188 -14.979 1.00 . A A .  89 THR CA   1 1 
        3  6298 1 1  89 THR CB   C  -3.860   0.471 -16.331 1.00 . A A .  89 THR CB   1 1 
        3  6299 1 1  89 THR CG2  C  -4.703  -0.791 -16.396 1.00 . A A .  89 THR CG2  1 1 
        3  6300 1 1  89 THR H    H  -5.679   2.293 -15.692 1.00 . A A .  89 THR H    1 1 
        3  6301 1 1  89 THR HA   H  -3.966   0.452 -14.190 1.00 . A A .  89 THR HA   1 1 
        3  6302 1 1  89 THR HB   H  -2.819   0.202 -16.450 1.00 . A A .  89 THR HB   1 1 
        3  6303 1 1  89 THR HG1  H  -3.789   1.092 -18.208 1.00 . A A .  89 THR HG1  1 1 
        3  6304 1 1  89 THR HG21 H  -4.571  -1.263 -17.358 1.00 . A A .  89 THR HG21 1 1 
        3  6305 1 1  89 THR HG22 H  -5.743  -0.535 -16.259 1.00 . A A .  89 THR HG22 1 1 
        3  6306 1 1  89 THR HG23 H  -4.394  -1.472 -15.617 1.00 . A A .  89 THR HG23 1 1 
        3  6307 1 1  89 THR N    N  -5.333   1.818 -14.901 1.00 . A A .  89 THR N    1 1 
        3  6308 1 1  89 THR O    O  -3.016   3.343 -15.288 1.00 . A A .  89 THR O    1 1 
        3  6309 1 1  89 THR OG1  O  -4.242   1.352 -17.395 1.00 . A A .  89 THR OG1  1 1 
        3  6310 1 1  90 GLY C    C   0.368   2.025 -13.132 1.00 . A A .  90 GLY C    1 1 
        3  6311 1 1  90 GLY CA   C  -0.735   2.702 -13.911 1.00 . A A .  90 GLY CA   1 1 
        3  6312 1 1  90 GLY H    H  -1.859   0.927 -13.699 1.00 . A A .  90 GLY H    1 1 
        3  6313 1 1  90 GLY HA2  H  -0.353   3.003 -14.876 1.00 . A A .  90 GLY HA2  1 1 
        3  6314 1 1  90 GLY HA3  H  -1.061   3.579 -13.371 1.00 . A A .  90 GLY HA3  1 1 
        3  6315 1 1  90 GLY N    N  -1.866   1.823 -14.104 1.00 . A A .  90 GLY N    1 1 
        3  6316 1 1  90 GLY O    O   0.586   0.820 -13.272 1.00 . A A .  90 GLY O    1 1 
        3  6317 1 1  91 LEU C    C   2.112   2.920 -10.108 1.00 . A A .  91 LEU C    1 1 
        3  6318 1 1  91 LEU CA   C   2.107   2.238 -11.466 1.00 . A A .  91 LEU CA   1 1 
        3  6319 1 1  91 LEU CB   C   3.482   2.345 -12.144 1.00 . A A .  91 LEU CB   1 1 
        3  6320 1 1  91 LEU CD1  C   4.144   4.751 -11.710 1.00 . A A .  91 LEU CD1  1 1 
        3  6321 1 1  91 LEU CD2  C   5.011   3.550 -13.715 1.00 . A A .  91 LEU CD2  1 1 
        3  6322 1 1  91 LEU CG   C   3.834   3.703 -12.770 1.00 . A A .  91 LEU CG   1 1 
        3  6323 1 1  91 LEU H    H   0.876   3.757 -12.273 1.00 . A A .  91 LEU H    1 1 
        3  6324 1 1  91 LEU HA   H   1.878   1.193 -11.316 1.00 . A A .  91 LEU HA   1 1 
        3  6325 1 1  91 LEU HB2  H   4.236   2.112 -11.406 1.00 . A A .  91 LEU HB2  1 1 
        3  6326 1 1  91 LEU HB3  H   3.529   1.596 -12.922 1.00 . A A .  91 LEU HB3  1 1 
        3  6327 1 1  91 LEU HD11 H   4.373   5.691 -12.189 1.00 . A A .  91 LEU HD11 1 1 
        3  6328 1 1  91 LEU HD12 H   4.991   4.429 -11.123 1.00 . A A .  91 LEU HD12 1 1 
        3  6329 1 1  91 LEU HD13 H   3.287   4.875 -11.063 1.00 . A A .  91 LEU HD13 1 1 
        3  6330 1 1  91 LEU HD21 H   4.751   2.862 -14.506 1.00 . A A .  91 LEU HD21 1 1 
        3  6331 1 1  91 LEU HD22 H   5.861   3.167 -13.170 1.00 . A A .  91 LEU HD22 1 1 
        3  6332 1 1  91 LEU HD23 H   5.260   4.511 -14.140 1.00 . A A .  91 LEU HD23 1 1 
        3  6333 1 1  91 LEU HG   H   2.989   4.053 -13.346 1.00 . A A .  91 LEU HG   1 1 
        3  6334 1 1  91 LEU N    N   1.066   2.789 -12.312 1.00 . A A .  91 LEU N    1 1 
        3  6335 1 1  91 LEU O    O   1.466   3.952  -9.920 1.00 . A A .  91 LEU O    1 1 
        3  6336 1 1  92 THR C    C   3.977   4.019  -7.800 1.00 . A A .  92 THR C    1 1 
        3  6337 1 1  92 THR CA   C   2.942   2.895  -7.834 1.00 . A A .  92 THR CA   1 1 
        3  6338 1 1  92 THR CB   C   3.320   1.804  -6.818 1.00 . A A .  92 THR CB   1 1 
        3  6339 1 1  92 THR CG2  C   2.160   0.844  -6.607 1.00 . A A .  92 THR CG2  1 1 
        3  6340 1 1  92 THR H    H   3.300   1.499  -9.375 1.00 . A A .  92 THR H    1 1 
        3  6341 1 1  92 THR HA   H   1.976   3.298  -7.561 1.00 . A A .  92 THR HA   1 1 
        3  6342 1 1  92 THR HB   H   3.556   2.274  -5.874 1.00 . A A .  92 THR HB   1 1 
        3  6343 1 1  92 THR HG1  H   4.756   0.467  -6.594 1.00 . A A .  92 THR HG1  1 1 
        3  6344 1 1  92 THR HG21 H   1.890   0.394  -7.551 1.00 . A A .  92 THR HG21 1 1 
        3  6345 1 1  92 THR HG22 H   1.313   1.382  -6.210 1.00 . A A .  92 THR HG22 1 1 
        3  6346 1 1  92 THR HG23 H   2.454   0.071  -5.911 1.00 . A A .  92 THR HG23 1 1 
        3  6347 1 1  92 THR N    N   2.831   2.335  -9.169 1.00 . A A .  92 THR N    1 1 
        3  6348 1 1  92 THR O    O   4.977   3.971  -8.516 1.00 . A A .  92 THR O    1 1 
        3  6349 1 1  92 THR OG1  O   4.469   1.080  -7.280 1.00 . A A .  92 THR OG1  1 1 
        3  6350 1 1  93 PRO C    C   5.983   5.890  -6.277 1.00 . A A .  93 PRO C    1 1 
        3  6351 1 1  93 PRO CA   C   4.628   6.217  -6.900 1.00 . A A .  93 PRO CA   1 1 
        3  6352 1 1  93 PRO CB   C   3.856   7.195  -6.009 1.00 . A A .  93 PRO CB   1 1 
        3  6353 1 1  93 PRO CD   C   2.590   5.168  -6.067 1.00 . A A .  93 PRO CD   1 1 
        3  6354 1 1  93 PRO CG   C   2.956   6.335  -5.193 1.00 . A A .  93 PRO CG   1 1 
        3  6355 1 1  93 PRO HA   H   4.780   6.661  -7.872 1.00 . A A .  93 PRO HA   1 1 
        3  6356 1 1  93 PRO HB2  H   4.550   7.743  -5.389 1.00 . A A .  93 PRO HB2  1 1 
        3  6357 1 1  93 PRO HB3  H   3.294   7.882  -6.623 1.00 . A A .  93 PRO HB3  1 1 
        3  6358 1 1  93 PRO HD2  H   2.479   4.273  -5.474 1.00 . A A .  93 PRO HD2  1 1 
        3  6359 1 1  93 PRO HD3  H   1.683   5.375  -6.614 1.00 . A A .  93 PRO HD3  1 1 
        3  6360 1 1  93 PRO HG2  H   3.477   5.992  -4.312 1.00 . A A .  93 PRO HG2  1 1 
        3  6361 1 1  93 PRO HG3  H   2.071   6.888  -4.915 1.00 . A A .  93 PRO HG3  1 1 
        3  6362 1 1  93 PRO N    N   3.740   5.053  -6.980 1.00 . A A .  93 PRO N    1 1 
        3  6363 1 1  93 PRO O    O   6.085   5.055  -5.373 1.00 . A A .  93 PRO O    1 1 
        3  6364 1 1  94 SER C    C   8.638   7.506  -5.241 1.00 . A A .  94 SER C    1 1 
        3  6365 1 1  94 SER CA   C   8.357   6.393  -6.246 1.00 . A A .  94 SER CA   1 1 
        3  6366 1 1  94 SER CB   C   9.372   6.423  -7.395 1.00 . A A .  94 SER CB   1 1 
        3  6367 1 1  94 SER H    H   6.869   7.184  -7.512 1.00 . A A .  94 SER H    1 1 
        3  6368 1 1  94 SER HA   H   8.412   5.438  -5.743 1.00 . A A .  94 SER HA   1 1 
        3  6369 1 1  94 SER HB2  H   9.054   5.741  -8.170 1.00 . A A .  94 SER HB2  1 1 
        3  6370 1 1  94 SER HB3  H   9.423   7.423  -7.797 1.00 . A A .  94 SER HB3  1 1 
        3  6371 1 1  94 SER HG   H  10.585   5.346  -6.285 1.00 . A A .  94 SER HG   1 1 
        3  6372 1 1  94 SER N    N   7.016   6.553  -6.771 1.00 . A A .  94 SER N    1 1 
        3  6373 1 1  94 SER O    O   7.940   8.521  -5.224 1.00 . A A .  94 SER O    1 1 
        3  6374 1 1  94 SER OG   O  10.668   6.039  -6.959 1.00 . A A .  94 SER OG   1 1 
        3  6375 1 1  95 GLY C    C  10.524   7.643  -2.157 1.00 . A A .  95 GLY C    1 1 
        3  6376 1 1  95 GLY CA   C   9.960   8.299  -3.392 1.00 . A A .  95 GLY CA   1 1 
        3  6377 1 1  95 GLY H    H  10.179   6.496  -4.471 1.00 . A A .  95 GLY H    1 1 
        3  6378 1 1  95 GLY HA2  H  10.687   8.991  -3.787 1.00 . A A .  95 GLY HA2  1 1 
        3  6379 1 1  95 GLY HA3  H   9.063   8.837  -3.126 1.00 . A A .  95 GLY HA3  1 1 
        3  6380 1 1  95 GLY N    N   9.642   7.315  -4.404 1.00 . A A .  95 GLY N    1 1 
        3  6381 1 1  95 GLY O    O  11.186   6.615  -2.258 1.00 . A A .  95 GLY O    1 1 
        3  6382 1 1  96 LYS C    C   9.828   7.985   1.408 1.00 . A A .  96 LYS C    1 1 
        3  6383 1 1  96 LYS CA   C  10.747   7.631   0.250 1.00 . A A .  96 LYS CA   1 1 
        3  6384 1 1  96 LYS CB   C  12.164   8.117   0.549 1.00 . A A .  96 LYS CB   1 1 
        3  6385 1 1  96 LYS CD   C  13.660  10.023   1.174 1.00 . A A .  96 LYS CD   1 1 
        3  6386 1 1  96 LYS CE   C  14.515   9.971  -0.082 1.00 . A A .  96 LYS CE   1 1 
        3  6387 1 1  96 LYS CG   C  12.237   9.591   0.893 1.00 . A A .  96 LYS CG   1 1 
        3  6388 1 1  96 LYS H    H   9.698   9.020  -0.964 1.00 . A A .  96 LYS H    1 1 
        3  6389 1 1  96 LYS HA   H  10.763   6.558   0.135 1.00 . A A .  96 LYS HA   1 1 
        3  6390 1 1  96 LYS HB2  H  12.556   7.556   1.383 1.00 . A A .  96 LYS HB2  1 1 
        3  6391 1 1  96 LYS HB3  H  12.783   7.941  -0.317 1.00 . A A .  96 LYS HB3  1 1 
        3  6392 1 1  96 LYS HD2  H  13.646  11.030   1.552 1.00 . A A .  96 LYS HD2  1 1 
        3  6393 1 1  96 LYS HD3  H  14.085   9.365   1.916 1.00 . A A .  96 LYS HD3  1 1 
        3  6394 1 1  96 LYS HE2  H  14.602   8.942  -0.398 1.00 . A A .  96 LYS HE2  1 1 
        3  6395 1 1  96 LYS HE3  H  14.028  10.545  -0.858 1.00 . A A .  96 LYS HE3  1 1 
        3  6396 1 1  96 LYS HG2  H  11.853  10.165   0.063 1.00 . A A .  96 LYS HG2  1 1 
        3  6397 1 1  96 LYS HG3  H  11.633   9.775   1.770 1.00 . A A .  96 LYS HG3  1 1 
        3  6398 1 1  96 LYS HZ1  H  15.804  11.492   0.523 1.00 . A A .  96 LYS HZ1  1 1 
        3  6399 1 1  96 LYS HZ2  H  16.407  10.546  -0.746 1.00 . A A .  96 LYS HZ2  1 1 
        3  6400 1 1  96 LYS HZ3  H  16.391   9.932   0.836 1.00 . A A .  96 LYS HZ3  1 1 
        3  6401 1 1  96 LYS N    N  10.254   8.204  -0.993 1.00 . A A .  96 LYS N    1 1 
        3  6402 1 1  96 LYS NZ   N  15.873  10.521   0.149 1.00 . A A .  96 LYS NZ   1 1 
        3  6403 1 1  96 LYS O    O   9.068   8.951   1.338 1.00 . A A .  96 LYS O    1 1 
        3  6404 1 1  97 ALA C    C   9.693   6.629   4.834 1.00 . A A .  97 ALA C    1 1 
        3  6405 1 1  97 ALA CA   C   9.103   7.400   3.657 1.00 . A A .  97 ALA CA   1 1 
        3  6406 1 1  97 ALA CB   C   7.663   6.973   3.409 1.00 . A A .  97 ALA CB   1 1 
        3  6407 1 1  97 ALA H    H  10.541   6.442   2.447 1.00 . A A .  97 ALA H    1 1 
        3  6408 1 1  97 ALA HA   H   9.111   8.457   3.886 1.00 . A A .  97 ALA HA   1 1 
        3  6409 1 1  97 ALA HB1  H   7.077   7.139   4.302 1.00 . A A .  97 ALA HB1  1 1 
        3  6410 1 1  97 ALA HB2  H   7.637   5.924   3.151 1.00 . A A .  97 ALA HB2  1 1 
        3  6411 1 1  97 ALA HB3  H   7.250   7.552   2.596 1.00 . A A .  97 ALA HB3  1 1 
        3  6412 1 1  97 ALA N    N   9.907   7.191   2.465 1.00 . A A .  97 ALA N    1 1 
        3  6413 1 1  97 ALA O    O  10.669   5.888   4.678 1.00 . A A .  97 ALA O    1 1 
        3  6414 1 1  98 ALA C    C   8.642   4.795   7.276 1.00 . A A .  98 ALA C    1 1 
        3  6415 1 1  98 ALA CA   C   9.497   6.048   7.179 1.00 . A A .  98 ALA CA   1 1 
        3  6416 1 1  98 ALA CB   C   9.351   6.891   8.434 1.00 . A A .  98 ALA CB   1 1 
        3  6417 1 1  98 ALA H    H   8.385   7.468   6.082 1.00 . A A .  98 ALA H    1 1 
        3  6418 1 1  98 ALA HA   H  10.535   5.764   7.072 1.00 . A A .  98 ALA HA   1 1 
        3  6419 1 1  98 ALA HB1  H   9.646   6.309   9.294 1.00 . A A .  98 ALA HB1  1 1 
        3  6420 1 1  98 ALA HB2  H   8.323   7.199   8.543 1.00 . A A .  98 ALA HB2  1 1 
        3  6421 1 1  98 ALA HB3  H   9.983   7.764   8.355 1.00 . A A .  98 ALA HB3  1 1 
        3  6422 1 1  98 ALA N    N   9.108   6.810   6.006 1.00 . A A .  98 ALA N    1 1 
        3  6423 1 1  98 ALA O    O   7.416   4.883   7.346 1.00 . A A .  98 ALA O    1 1 
        3  6424 1 1  99 SER C    C   8.875   1.520   8.466 1.00 . A A .  99 SER C    1 1 
        3  6425 1 1  99 SER CA   C   8.553   2.378   7.250 1.00 . A A .  99 SER CA   1 1 
        3  6426 1 1  99 SER CB   C   8.885   1.612   5.968 1.00 . A A .  99 SER CB   1 1 
        3  6427 1 1  99 SER H    H  10.261   3.622   7.300 1.00 . A A .  99 SER H    1 1 
        3  6428 1 1  99 SER HA   H   7.497   2.606   7.256 1.00 . A A .  99 SER HA   1 1 
        3  6429 1 1  99 SER HB2  H   8.390   0.651   5.988 1.00 . A A .  99 SER HB2  1 1 
        3  6430 1 1  99 SER HB3  H   8.540   2.177   5.115 1.00 . A A .  99 SER HB3  1 1 
        3  6431 1 1  99 SER HG   H  10.753   1.946   6.486 1.00 . A A .  99 SER HG   1 1 
        3  6432 1 1  99 SER N    N   9.280   3.636   7.276 1.00 . A A .  99 SER N    1 1 
        3  6433 1 1  99 SER O    O   9.894   1.713   9.130 1.00 . A A .  99 SER O    1 1 
        3  6434 1 1  99 SER OG   O  10.285   1.404   5.841 1.00 . A A .  99 SER OG   1 1 
        3  6435 1 1 100 SER C    C   7.580  -1.722   9.348 1.00 . A A . 100 SER C    1 1 
        3  6436 1 1 100 SER CA   C   8.222  -0.413   9.781 1.00 . A A . 100 SER CA   1 1 
        3  6437 1 1 100 SER CB   C   7.658   0.031  11.132 1.00 . A A . 100 SER CB   1 1 
        3  6438 1 1 100 SER H    H   7.123   0.589   8.286 1.00 . A A . 100 SER H    1 1 
        3  6439 1 1 100 SER HA   H   9.291  -0.554   9.868 1.00 . A A . 100 SER HA   1 1 
        3  6440 1 1 100 SER HB2  H   6.587   0.138  11.055 1.00 . A A . 100 SER HB2  1 1 
        3  6441 1 1 100 SER HB3  H   7.894  -0.711  11.880 1.00 . A A . 100 SER HB3  1 1 
        3  6442 1 1 100 SER HG   H   8.749   1.624  10.811 1.00 . A A . 100 SER HG   1 1 
        3  6443 1 1 100 SER N    N   7.983   0.594   8.765 1.00 . A A . 100 SER N    1 1 
        3  6444 1 1 100 SER O    O   6.649  -1.723   8.538 1.00 . A A . 100 SER O    1 1 
        3  6445 1 1 100 SER OG   O   8.213   1.273  11.529 1.00 . A A . 100 SER OG   1 1 
        3  6446 1 1 101 LEU C    C   6.511  -4.580  10.519 1.00 . A A . 101 LEU C    1 1 
        3  6447 1 1 101 LEU CA   C   7.550  -4.130   9.502 1.00 . A A . 101 LEU CA   1 1 
        3  6448 1 1 101 LEU CB   C   8.674  -5.163   9.392 1.00 . A A . 101 LEU CB   1 1 
        3  6449 1 1 101 LEU CD1  C  10.864  -5.884   8.416 1.00 . A A . 101 LEU CD1  1 1 
        3  6450 1 1 101 LEU CD2  C   9.244  -4.607   7.015 1.00 . A A . 101 LEU CD2  1 1 
        3  6451 1 1 101 LEU CG   C   9.797  -4.804   8.416 1.00 . A A . 101 LEU CG   1 1 
        3  6452 1 1 101 LEU H    H   8.818  -2.772  10.510 1.00 . A A . 101 LEU H    1 1 
        3  6453 1 1 101 LEU HA   H   7.072  -4.031   8.539 1.00 . A A . 101 LEU HA   1 1 
        3  6454 1 1 101 LEU HB2  H   9.105  -5.299  10.371 1.00 . A A . 101 LEU HB2  1 1 
        3  6455 1 1 101 LEU HB3  H   8.242  -6.102   9.075 1.00 . A A . 101 LEU HB3  1 1 
        3  6456 1 1 101 LEU HD11 H  11.286  -5.970   9.406 1.00 . A A . 101 LEU HD11 1 1 
        3  6457 1 1 101 LEU HD12 H  11.640  -5.621   7.714 1.00 . A A . 101 LEU HD12 1 1 
        3  6458 1 1 101 LEU HD13 H  10.422  -6.826   8.129 1.00 . A A . 101 LEU HD13 1 1 
        3  6459 1 1 101 LEU HD21 H   8.547  -3.782   7.017 1.00 . A A . 101 LEU HD21 1 1 
        3  6460 1 1 101 LEU HD22 H   8.736  -5.505   6.699 1.00 . A A . 101 LEU HD22 1 1 
        3  6461 1 1 101 LEU HD23 H  10.055  -4.392   6.336 1.00 . A A . 101 LEU HD23 1 1 
        3  6462 1 1 101 LEU HG   H  10.257  -3.878   8.730 1.00 . A A . 101 LEU HG   1 1 
        3  6463 1 1 101 LEU N    N   8.081  -2.830   9.864 1.00 . A A . 101 LEU N    1 1 
        3  6464 1 1 101 LEU O    O   6.840  -4.893  11.665 1.00 . A A . 101 LEU O    1 1 
        3  6465 1 1 102 TYR C    C   3.908  -6.518  10.691 1.00 . A A . 102 TYR C    1 1 
        3  6466 1 1 102 TYR CA   C   4.162  -5.035  10.943 1.00 . A A . 102 TYR CA   1 1 
        3  6467 1 1 102 TYR CB   C   2.902  -4.204  10.650 1.00 . A A . 102 TYR CB   1 1 
        3  6468 1 1 102 TYR CD1  C   1.530  -4.217  12.778 1.00 . A A . 102 TYR CD1  1 1 
        3  6469 1 1 102 TYR CD2  C   0.666  -5.352  10.869 1.00 . A A . 102 TYR CD2  1 1 
        3  6470 1 1 102 TYR CE1  C   0.407  -4.575  13.502 1.00 . A A . 102 TYR CE1  1 1 
        3  6471 1 1 102 TYR CE2  C  -0.458  -5.713  11.586 1.00 . A A . 102 TYR CE2  1 1 
        3  6472 1 1 102 TYR CG   C   1.679  -4.600  11.450 1.00 . A A . 102 TYR CG   1 1 
        3  6473 1 1 102 TYR CZ   C  -0.583  -5.323  12.901 1.00 . A A . 102 TYR CZ   1 1 
        3  6474 1 1 102 TYR H    H   5.057  -4.265   9.191 1.00 . A A . 102 TYR H    1 1 
        3  6475 1 1 102 TYR HA   H   4.452  -4.896  11.973 1.00 . A A . 102 TYR HA   1 1 
        3  6476 1 1 102 TYR HB2  H   3.109  -3.166  10.865 1.00 . A A . 102 TYR HB2  1 1 
        3  6477 1 1 102 TYR HB3  H   2.657  -4.301   9.602 1.00 . A A . 102 TYR HB3  1 1 
        3  6478 1 1 102 TYR HD1  H   2.308  -3.630  13.247 1.00 . A A . 102 TYR HD1  1 1 
        3  6479 1 1 102 TYR HD2  H   0.766  -5.657   9.839 1.00 . A A . 102 TYR HD2  1 1 
        3  6480 1 1 102 TYR HE1  H   0.308  -4.267  14.532 1.00 . A A . 102 TYR HE1  1 1 
        3  6481 1 1 102 TYR HE2  H  -1.232  -6.298  11.113 1.00 . A A . 102 TYR HE2  1 1 
        3  6482 1 1 102 TYR HH   H  -1.887  -6.626  13.450 1.00 . A A . 102 TYR HH   1 1 
        3  6483 1 1 102 TYR N    N   5.257  -4.581  10.100 1.00 . A A . 102 TYR N    1 1 
        3  6484 1 1 102 TYR O    O   3.306  -6.888   9.686 1.00 . A A . 102 TYR O    1 1 
        3  6485 1 1 102 TYR OH   O  -1.704  -5.687  13.613 1.00 . A A . 102 TYR OH   1 1 
        3  6486 1 1 103 ILE C    C   3.133  -9.326  12.316 1.00 . A A . 103 ILE C    1 1 
        3  6487 1 1 103 ILE CA   C   4.259  -8.809  11.429 1.00 . A A . 103 ILE CA   1 1 
        3  6488 1 1 103 ILE CB   C   5.557  -9.592  11.773 1.00 . A A . 103 ILE CB   1 1 
        3  6489 1 1 103 ILE CD1  C   7.459  -7.976  11.257 1.00 . A A . 103 ILE CD1  1 1 
        3  6490 1 1 103 ILE CG1  C   6.707  -9.217  10.836 1.00 . A A . 103 ILE CG1  1 1 
        3  6491 1 1 103 ILE CG2  C   5.314 -11.092  11.712 1.00 . A A . 103 ILE CG2  1 1 
        3  6492 1 1 103 ILE H    H   4.900  -7.014  12.354 1.00 . A A . 103 ILE H    1 1 
        3  6493 1 1 103 ILE HA   H   4.008  -9.009  10.397 1.00 . A A . 103 ILE HA   1 1 
        3  6494 1 1 103 ILE HB   H   5.836  -9.343  12.787 1.00 . A A . 103 ILE HB   1 1 
        3  6495 1 1 103 ILE HD11 H   7.892  -8.132  12.235 1.00 . A A . 103 ILE HD11 1 1 
        3  6496 1 1 103 ILE HD12 H   6.779  -7.139  11.295 1.00 . A A . 103 ILE HD12 1 1 
        3  6497 1 1 103 ILE HD13 H   8.244  -7.772  10.544 1.00 . A A . 103 ILE HD13 1 1 
        3  6498 1 1 103 ILE HG12 H   7.412 -10.034  10.802 1.00 . A A . 103 ILE HG12 1 1 
        3  6499 1 1 103 ILE HG13 H   6.313  -9.048   9.845 1.00 . A A . 103 ILE HG13 1 1 
        3  6500 1 1 103 ILE HG21 H   4.531 -11.359  12.407 1.00 . A A . 103 ILE HG21 1 1 
        3  6501 1 1 103 ILE HG22 H   6.222 -11.616  11.974 1.00 . A A . 103 ILE HG22 1 1 
        3  6502 1 1 103 ILE HG23 H   5.016 -11.369  10.711 1.00 . A A . 103 ILE HG23 1 1 
        3  6503 1 1 103 ILE N    N   4.413  -7.365  11.579 1.00 . A A . 103 ILE N    1 1 
        3  6504 1 1 103 ILE O    O   3.159  -9.138  13.534 1.00 . A A . 103 ILE O    1 1 
        3  6505 1 1 104 GLY C    C  -0.269 -10.341  11.835 1.00 . A A . 104 GLY C    1 1 
        3  6506 1 1 104 GLY CA   C   1.086 -10.588  12.454 1.00 . A A . 104 GLY CA   1 1 
        3  6507 1 1 104 GLY H    H   2.134  -9.988  10.718 1.00 . A A . 104 GLY H    1 1 
        3  6508 1 1 104 GLY HA2  H   1.264 -11.652  12.496 1.00 . A A . 104 GLY HA2  1 1 
        3  6509 1 1 104 GLY HA3  H   1.088 -10.192  13.459 1.00 . A A . 104 GLY HA3  1 1 
        3  6510 1 1 104 GLY N    N   2.151  -9.963  11.701 1.00 . A A . 104 GLY N    1 1 
        3  6511 1 1 104 GLY O    O  -0.357  -9.840  10.714 1.00 . A A . 104 GLY O    1 1 
        3  6512 1 1 105 PRO C    C  -2.998  -8.914  12.292 1.00 . A A . 105 PRO C    1 1 
        3  6513 1 1 105 PRO CA   C  -2.711 -10.397  12.104 1.00 . A A . 105 PRO CA   1 1 
        3  6514 1 1 105 PRO CB   C  -3.599 -11.245  13.027 1.00 . A A . 105 PRO CB   1 1 
        3  6515 1 1 105 PRO CD   C  -1.340 -11.464  13.789 1.00 . A A . 105 PRO CD   1 1 
        3  6516 1 1 105 PRO CG   C  -2.669 -12.160  13.755 1.00 . A A . 105 PRO CG   1 1 
        3  6517 1 1 105 PRO HA   H  -2.881 -10.671  11.071 1.00 . A A . 105 PRO HA   1 1 
        3  6518 1 1 105 PRO HB2  H  -4.127 -10.597  13.712 1.00 . A A . 105 PRO HB2  1 1 
        3  6519 1 1 105 PRO HB3  H  -4.309 -11.800  12.434 1.00 . A A . 105 PRO HB3  1 1 
        3  6520 1 1 105 PRO HD2  H  -1.279 -10.802  14.641 1.00 . A A . 105 PRO HD2  1 1 
        3  6521 1 1 105 PRO HD3  H  -0.535 -12.183  13.805 1.00 . A A . 105 PRO HD3  1 1 
        3  6522 1 1 105 PRO HG2  H  -3.029 -12.328  14.760 1.00 . A A . 105 PRO HG2  1 1 
        3  6523 1 1 105 PRO HG3  H  -2.587 -13.097  13.225 1.00 . A A . 105 PRO HG3  1 1 
        3  6524 1 1 105 PRO N    N  -1.351 -10.712  12.532 1.00 . A A . 105 PRO N    1 1 
        3  6525 1 1 105 PRO O    O  -2.145  -8.173  12.777 1.00 . A A . 105 PRO O    1 1 
        3  6526 1 1 106 TYR C    C  -5.152  -6.719  13.348 1.00 . A A . 106 TYR C    1 1 
        3  6527 1 1 106 TYR CA   C  -4.490  -7.053  12.020 1.00 . A A . 106 TYR CA   1 1 
        3  6528 1 1 106 TYR CB   C  -5.382  -6.631  10.848 1.00 . A A . 106 TYR CB   1 1 
        3  6529 1 1 106 TYR CD1  C  -4.322  -4.547   9.899 1.00 . A A . 106 TYR CD1  1 1 
        3  6530 1 1 106 TYR CD2  C  -6.418  -4.328  11.014 1.00 . A A . 106 TYR CD2  1 1 
        3  6531 1 1 106 TYR CE1  C  -4.304  -3.187   9.651 1.00 . A A . 106 TYR CE1  1 1 
        3  6532 1 1 106 TYR CE2  C  -6.407  -2.965  10.770 1.00 . A A . 106 TYR CE2  1 1 
        3  6533 1 1 106 TYR CG   C  -5.377  -5.140  10.583 1.00 . A A . 106 TYR CG   1 1 
        3  6534 1 1 106 TYR CZ   C  -5.348  -2.399  10.088 1.00 . A A . 106 TYR CZ   1 1 
        3  6535 1 1 106 TYR H    H  -4.894  -9.106  11.670 1.00 . A A . 106 TYR H    1 1 
        3  6536 1 1 106 TYR HA   H  -3.554  -6.519  11.958 1.00 . A A . 106 TYR HA   1 1 
        3  6537 1 1 106 TYR HB2  H  -5.043  -7.126   9.951 1.00 . A A . 106 TYR HB2  1 1 
        3  6538 1 1 106 TYR HB3  H  -6.400  -6.928  11.055 1.00 . A A . 106 TYR HB3  1 1 
        3  6539 1 1 106 TYR HD1  H  -3.505  -5.167   9.559 1.00 . A A . 106 TYR HD1  1 1 
        3  6540 1 1 106 TYR HD2  H  -7.246  -4.772  11.549 1.00 . A A . 106 TYR HD2  1 1 
        3  6541 1 1 106 TYR HE1  H  -3.474  -2.748   9.114 1.00 . A A . 106 TYR HE1  1 1 
        3  6542 1 1 106 TYR HE2  H  -7.224  -2.351  11.113 1.00 . A A . 106 TYR HE2  1 1 
        3  6543 1 1 106 TYR HH   H  -5.026  -0.878   8.950 1.00 . A A . 106 TYR HH   1 1 
        3  6544 1 1 106 TYR N    N  -4.195  -8.472  11.954 1.00 . A A . 106 TYR N    1 1 
        3  6545 1 1 106 TYR O    O  -6.053  -7.425  13.806 1.00 . A A . 106 TYR O    1 1 
        3  6546 1 1 106 TYR OH   O  -5.334  -1.043   9.848 1.00 . A A . 106 TYR OH   1 1 
        3  6547 1 1 107 GLY C    C  -4.821  -3.783  15.516 1.00 . A A . 107 GLY C    1 1 
        3  6548 1 1 107 GLY CA   C  -5.215  -5.211  15.230 1.00 . A A . 107 GLY CA   1 1 
        3  6549 1 1 107 GLY H    H  -3.922  -5.167  13.565 1.00 . A A . 107 GLY H    1 1 
        3  6550 1 1 107 GLY HA2  H  -6.292  -5.283  15.198 1.00 . A A . 107 GLY HA2  1 1 
        3  6551 1 1 107 GLY HA3  H  -4.840  -5.843  16.021 1.00 . A A . 107 GLY HA3  1 1 
        3  6552 1 1 107 GLY N    N  -4.672  -5.658  13.969 1.00 . A A . 107 GLY N    1 1 
        3  6553 1 1 107 GLY O    O  -5.238  -2.868  14.806 1.00 . A A . 107 GLY O    1 1 
        3  6554 1 1 108 GLU C    C  -2.314  -1.885  15.984 1.00 . A A . 108 GLU C    1 1 
        3  6555 1 1 108 GLU CA   C  -3.523  -2.248  16.850 1.00 . A A . 108 GLU CA   1 1 
        3  6556 1 1 108 GLU CB   C  -3.211  -2.106  18.348 1.00 . A A . 108 GLU CB   1 1 
        3  6557 1 1 108 GLU CD   C  -2.003  -2.969  20.384 1.00 . A A . 108 GLU CD   1 1 
        3  6558 1 1 108 GLU CG   C  -2.316  -3.197  18.920 1.00 . A A . 108 GLU CG   1 1 
        3  6559 1 1 108 GLU H    H  -3.701  -4.344  17.077 1.00 . A A . 108 GLU H    1 1 
        3  6560 1 1 108 GLU HA   H  -4.324  -1.564  16.605 1.00 . A A . 108 GLU HA   1 1 
        3  6561 1 1 108 GLU HB2  H  -2.725  -1.156  18.510 1.00 . A A . 108 GLU HB2  1 1 
        3  6562 1 1 108 GLU HB3  H  -4.144  -2.115  18.895 1.00 . A A . 108 GLU HB3  1 1 
        3  6563 1 1 108 GLU HG2  H  -2.815  -4.148  18.817 1.00 . A A . 108 GLU HG2  1 1 
        3  6564 1 1 108 GLU HG3  H  -1.389  -3.213  18.366 1.00 . A A . 108 GLU HG3  1 1 
        3  6565 1 1 108 GLU N    N  -3.997  -3.582  16.534 1.00 . A A . 108 GLU N    1 1 
        3  6566 1 1 108 GLU O    O  -1.161  -2.131  16.346 1.00 . A A . 108 GLU O    1 1 
        3  6567 1 1 108 GLU OE1  O  -2.880  -3.240  21.235 1.00 . A A . 108 GLU OE1  1 1 
        3  6568 1 1 108 GLU OE2  O  -0.889  -2.500  20.694 1.00 . A A . 108 GLU OE2  1 1 
        3  6569 1 1 109 ILE C    C  -0.844   0.345  14.382 1.00 . A A . 109 ILE C    1 1 
        3  6570 1 1 109 ILE CA   C  -1.553  -0.913  13.882 1.00 . A A . 109 ILE CA   1 1 
        3  6571 1 1 109 ILE CB   C  -2.128  -0.686  12.457 1.00 . A A . 109 ILE CB   1 1 
        3  6572 1 1 109 ILE CD1  C  -1.464  -0.377  10.001 1.00 . A A . 109 ILE CD1  1 1 
        3  6573 1 1 109 ILE CG1  C  -0.994  -0.511  11.436 1.00 . A A . 109 ILE CG1  1 1 
        3  6574 1 1 109 ILE CG2  C  -3.065   0.515  12.438 1.00 . A A . 109 ILE CG2  1 1 
        3  6575 1 1 109 ILE H    H  -3.537  -1.149  14.587 1.00 . A A . 109 ILE H    1 1 
        3  6576 1 1 109 ILE HA   H  -0.833  -1.717  13.832 1.00 . A A . 109 ILE HA   1 1 
        3  6577 1 1 109 ILE HB   H  -2.706  -1.558  12.192 1.00 . A A . 109 ILE HB   1 1 
        3  6578 1 1 109 ILE HD11 H  -2.005  -1.267   9.714 1.00 . A A . 109 ILE HD11 1 1 
        3  6579 1 1 109 ILE HD12 H  -0.608  -0.252   9.354 1.00 . A A . 109 ILE HD12 1 1 
        3  6580 1 1 109 ILE HD13 H  -2.112   0.482   9.913 1.00 . A A . 109 ILE HD13 1 1 
        3  6581 1 1 109 ILE HG12 H  -0.436   0.379  11.681 1.00 . A A . 109 ILE HG12 1 1 
        3  6582 1 1 109 ILE HG13 H  -0.336  -1.367  11.491 1.00 . A A . 109 ILE HG13 1 1 
        3  6583 1 1 109 ILE HG21 H  -3.451   0.654  11.438 1.00 . A A . 109 ILE HG21 1 1 
        3  6584 1 1 109 ILE HG22 H  -2.524   1.399  12.742 1.00 . A A . 109 ILE HG22 1 1 
        3  6585 1 1 109 ILE HG23 H  -3.886   0.343  13.120 1.00 . A A . 109 ILE HG23 1 1 
        3  6586 1 1 109 ILE N    N  -2.597  -1.309  14.820 1.00 . A A . 109 ILE N    1 1 
        3  6587 1 1 109 ILE O    O   0.206   0.730  13.871 1.00 . A A . 109 ILE O    1 1 
        3  6588 1 1 110 GLU C    C   0.638   1.858  16.476 1.00 . A A . 110 GLU C    1 1 
        3  6589 1 1 110 GLU CA   C  -0.822   2.111  16.097 1.00 . A A . 110 GLU CA   1 1 
        3  6590 1 1 110 GLU CB   C  -1.629   2.421  17.352 1.00 . A A . 110 GLU CB   1 1 
        3  6591 1 1 110 GLU CD   C  -2.830   1.406  19.326 1.00 . A A . 110 GLU CD   1 1 
        3  6592 1 1 110 GLU CG   C  -1.734   1.238  18.300 1.00 . A A . 110 GLU CG   1 1 
        3  6593 1 1 110 GLU H    H  -2.295   0.635  15.724 1.00 . A A . 110 GLU H    1 1 
        3  6594 1 1 110 GLU HA   H  -0.870   2.960  15.430 1.00 . A A . 110 GLU HA   1 1 
        3  6595 1 1 110 GLU HB2  H  -1.157   3.237  17.879 1.00 . A A . 110 GLU HB2  1 1 
        3  6596 1 1 110 GLU HB3  H  -2.628   2.716  17.065 1.00 . A A . 110 GLU HB3  1 1 
        3  6597 1 1 110 GLU HG2  H  -1.938   0.347  17.725 1.00 . A A . 110 GLU HG2  1 1 
        3  6598 1 1 110 GLU HG3  H  -0.792   1.123  18.817 1.00 . A A . 110 GLU HG3  1 1 
        3  6599 1 1 110 GLU N    N  -1.418   0.960  15.413 1.00 . A A . 110 GLU N    1 1 
        3  6600 1 1 110 GLU O    O   1.408   2.795  16.686 1.00 . A A . 110 GLU O    1 1 
        3  6601 1 1 110 GLU OE1  O  -3.994   1.613  18.920 1.00 . A A . 110 GLU OE1  1 1 
        3  6602 1 1 110 GLU OE2  O  -2.537   1.310  20.537 1.00 . A A . 110 GLU OE2  1 1 
        3  6603 1 1 111 ALA C    C   3.367   0.806  15.921 1.00 . A A . 111 ALA C    1 1 
        3  6604 1 1 111 ALA CA   C   2.361   0.181  16.885 1.00 . A A . 111 ALA CA   1 1 
        3  6605 1 1 111 ALA CB   C   2.478  -1.333  16.852 1.00 . A A . 111 ALA CB   1 1 
        3  6606 1 1 111 ALA H    H   0.321  -0.113  16.431 1.00 . A A . 111 ALA H    1 1 
        3  6607 1 1 111 ALA HA   H   2.584   0.512  17.889 1.00 . A A . 111 ALA HA   1 1 
        3  6608 1 1 111 ALA HB1  H   3.482  -1.622  17.122 1.00 . A A . 111 ALA HB1  1 1 
        3  6609 1 1 111 ALA HB2  H   2.256  -1.686  15.858 1.00 . A A . 111 ALA HB2  1 1 
        3  6610 1 1 111 ALA HB3  H   1.778  -1.763  17.553 1.00 . A A . 111 ALA HB3  1 1 
        3  6611 1 1 111 ALA N    N   1.000   0.582  16.574 1.00 . A A . 111 ALA N    1 1 
        3  6612 1 1 111 ALA O    O   4.438   1.241  16.338 1.00 . A A . 111 ALA O    1 1 
        3  6613 1 1 112 VAL C    C   3.975   2.945  13.741 1.00 . A A . 112 VAL C    1 1 
        3  6614 1 1 112 VAL CA   C   3.922   1.422  13.637 1.00 . A A . 112 VAL CA   1 1 
        3  6615 1 1 112 VAL CB   C   3.539   1.000  12.196 1.00 . A A . 112 VAL CB   1 1 
        3  6616 1 1 112 VAL CG1  C   2.177   1.545  11.792 1.00 . A A . 112 VAL CG1  1 1 
        3  6617 1 1 112 VAL CG2  C   4.601   1.453  11.208 1.00 . A A . 112 VAL CG2  1 1 
        3  6618 1 1 112 VAL H    H   2.136   0.531  14.359 1.00 . A A . 112 VAL H    1 1 
        3  6619 1 1 112 VAL HA   H   4.909   1.035  13.845 1.00 . A A . 112 VAL HA   1 1 
        3  6620 1 1 112 VAL HB   H   3.490  -0.078  12.163 1.00 . A A . 112 VAL HB   1 1 
        3  6621 1 1 112 VAL HG11 H   2.192   2.624  11.839 1.00 . A A . 112 VAL HG11 1 1 
        3  6622 1 1 112 VAL HG12 H   1.422   1.167  12.467 1.00 . A A . 112 VAL HG12 1 1 
        3  6623 1 1 112 VAL HG13 H   1.949   1.229  10.785 1.00 . A A . 112 VAL HG13 1 1 
        3  6624 1 1 112 VAL HG21 H   4.339   1.112  10.216 1.00 . A A . 112 VAL HG21 1 1 
        3  6625 1 1 112 VAL HG22 H   5.556   1.038  11.491 1.00 . A A . 112 VAL HG22 1 1 
        3  6626 1 1 112 VAL HG23 H   4.661   2.532  11.212 1.00 . A A . 112 VAL HG23 1 1 
        3  6627 1 1 112 VAL N    N   3.017   0.864  14.637 1.00 . A A . 112 VAL N    1 1 
        3  6628 1 1 112 VAL O    O   5.017   3.555  13.506 1.00 . A A . 112 VAL O    1 1 
        3  6629 1 1 113 TYR C    C   3.763   5.411  15.408 1.00 . A A . 113 TYR C    1 1 
        3  6630 1 1 113 TYR CA   C   2.798   4.998  14.306 1.00 . A A . 113 TYR CA   1 1 
        3  6631 1 1 113 TYR CB   C   1.379   5.449  14.669 1.00 . A A . 113 TYR CB   1 1 
        3  6632 1 1 113 TYR CD1  C  -0.292   4.038  13.397 1.00 . A A . 113 TYR CD1  1 1 
        3  6633 1 1 113 TYR CD2  C   0.040   6.293  12.704 1.00 . A A . 113 TYR CD2  1 1 
        3  6634 1 1 113 TYR CE1  C  -1.226   3.864  12.394 1.00 . A A . 113 TYR CE1  1 1 
        3  6635 1 1 113 TYR CE2  C  -0.895   6.127  11.700 1.00 . A A . 113 TYR CE2  1 1 
        3  6636 1 1 113 TYR CG   C   0.359   5.254  13.568 1.00 . A A . 113 TYR CG   1 1 
        3  6637 1 1 113 TYR CZ   C  -1.525   4.911  11.549 1.00 . A A . 113 TYR CZ   1 1 
        3  6638 1 1 113 TYR H    H   2.048   3.019  14.274 1.00 . A A . 113 TYR H    1 1 
        3  6639 1 1 113 TYR HA   H   3.096   5.469  13.380 1.00 . A A . 113 TYR HA   1 1 
        3  6640 1 1 113 TYR HB2  H   1.044   4.889  15.530 1.00 . A A . 113 TYR HB2  1 1 
        3  6641 1 1 113 TYR HB3  H   1.400   6.500  14.919 1.00 . A A . 113 TYR HB3  1 1 
        3  6642 1 1 113 TYR HD1  H  -0.055   3.218  14.058 1.00 . A A . 113 TYR HD1  1 1 
        3  6643 1 1 113 TYR HD2  H   0.537   7.245  12.822 1.00 . A A . 113 TYR HD2  1 1 
        3  6644 1 1 113 TYR HE1  H  -1.722   2.910  12.277 1.00 . A A . 113 TYR HE1  1 1 
        3  6645 1 1 113 TYR HE2  H  -1.128   6.947  11.036 1.00 . A A . 113 TYR HE2  1 1 
        3  6646 1 1 113 TYR HH   H  -2.088   5.027   9.712 1.00 . A A . 113 TYR HH   1 1 
        3  6647 1 1 113 TYR N    N   2.853   3.554  14.117 1.00 . A A . 113 TYR N    1 1 
        3  6648 1 1 113 TYR O    O   4.561   6.328  15.241 1.00 . A A . 113 TYR O    1 1 
        3  6649 1 1 113 TYR OH   O  -2.457   4.743  10.553 1.00 . A A . 113 TYR OH   1 1 
        3  6650 1 1 114 ASP C    C   6.006   4.653  17.369 1.00 . A A . 114 ASP C    1 1 
        3  6651 1 1 114 ASP CA   C   4.543   4.976  17.675 1.00 . A A . 114 ASP CA   1 1 
        3  6652 1 1 114 ASP CB   C   4.055   4.168  18.877 1.00 . A A . 114 ASP CB   1 1 
        3  6653 1 1 114 ASP CG   C   4.939   4.321  20.097 1.00 . A A . 114 ASP CG   1 1 
        3  6654 1 1 114 ASP H    H   3.040   3.966  16.576 1.00 . A A . 114 ASP H    1 1 
        3  6655 1 1 114 ASP HA   H   4.462   6.028  17.902 1.00 . A A . 114 ASP HA   1 1 
        3  6656 1 1 114 ASP HB2  H   3.059   4.492  19.139 1.00 . A A . 114 ASP HB2  1 1 
        3  6657 1 1 114 ASP HB3  H   4.025   3.123  18.608 1.00 . A A . 114 ASP HB3  1 1 
        3  6658 1 1 114 ASP N    N   3.691   4.700  16.523 1.00 . A A . 114 ASP N    1 1 
        3  6659 1 1 114 ASP O    O   6.912   5.377  17.794 1.00 . A A . 114 ASP O    1 1 
        3  6660 1 1 114 ASP OD1  O   5.176   5.469  20.526 1.00 . A A . 114 ASP OD1  1 1 
        3  6661 1 1 114 ASP OD2  O   5.367   3.284  20.652 1.00 . A A . 114 ASP OD2  1 1 
        3  6662 1 1 115 ALA C    C   8.235   4.260  15.385 1.00 . A A . 115 ALA C    1 1 
        3  6663 1 1 115 ALA CA   C   7.576   3.176  16.225 1.00 . A A . 115 ALA CA   1 1 
        3  6664 1 1 115 ALA CB   C   7.538   1.864  15.454 1.00 . A A . 115 ALA CB   1 1 
        3  6665 1 1 115 ALA H    H   5.464   3.036  16.324 1.00 . A A . 115 ALA H    1 1 
        3  6666 1 1 115 ALA HA   H   8.156   3.025  17.124 1.00 . A A . 115 ALA HA   1 1 
        3  6667 1 1 115 ALA HB1  H   8.545   1.560  15.213 1.00 . A A . 115 ALA HB1  1 1 
        3  6668 1 1 115 ALA HB2  H   6.975   1.999  14.542 1.00 . A A . 115 ALA HB2  1 1 
        3  6669 1 1 115 ALA HB3  H   7.068   1.105  16.059 1.00 . A A . 115 ALA HB3  1 1 
        3  6670 1 1 115 ALA N    N   6.227   3.576  16.619 1.00 . A A . 115 ALA N    1 1 
        3  6671 1 1 115 ALA O    O   9.362   4.683  15.656 1.00 . A A . 115 ALA O    1 1 
        3  6672 1 1 116 LEU C    C   8.179   7.071  14.246 1.00 . A A . 116 LEU C    1 1 
        3  6673 1 1 116 LEU CA   C   8.021   5.761  13.491 1.00 . A A . 116 LEU CA   1 1 
        3  6674 1 1 116 LEU CB   C   7.090   5.949  12.297 1.00 . A A . 116 LEU CB   1 1 
        3  6675 1 1 116 LEU CD1  C   6.018   5.023  10.234 1.00 . A A . 116 LEU CD1  1 1 
        3  6676 1 1 116 LEU CD2  C   8.361   4.389  10.814 1.00 . A A . 116 LEU CD2  1 1 
        3  6677 1 1 116 LEU CG   C   6.991   4.743  11.364 1.00 . A A . 116 LEU CG   1 1 
        3  6678 1 1 116 LEU H    H   6.619   4.347  14.208 1.00 . A A . 116 LEU H    1 1 
        3  6679 1 1 116 LEU HA   H   8.992   5.448  13.135 1.00 . A A . 116 LEU HA   1 1 
        3  6680 1 1 116 LEU HB2  H   6.101   6.173  12.669 1.00 . A A . 116 LEU HB2  1 1 
        3  6681 1 1 116 LEU HB3  H   7.441   6.792  11.722 1.00 . A A . 116 LEU HB3  1 1 
        3  6682 1 1 116 LEU HD11 H   5.032   5.196  10.639 1.00 . A A . 116 LEU HD11 1 1 
        3  6683 1 1 116 LEU HD12 H   5.988   4.175   9.565 1.00 . A A . 116 LEU HD12 1 1 
        3  6684 1 1 116 LEU HD13 H   6.342   5.897   9.690 1.00 . A A . 116 LEU HD13 1 1 
        3  6685 1 1 116 LEU HD21 H   8.280   3.520  10.178 1.00 . A A . 116 LEU HD21 1 1 
        3  6686 1 1 116 LEU HD22 H   9.034   4.178  11.632 1.00 . A A . 116 LEU HD22 1 1 
        3  6687 1 1 116 LEU HD23 H   8.741   5.221  10.239 1.00 . A A . 116 LEU HD23 1 1 
        3  6688 1 1 116 LEU HG   H   6.623   3.893  11.921 1.00 . A A . 116 LEU HG   1 1 
        3  6689 1 1 116 LEU N    N   7.516   4.721  14.371 1.00 . A A . 116 LEU N    1 1 
        3  6690 1 1 116 LEU O    O   9.135   7.810  14.016 1.00 . A A . 116 LEU O    1 1 
        3  6691 1 1 117 MET C    C   8.622   8.649  16.714 1.00 . A A . 117 MET C    1 1 
        3  6692 1 1 117 MET CA   C   7.295   8.545  15.981 1.00 . A A . 117 MET CA   1 1 
        3  6693 1 1 117 MET CB   C   6.141   8.576  16.987 1.00 . A A . 117 MET CB   1 1 
        3  6694 1 1 117 MET CE   C   6.101  11.500  15.692 1.00 . A A . 117 MET CE   1 1 
        3  6695 1 1 117 MET CG   C   4.836   9.110  16.412 1.00 . A A . 117 MET CG   1 1 
        3  6696 1 1 117 MET H    H   6.499   6.711  15.276 1.00 . A A . 117 MET H    1 1 
        3  6697 1 1 117 MET HA   H   7.202   9.393  15.319 1.00 . A A . 117 MET HA   1 1 
        3  6698 1 1 117 MET HB2  H   5.967   7.571  17.343 1.00 . A A . 117 MET HB2  1 1 
        3  6699 1 1 117 MET HB3  H   6.425   9.199  17.821 1.00 . A A . 117 MET HB3  1 1 
        3  6700 1 1 117 MET HE1  H   6.054  11.181  14.661 1.00 . A A . 117 MET HE1  1 1 
        3  6701 1 1 117 MET HE2  H   6.994  11.101  16.151 1.00 . A A . 117 MET HE2  1 1 
        3  6702 1 1 117 MET HE3  H   6.126  12.578  15.736 1.00 . A A . 117 MET HE3  1 1 
        3  6703 1 1 117 MET HG2  H   4.790   8.854  15.365 1.00 . A A . 117 MET HG2  1 1 
        3  6704 1 1 117 MET HG3  H   4.013   8.637  16.929 1.00 . A A . 117 MET HG3  1 1 
        3  6705 1 1 117 MET N    N   7.245   7.341  15.157 1.00 . A A . 117 MET N    1 1 
        3  6706 1 1 117 MET O    O   9.231   9.718  16.749 1.00 . A A . 117 MET O    1 1 
        3  6707 1 1 117 MET SD   S   4.661  10.902  16.570 1.00 . A A . 117 MET SD   1 1 
        3  6708 1 1 118 LYS C    C  11.468   7.791  16.963 1.00 . A A . 118 LYS C    1 1 
        3  6709 1 1 118 LYS CA   C  10.356   7.509  17.965 1.00 . A A . 118 LYS CA   1 1 
        3  6710 1 1 118 LYS CB   C  10.573   6.145  18.647 1.00 . A A . 118 LYS CB   1 1 
        3  6711 1 1 118 LYS CD   C  13.102   6.112  18.998 1.00 . A A . 118 LYS CD   1 1 
        3  6712 1 1 118 LYS CE   C  14.218   6.108  20.034 1.00 . A A . 118 LYS CE   1 1 
        3  6713 1 1 118 LYS CG   C  11.723   6.110  19.658 1.00 . A A . 118 LYS CG   1 1 
        3  6714 1 1 118 LYS H    H   8.523   6.723  17.251 1.00 . A A . 118 LYS H    1 1 
        3  6715 1 1 118 LYS HA   H  10.356   8.286  18.713 1.00 . A A . 118 LYS HA   1 1 
        3  6716 1 1 118 LYS HB2  H   9.666   5.873  19.164 1.00 . A A . 118 LYS HB2  1 1 
        3  6717 1 1 118 LYS HB3  H  10.771   5.405  17.883 1.00 . A A . 118 LYS HB3  1 1 
        3  6718 1 1 118 LYS HD2  H  13.196   5.231  18.382 1.00 . A A . 118 LYS HD2  1 1 
        3  6719 1 1 118 LYS HD3  H  13.196   6.996  18.384 1.00 . A A . 118 LYS HD3  1 1 
        3  6720 1 1 118 LYS HE2  H  14.134   7.000  20.638 1.00 . A A . 118 LYS HE2  1 1 
        3  6721 1 1 118 LYS HE3  H  14.102   5.238  20.664 1.00 . A A . 118 LYS HE3  1 1 
        3  6722 1 1 118 LYS HG2  H  11.647   6.978  20.295 1.00 . A A . 118 LYS HG2  1 1 
        3  6723 1 1 118 LYS HG3  H  11.625   5.217  20.259 1.00 . A A . 118 LYS HG3  1 1 
        3  6724 1 1 118 LYS HZ1  H  15.634   5.281  18.732 1.00 . A A . 118 LYS HZ1  1 1 
        3  6725 1 1 118 LYS HZ2  H  16.300   5.944  20.141 1.00 . A A . 118 LYS HZ2  1 1 
        3  6726 1 1 118 LYS HZ3  H  15.757   6.965  18.898 1.00 . A A . 118 LYS HZ3  1 1 
        3  6727 1 1 118 LYS N    N   9.071   7.539  17.286 1.00 . A A . 118 LYS N    1 1 
        3  6728 1 1 118 LYS NZ   N  15.569   6.073  19.407 1.00 . A A . 118 LYS NZ   1 1 
        3  6729 1 1 118 LYS O    O  12.242   8.730  17.135 1.00 . A A . 118 LYS O    1 1 
        3  6730 1 1 119 TRP C    C  12.753   8.440  14.309 1.00 . A A . 119 TRP C    1 1 
        3  6731 1 1 119 TRP CA   C  12.581   7.047  14.921 1.00 . A A . 119 TRP CA   1 1 
        3  6732 1 1 119 TRP CB   C  12.311   6.017  13.822 1.00 . A A . 119 TRP CB   1 1 
        3  6733 1 1 119 TRP CD1  C  14.588   5.313  12.885 1.00 . A A . 119 TRP CD1  1 1 
        3  6734 1 1 119 TRP CD2  C  13.347   6.525  11.467 1.00 . A A . 119 TRP CD2  1 1 
        3  6735 1 1 119 TRP CE2  C  14.565   6.204  10.838 1.00 . A A . 119 TRP CE2  1 1 
        3  6736 1 1 119 TRP CE3  C  12.406   7.280  10.760 1.00 . A A . 119 TRP CE3  1 1 
        3  6737 1 1 119 TRP CG   C  13.384   5.948  12.779 1.00 . A A . 119 TRP CG   1 1 
        3  6738 1 1 119 TRP CH2  C  13.926   7.353   8.878 1.00 . A A . 119 TRP CH2  1 1 
        3  6739 1 1 119 TRP CZ2  C  14.867   6.617   9.544 1.00 . A A . 119 TRP CZ2  1 1 
        3  6740 1 1 119 TRP CZ3  C  12.707   7.687   9.475 1.00 . A A . 119 TRP CZ3  1 1 
        3  6741 1 1 119 TRP H    H  10.776   6.350  15.771 1.00 . A A . 119 TRP H    1 1 
        3  6742 1 1 119 TRP HA   H  13.496   6.780  15.427 1.00 . A A . 119 TRP HA   1 1 
        3  6743 1 1 119 TRP HB2  H  12.223   5.040  14.272 1.00 . A A . 119 TRP HB2  1 1 
        3  6744 1 1 119 TRP HB3  H  11.382   6.266  13.329 1.00 . A A . 119 TRP HB3  1 1 
        3  6745 1 1 119 TRP HD1  H  14.918   4.777  13.763 1.00 . A A . 119 TRP HD1  1 1 
        3  6746 1 1 119 TRP HE1  H  16.209   5.103  11.558 1.00 . A A . 119 TRP HE1  1 1 
        3  6747 1 1 119 TRP HE3  H  11.458   7.547  11.204 1.00 . A A . 119 TRP HE3  1 1 
        3  6748 1 1 119 TRP HH2  H  14.119   7.694   7.870 1.00 . A A . 119 TRP HH2  1 1 
        3  6749 1 1 119 TRP HZ2  H  15.805   6.368   9.069 1.00 . A A . 119 TRP HZ2  1 1 
        3  6750 1 1 119 TRP HZ3  H  11.992   8.271   8.914 1.00 . A A . 119 TRP HZ3  1 1 
        3  6751 1 1 119 TRP N    N  11.503   6.998  15.901 1.00 . A A . 119 TRP N    1 1 
        3  6752 1 1 119 TRP NE1  N  15.305   5.467  11.725 1.00 . A A . 119 TRP NE1  1 1 
        3  6753 1 1 119 TRP O    O  13.844   9.009  14.343 1.00 . A A . 119 TRP O    1 1 
        3  6754 1 1 120 VAL C    C  12.098  11.426  13.958 1.00 . A A . 120 VAL C    1 1 
        3  6755 1 1 120 VAL CA   C  11.761  10.256  13.040 1.00 . A A . 120 VAL CA   1 1 
        3  6756 1 1 120 VAL CB   C  10.456  10.565  12.278 1.00 . A A . 120 VAL CB   1 1 
        3  6757 1 1 120 VAL CG1  C   9.276  10.687  13.229 1.00 . A A . 120 VAL CG1  1 1 
        3  6758 1 1 120 VAL CG2  C  10.609  11.827  11.437 1.00 . A A . 120 VAL CG2  1 1 
        3  6759 1 1 120 VAL H    H  10.802   8.552  13.875 1.00 . A A . 120 VAL H    1 1 
        3  6760 1 1 120 VAL HA   H  12.554  10.155  12.313 1.00 . A A . 120 VAL HA   1 1 
        3  6761 1 1 120 VAL HB   H  10.259   9.742  11.617 1.00 . A A . 120 VAL HB   1 1 
        3  6762 1 1 120 VAL HG11 H   8.383  10.916  12.666 1.00 . A A . 120 VAL HG11 1 1 
        3  6763 1 1 120 VAL HG12 H   9.466  11.477  13.939 1.00 . A A . 120 VAL HG12 1 1 
        3  6764 1 1 120 VAL HG13 H   9.139   9.754  13.755 1.00 . A A . 120 VAL HG13 1 1 
        3  6765 1 1 120 VAL HG21 H  11.406  11.689  10.721 1.00 . A A . 120 VAL HG21 1 1 
        3  6766 1 1 120 VAL HG22 H  10.843  12.663  12.080 1.00 . A A . 120 VAL HG22 1 1 
        3  6767 1 1 120 VAL HG23 H   9.684  12.025  10.912 1.00 . A A . 120 VAL HG23 1 1 
        3  6768 1 1 120 VAL N    N  11.675   8.997  13.773 1.00 . A A . 120 VAL N    1 1 
        3  6769 1 1 120 VAL O    O  12.913  12.281  13.612 1.00 . A A . 120 VAL O    1 1 
        3  6770 1 1 121 ASP C    C  13.064  12.481  16.686 1.00 . A A . 121 ASP C    1 1 
        3  6771 1 1 121 ASP CA   C  11.668  12.546  16.077 1.00 . A A . 121 ASP CA   1 1 
        3  6772 1 1 121 ASP CB   C  10.607  12.481  17.183 1.00 . A A . 121 ASP CB   1 1 
        3  6773 1 1 121 ASP CG   C  10.630  13.688  18.105 1.00 . A A . 121 ASP CG   1 1 
        3  6774 1 1 121 ASP H    H  10.853  10.724  15.346 1.00 . A A . 121 ASP H    1 1 
        3  6775 1 1 121 ASP HA   H  11.563  13.478  15.541 1.00 . A A . 121 ASP HA   1 1 
        3  6776 1 1 121 ASP HB2  H   9.631  12.421  16.729 1.00 . A A . 121 ASP HB2  1 1 
        3  6777 1 1 121 ASP HB3  H  10.774  11.594  17.778 1.00 . A A . 121 ASP HB3  1 1 
        3  6778 1 1 121 ASP N    N  11.472  11.455  15.124 1.00 . A A . 121 ASP N    1 1 
        3  6779 1 1 121 ASP O    O  13.714  13.505  16.900 1.00 . A A . 121 ASP O    1 1 
        3  6780 1 1 121 ASP OD1  O  11.355  13.657  19.122 1.00 . A A . 121 ASP OD1  1 1 
        3  6781 1 1 121 ASP OD2  O   9.907  14.667  17.824 1.00 . A A . 121 ASP OD2  1 1 
        3  6782 1 1 122 ASP C    C  15.966  11.314  16.627 1.00 . A A . 122 ASP C    1 1 
        3  6783 1 1 122 ASP CA   C  14.814  11.049  17.586 1.00 . A A . 122 ASP CA   1 1 
        3  6784 1 1 122 ASP CB   C  14.890   9.618  18.126 1.00 . A A . 122 ASP CB   1 1 
        3  6785 1 1 122 ASP CG   C  16.117   9.366  18.974 1.00 . A A . 122 ASP CG   1 1 
        3  6786 1 1 122 ASP H    H  12.990  10.486  16.667 1.00 . A A . 122 ASP H    1 1 
        3  6787 1 1 122 ASP HA   H  14.884  11.740  18.413 1.00 . A A . 122 ASP HA   1 1 
        3  6788 1 1 122 ASP HB2  H  14.017   9.424  18.730 1.00 . A A . 122 ASP HB2  1 1 
        3  6789 1 1 122 ASP HB3  H  14.904   8.929  17.293 1.00 . A A . 122 ASP HB3  1 1 
        3  6790 1 1 122 ASP N    N  13.528  11.265  16.932 1.00 . A A . 122 ASP N    1 1 
        3  6791 1 1 122 ASP O    O  17.017  11.811  17.029 1.00 . A A . 122 ASP O    1 1 
        3  6792 1 1 122 ASP OD1  O  16.280  10.048  20.008 1.00 . A A . 122 ASP OD1  1 1 
        3  6793 1 1 122 ASP OD2  O  16.905   8.459  18.633 1.00 . A A . 122 ASP OD2  1 1 
        3  6794 1 1 123 ASN C    C  16.736  12.595  13.754 1.00 . A A . 123 ASN C    1 1 
        3  6795 1 1 123 ASN CA   C  16.797  11.191  14.343 1.00 . A A . 123 ASN CA   1 1 
        3  6796 1 1 123 ASN CB   C  16.680  10.162  13.215 1.00 . A A . 123 ASN CB   1 1 
        3  6797 1 1 123 ASN CG   C  17.017   8.749  13.655 1.00 . A A . 123 ASN CG   1 1 
        3  6798 1 1 123 ASN H    H  14.906  10.587  15.092 1.00 . A A . 123 ASN H    1 1 
        3  6799 1 1 123 ASN HA   H  17.754  11.065  14.829 1.00 . A A . 123 ASN HA   1 1 
        3  6800 1 1 123 ASN HB2  H  15.669  10.168  12.840 1.00 . A A . 123 ASN HB2  1 1 
        3  6801 1 1 123 ASN HB3  H  17.355  10.441  12.418 1.00 . A A . 123 ASN HB3  1 1 
        3  6802 1 1 123 ASN HD21 H  17.755   8.340  11.857 1.00 . A A . 123 ASN HD21 1 1 
        3  6803 1 1 123 ASN HD22 H  17.818   7.047  13.008 1.00 . A A . 123 ASN HD22 1 1 
        3  6804 1 1 123 ASN N    N  15.762  10.990  15.354 1.00 . A A . 123 ASN N    1 1 
        3  6805 1 1 123 ASN ND2  N  17.586   7.969  12.748 1.00 . A A . 123 ASN ND2  1 1 
        3  6806 1 1 123 ASN O    O  17.764  13.177  13.421 1.00 . A A . 123 ASN O    1 1 
        3  6807 1 1 123 ASN OD1  O  16.772   8.360  14.796 1.00 . A A . 123 ASN OD1  1 1 
        3  6808 1 1 124 GLY C    C  15.251  14.530  11.594 1.00 . A A . 124 GLY C    1 1 
        3  6809 1 1 124 GLY CA   C  15.373  14.480  13.106 1.00 . A A . 124 GLY CA   1 1 
        3  6810 1 1 124 GLY H    H  14.740  12.606  13.862 1.00 . A A . 124 GLY H    1 1 
        3  6811 1 1 124 GLY HA2  H  14.482  14.911  13.538 1.00 . A A . 124 GLY HA2  1 1 
        3  6812 1 1 124 GLY HA3  H  16.226  15.070  13.407 1.00 . A A . 124 GLY HA3  1 1 
        3  6813 1 1 124 GLY N    N  15.532  13.132  13.617 1.00 . A A . 124 GLY N    1 1 
        3  6814 1 1 124 GLY O    O  16.102  15.105  10.911 1.00 . A A . 124 GLY O    1 1 
        3  6815 1 1 125 PHE C    C  12.812  14.958   9.338 1.00 . A A . 125 PHE C    1 1 
        3  6816 1 1 125 PHE CA   C  13.916  13.953   9.643 1.00 . A A . 125 PHE CA   1 1 
        3  6817 1 1 125 PHE CB   C  13.512  12.563   9.153 1.00 . A A . 125 PHE CB   1 1 
        3  6818 1 1 125 PHE CD1  C  15.374  11.527   7.841 1.00 . A A . 125 PHE CD1  1 1 
        3  6819 1 1 125 PHE CD2  C  15.039  10.804  10.085 1.00 . A A . 125 PHE CD2  1 1 
        3  6820 1 1 125 PHE CE1  C  16.437  10.653   7.713 1.00 . A A . 125 PHE CE1  1 1 
        3  6821 1 1 125 PHE CE2  C  16.100   9.928   9.962 1.00 . A A . 125 PHE CE2  1 1 
        3  6822 1 1 125 PHE CG   C  14.665  11.611   9.026 1.00 . A A . 125 PHE CG   1 1 
        3  6823 1 1 125 PHE CZ   C  16.800   9.853   8.775 1.00 . A A . 125 PHE CZ   1 1 
        3  6824 1 1 125 PHE H    H  13.581  13.438  11.662 1.00 . A A . 125 PHE H    1 1 
        3  6825 1 1 125 PHE HA   H  14.817  14.258   9.135 1.00 . A A . 125 PHE HA   1 1 
        3  6826 1 1 125 PHE HB2  H  12.806  12.133   9.848 1.00 . A A . 125 PHE HB2  1 1 
        3  6827 1 1 125 PHE HB3  H  13.045  12.654   8.190 1.00 . A A . 125 PHE HB3  1 1 
        3  6828 1 1 125 PHE HD1  H  15.092  12.155   7.007 1.00 . A A . 125 PHE HD1  1 1 
        3  6829 1 1 125 PHE HD2  H  14.493  10.862  11.013 1.00 . A A . 125 PHE HD2  1 1 
        3  6830 1 1 125 PHE HE1  H  16.982  10.597   6.782 1.00 . A A . 125 PHE HE1  1 1 
        3  6831 1 1 125 PHE HE2  H  16.382   9.304  10.796 1.00 . A A . 125 PHE HE2  1 1 
        3  6832 1 1 125 PHE HZ   H  17.629   9.169   8.678 1.00 . A A . 125 PHE HZ   1 1 
        3  6833 1 1 125 PHE N    N  14.195  13.921  11.071 1.00 . A A . 125 PHE N    1 1 
        3  6834 1 1 125 PHE O    O  12.065  15.358  10.234 1.00 . A A . 125 PHE O    1 1 
        3  6835 1 1 126 ASP C    C  10.418  15.597   7.256 1.00 . A A . 126 ASP C    1 1 
        3  6836 1 1 126 ASP CA   C  11.693  16.329   7.666 1.00 . A A . 126 ASP CA   1 1 
        3  6837 1 1 126 ASP CB   C  12.207  17.206   6.521 1.00 . A A . 126 ASP CB   1 1 
        3  6838 1 1 126 ASP CG   C  11.240  18.319   6.172 1.00 . A A . 126 ASP CG   1 1 
        3  6839 1 1 126 ASP H    H  13.336  15.015   7.410 1.00 . A A . 126 ASP H    1 1 
        3  6840 1 1 126 ASP HA   H  11.470  16.957   8.517 1.00 . A A . 126 ASP HA   1 1 
        3  6841 1 1 126 ASP HB2  H  13.151  17.650   6.810 1.00 . A A . 126 ASP HB2  1 1 
        3  6842 1 1 126 ASP HB3  H  12.357  16.594   5.644 1.00 . A A . 126 ASP HB3  1 1 
        3  6843 1 1 126 ASP N    N  12.714  15.369   8.079 1.00 . A A . 126 ASP N    1 1 
        3  6844 1 1 126 ASP O    O  10.458  14.402   6.971 1.00 . A A . 126 ASP O    1 1 
        3  6845 1 1 126 ASP OD1  O  10.804  19.040   7.091 1.00 . A A . 126 ASP OD1  1 1 
        3  6846 1 1 126 ASP OD2  O  10.895  18.465   4.983 1.00 . A A . 126 ASP OD2  1 1 
        3  6847 1 1 127 LEU C    C   7.886  15.066   5.614 1.00 . A A . 127 LEU C    1 1 
        3  6848 1 1 127 LEU CA   C   7.990  15.698   6.996 1.00 . A A . 127 LEU CA   1 1 
        3  6849 1 1 127 LEU CB   C   6.840  16.707   7.133 1.00 . A A . 127 LEU CB   1 1 
        3  6850 1 1 127 LEU CD1  C   7.624  18.787   8.301 1.00 . A A . 127 LEU CD1  1 1 
        3  6851 1 1 127 LEU CD2  C   5.356  17.858   8.792 1.00 . A A . 127 LEU CD2  1 1 
        3  6852 1 1 127 LEU CG   C   6.794  17.521   8.428 1.00 . A A . 127 LEU CG   1 1 
        3  6853 1 1 127 LEU H    H   9.349  17.283   7.367 1.00 . A A . 127 LEU H    1 1 
        3  6854 1 1 127 LEU HA   H   7.857  14.924   7.737 1.00 . A A . 127 LEU HA   1 1 
        3  6855 1 1 127 LEU HB2  H   6.897  17.395   6.302 1.00 . A A . 127 LEU HB2  1 1 
        3  6856 1 1 127 LEU HB3  H   5.910  16.161   7.050 1.00 . A A . 127 LEU HB3  1 1 
        3  6857 1 1 127 LEU HD11 H   7.226  19.402   7.506 1.00 . A A . 127 LEU HD11 1 1 
        3  6858 1 1 127 LEU HD12 H   8.648  18.526   8.074 1.00 . A A . 127 LEU HD12 1 1 
        3  6859 1 1 127 LEU HD13 H   7.590  19.335   9.231 1.00 . A A . 127 LEU HD13 1 1 
        3  6860 1 1 127 LEU HD21 H   4.790  16.944   8.900 1.00 . A A . 127 LEU HD21 1 1 
        3  6861 1 1 127 LEU HD22 H   4.919  18.463   8.013 1.00 . A A . 127 LEU HD22 1 1 
        3  6862 1 1 127 LEU HD23 H   5.339  18.404   9.724 1.00 . A A . 127 LEU HD23 1 1 
        3  6863 1 1 127 LEU HG   H   7.211  16.930   9.231 1.00 . A A . 127 LEU HG   1 1 
        3  6864 1 1 127 LEU N    N   9.296  16.314   7.231 1.00 . A A . 127 LEU N    1 1 
        3  6865 1 1 127 LEU O    O   8.547  15.479   4.659 1.00 . A A . 127 LEU O    1 1 
        3  6866 1 1 128 SER C    C   5.187  13.010   4.420 1.00 . A A . 128 SER C    1 1 
        3  6867 1 1 128 SER CA   C   6.632  13.469   4.276 1.00 . A A . 128 SER CA   1 1 
        3  6868 1 1 128 SER CB   C   7.549  12.304   3.886 1.00 . A A . 128 SER CB   1 1 
        3  6869 1 1 128 SER H    H   6.678  13.685   6.365 1.00 . A A . 128 SER H    1 1 
        3  6870 1 1 128 SER HA   H   6.684  14.237   3.517 1.00 . A A . 128 SER HA   1 1 
        3  6871 1 1 128 SER HB2  H   7.447  11.509   4.612 1.00 . A A . 128 SER HB2  1 1 
        3  6872 1 1 128 SER HB3  H   7.269  11.939   2.909 1.00 . A A . 128 SER HB3  1 1 
        3  6873 1 1 128 SER HG   H   8.951  13.670   4.016 1.00 . A A . 128 SER HG   1 1 
        3  6874 1 1 128 SER N    N   7.044  14.054   5.536 1.00 . A A . 128 SER N    1 1 
        3  6875 1 1 128 SER O    O   4.913  11.871   4.804 1.00 . A A . 128 SER O    1 1 
        3  6876 1 1 128 SER OG   O   8.906  12.719   3.848 1.00 . A A . 128 SER OG   1 1 
        3  6877 1 1 129 GLY C    C   2.188  12.831   3.376 1.00 . A A . 129 GLY C    1 1 
        3  6878 1 1 129 GLY CA   C   2.857  13.698   4.426 1.00 . A A . 129 GLY CA   1 1 
        3  6879 1 1 129 GLY H    H   4.563  14.828   3.851 1.00 . A A . 129 GLY H    1 1 
        3  6880 1 1 129 GLY HA2  H   2.750  13.213   5.385 1.00 . A A . 129 GLY HA2  1 1 
        3  6881 1 1 129 GLY HA3  H   2.347  14.650   4.465 1.00 . A A . 129 GLY HA3  1 1 
        3  6882 1 1 129 GLY N    N   4.270  13.942   4.184 1.00 . A A . 129 GLY N    1 1 
        3  6883 1 1 129 GLY O    O   1.249  13.268   2.709 1.00 . A A . 129 GLY O    1 1 
        3  6884 1 1 130 GLU C    C   2.092   9.248   2.996 1.00 . A A . 130 GLU C    1 1 
        3  6885 1 1 130 GLU CA   C   2.047  10.626   2.350 1.00 . A A . 130 GLU CA   1 1 
        3  6886 1 1 130 GLU CB   C   2.750  10.597   0.987 1.00 . A A . 130 GLU CB   1 1 
        3  6887 1 1 130 GLU CD   C   3.215  11.810  -1.183 1.00 . A A . 130 GLU CD   1 1 
        3  6888 1 1 130 GLU CG   C   2.562  11.870   0.180 1.00 . A A . 130 GLU CG   1 1 
        3  6889 1 1 130 GLU H    H   3.467  11.344   3.741 1.00 . A A . 130 GLU H    1 1 
        3  6890 1 1 130 GLU HA   H   1.015  10.911   2.210 1.00 . A A . 130 GLU HA   1 1 
        3  6891 1 1 130 GLU HB2  H   3.808  10.446   1.142 1.00 . A A . 130 GLU HB2  1 1 
        3  6892 1 1 130 GLU HB3  H   2.359   9.771   0.412 1.00 . A A . 130 GLU HB3  1 1 
        3  6893 1 1 130 GLU HG2  H   1.505  12.042   0.044 1.00 . A A . 130 GLU HG2  1 1 
        3  6894 1 1 130 GLU HG3  H   2.990  12.694   0.732 1.00 . A A . 130 GLU HG3  1 1 
        3  6895 1 1 130 GLU N    N   2.666  11.604   3.234 1.00 . A A . 130 GLU N    1 1 
        3  6896 1 1 130 GLU O    O   3.124   8.841   3.528 1.00 . A A . 130 GLU O    1 1 
        3  6897 1 1 130 GLU OE1  O   2.625  11.205  -2.101 1.00 . A A . 130 GLU OE1  1 1 
        3  6898 1 1 130 GLU OE2  O   4.304  12.396  -1.356 1.00 . A A . 130 GLU OE2  1 1 
        3  6899 1 1 131 ALA C    C   1.017   6.147   2.514 1.00 . A A . 131 ALA C    1 1 
        3  6900 1 1 131 ALA CA   C   0.890   7.223   3.580 1.00 . A A . 131 ALA CA   1 1 
        3  6901 1 1 131 ALA CB   C  -0.413   7.063   4.347 1.00 . A A . 131 ALA CB   1 1 
        3  6902 1 1 131 ALA H    H   0.174   8.920   2.532 1.00 . A A . 131 ALA H    1 1 
        3  6903 1 1 131 ALA HA   H   1.711   7.124   4.282 1.00 . A A . 131 ALA HA   1 1 
        3  6904 1 1 131 ALA HB1  H  -1.245   7.162   3.666 1.00 . A A . 131 ALA HB1  1 1 
        3  6905 1 1 131 ALA HB2  H  -0.477   7.825   5.109 1.00 . A A . 131 ALA HB2  1 1 
        3  6906 1 1 131 ALA HB3  H  -0.440   6.087   4.810 1.00 . A A . 131 ALA HB3  1 1 
        3  6907 1 1 131 ALA N    N   0.968   8.546   2.975 1.00 . A A . 131 ALA N    1 1 
        3  6908 1 1 131 ALA O    O   0.390   6.233   1.453 1.00 . A A . 131 ALA O    1 1 
        3  6909 1 1 132 TYR C    C   2.232   2.755   2.585 1.00 . A A . 132 TYR C    1 1 
        3  6910 1 1 132 TYR CA   C   2.081   4.075   1.838 1.00 . A A . 132 TYR CA   1 1 
        3  6911 1 1 132 TYR CB   C   3.370   4.400   1.074 1.00 . A A . 132 TYR CB   1 1 
        3  6912 1 1 132 TYR CD1  C   4.048   2.304  -0.178 1.00 . A A . 132 TYR CD1  1 1 
        3  6913 1 1 132 TYR CD2  C   3.388   4.215  -1.440 1.00 . A A . 132 TYR CD2  1 1 
        3  6914 1 1 132 TYR CE1  C   4.291   1.610  -1.350 1.00 . A A . 132 TYR CE1  1 1 
        3  6915 1 1 132 TYR CE2  C   3.620   3.526  -2.615 1.00 . A A . 132 TYR CE2  1 1 
        3  6916 1 1 132 TYR CG   C   3.593   3.618  -0.203 1.00 . A A . 132 TYR CG   1 1 
        3  6917 1 1 132 TYR CZ   C   4.072   2.226  -2.565 1.00 . A A . 132 TYR CZ   1 1 
        3  6918 1 1 132 TYR H    H   2.283   5.118   3.666 1.00 . A A . 132 TYR H    1 1 
        3  6919 1 1 132 TYR HA   H   1.251   4.018   1.152 1.00 . A A . 132 TYR HA   1 1 
        3  6920 1 1 132 TYR HB2  H   3.363   5.447   0.812 1.00 . A A . 132 TYR HB2  1 1 
        3  6921 1 1 132 TYR HB3  H   4.211   4.211   1.725 1.00 . A A . 132 TYR HB3  1 1 
        3  6922 1 1 132 TYR HD1  H   4.214   1.824   0.774 1.00 . A A . 132 TYR HD1  1 1 
        3  6923 1 1 132 TYR HD2  H   3.036   5.235  -1.477 1.00 . A A . 132 TYR HD2  1 1 
        3  6924 1 1 132 TYR HE1  H   4.644   0.589  -1.312 1.00 . A A . 132 TYR HE1  1 1 
        3  6925 1 1 132 TYR HE2  H   3.448   4.009  -3.567 1.00 . A A . 132 TYR HE2  1 1 
        3  6926 1 1 132 TYR HH   H   4.870   2.090  -4.312 1.00 . A A . 132 TYR HH   1 1 
        3  6927 1 1 132 TYR N    N   1.832   5.144   2.790 1.00 . A A . 132 TYR N    1 1 
        3  6928 1 1 132 TYR O    O   3.223   2.544   3.276 1.00 . A A . 132 TYR O    1 1 
        3  6929 1 1 132 TYR OH   O   4.321   1.547  -3.736 1.00 . A A . 132 TYR OH   1 1 
        3  6930 1 1 133 GLU C    C   1.088  -0.554   2.141 1.00 . A A . 133 GLU C    1 1 
        3  6931 1 1 133 GLU CA   C   1.334   0.578   3.124 1.00 . A A . 133 GLU CA   1 1 
        3  6932 1 1 133 GLU CB   C   0.327   0.509   4.284 1.00 . A A . 133 GLU CB   1 1 
        3  6933 1 1 133 GLU CD   C  -2.093   0.417   5.024 1.00 . A A . 133 GLU CD   1 1 
        3  6934 1 1 133 GLU CG   C  -1.132   0.531   3.854 1.00 . A A . 133 GLU CG   1 1 
        3  6935 1 1 133 GLU H    H   0.490   2.069   1.873 1.00 . A A . 133 GLU H    1 1 
        3  6936 1 1 133 GLU HA   H   2.332   0.475   3.524 1.00 . A A . 133 GLU HA   1 1 
        3  6937 1 1 133 GLU HB2  H   0.500  -0.403   4.837 1.00 . A A . 133 GLU HB2  1 1 
        3  6938 1 1 133 GLU HB3  H   0.497   1.351   4.942 1.00 . A A . 133 GLU HB3  1 1 
        3  6939 1 1 133 GLU HG2  H  -1.330   1.459   3.338 1.00 . A A . 133 GLU HG2  1 1 
        3  6940 1 1 133 GLU HG3  H  -1.308  -0.297   3.183 1.00 . A A . 133 GLU HG3  1 1 
        3  6941 1 1 133 GLU N    N   1.267   1.863   2.444 1.00 . A A . 133 GLU N    1 1 
        3  6942 1 1 133 GLU O    O   0.386  -0.382   1.144 1.00 . A A . 133 GLU O    1 1 
        3  6943 1 1 133 GLU OE1  O  -2.208  -0.689   5.594 1.00 . A A . 133 GLU OE1  1 1 
        3  6944 1 1 133 GLU OE2  O  -2.740   1.428   5.366 1.00 . A A . 133 GLU OE2  1 1 
        3  6945 1 1 134 ILE C    C   1.340  -4.116   2.435 1.00 . A A . 134 ILE C    1 1 
        3  6946 1 1 134 ILE CA   C   1.505  -2.876   1.574 1.00 . A A . 134 ILE CA   1 1 
        3  6947 1 1 134 ILE CB   C   2.669  -3.103   0.584 1.00 . A A . 134 ILE CB   1 1 
        3  6948 1 1 134 ILE CD1  C   5.174  -3.509   0.396 1.00 . A A . 134 ILE CD1  1 1 
        3  6949 1 1 134 ILE CG1  C   4.004  -3.240   1.319 1.00 . A A . 134 ILE CG1  1 1 
        3  6950 1 1 134 ILE CG2  C   2.743  -1.969  -0.420 1.00 . A A . 134 ILE CG2  1 1 
        3  6951 1 1 134 ILE H    H   2.308  -1.752   3.173 1.00 . A A . 134 ILE H    1 1 
        3  6952 1 1 134 ILE HA   H   0.600  -2.729   1.001 1.00 . A A . 134 ILE HA   1 1 
        3  6953 1 1 134 ILE HB   H   2.473  -4.017   0.045 1.00 . A A . 134 ILE HB   1 1 
        3  6954 1 1 134 ILE HD11 H   5.015  -4.443  -0.123 1.00 . A A . 134 ILE HD11 1 1 
        3  6955 1 1 134 ILE HD12 H   6.083  -3.568   0.975 1.00 . A A . 134 ILE HD12 1 1 
        3  6956 1 1 134 ILE HD13 H   5.255  -2.707  -0.324 1.00 . A A . 134 ILE HD13 1 1 
        3  6957 1 1 134 ILE HG12 H   4.209  -2.326   1.856 1.00 . A A . 134 ILE HG12 1 1 
        3  6958 1 1 134 ILE HG13 H   3.939  -4.059   2.021 1.00 . A A . 134 ILE HG13 1 1 
        3  6959 1 1 134 ILE HG21 H   1.830  -1.937  -0.997 1.00 . A A . 134 ILE HG21 1 1 
        3  6960 1 1 134 ILE HG22 H   3.581  -2.128  -1.083 1.00 . A A . 134 ILE HG22 1 1 
        3  6961 1 1 134 ILE HG23 H   2.870  -1.032   0.103 1.00 . A A . 134 ILE HG23 1 1 
        3  6962 1 1 134 ILE N    N   1.703  -1.698   2.402 1.00 . A A . 134 ILE N    1 1 
        3  6963 1 1 134 ILE O    O   2.094  -4.332   3.388 1.00 . A A . 134 ILE O    1 1 
        3  6964 1 1 135 TYR C    C   0.868  -7.294   2.145 1.00 . A A . 135 TYR C    1 1 
        3  6965 1 1 135 TYR CA   C   0.118  -6.163   2.826 1.00 . A A . 135 TYR CA   1 1 
        3  6966 1 1 135 TYR CB   C  -1.379  -6.472   2.903 1.00 . A A . 135 TYR CB   1 1 
        3  6967 1 1 135 TYR CD1  C  -2.109  -5.046   4.856 1.00 . A A . 135 TYR CD1  1 1 
        3  6968 1 1 135 TYR CD2  C  -3.043  -4.580   2.713 1.00 . A A . 135 TYR CD2  1 1 
        3  6969 1 1 135 TYR CE1  C  -2.844  -4.013   5.405 1.00 . A A . 135 TYR CE1  1 1 
        3  6970 1 1 135 TYR CE2  C  -3.780  -3.543   3.255 1.00 . A A . 135 TYR CE2  1 1 
        3  6971 1 1 135 TYR CG   C  -2.196  -5.348   3.502 1.00 . A A . 135 TYR CG   1 1 
        3  6972 1 1 135 TYR CZ   C  -3.677  -3.265   4.601 1.00 . A A . 135 TYR CZ   1 1 
        3  6973 1 1 135 TYR H    H  -0.217  -4.703   1.330 1.00 . A A . 135 TYR H    1 1 
        3  6974 1 1 135 TYR HA   H   0.506  -6.039   3.828 1.00 . A A . 135 TYR HA   1 1 
        3  6975 1 1 135 TYR HB2  H  -1.752  -6.658   1.906 1.00 . A A . 135 TYR HB2  1 1 
        3  6976 1 1 135 TYR HB3  H  -1.528  -7.355   3.509 1.00 . A A . 135 TYR HB3  1 1 
        3  6977 1 1 135 TYR HD1  H  -1.456  -5.633   5.485 1.00 . A A . 135 TYR HD1  1 1 
        3  6978 1 1 135 TYR HD2  H  -3.122  -4.801   1.659 1.00 . A A . 135 TYR HD2  1 1 
        3  6979 1 1 135 TYR HE1  H  -2.763  -3.795   6.459 1.00 . A A . 135 TYR HE1  1 1 
        3  6980 1 1 135 TYR HE2  H  -4.431  -2.958   2.625 1.00 . A A . 135 TYR HE2  1 1 
        3  6981 1 1 135 TYR HH   H  -3.785  -1.559   5.491 1.00 . A A . 135 TYR HH   1 1 
        3  6982 1 1 135 TYR N    N   0.355  -4.929   2.100 1.00 . A A . 135 TYR N    1 1 
        3  6983 1 1 135 TYR O    O   0.322  -7.988   1.293 1.00 . A A . 135 TYR O    1 1 
        3  6984 1 1 135 TYR OH   O  -4.401  -2.229   5.143 1.00 . A A . 135 TYR OH   1 1 
        3  6985 1 1 136 LEU C    C   2.675  -9.811   2.276 1.00 . A A . 136 LEU C    1 1 
        3  6986 1 1 136 LEU CA   C   3.020  -8.386   1.850 1.00 . A A . 136 LEU CA   1 1 
        3  6987 1 1 136 LEU CB   C   4.476  -8.031   2.183 1.00 . A A . 136 LEU CB   1 1 
        3  6988 1 1 136 LEU CD1  C   6.545  -7.653   0.824 1.00 . A A . 136 LEU CD1  1 1 
        3  6989 1 1 136 LEU CD2  C   6.275  -9.776   2.097 1.00 . A A . 136 LEU CD2  1 1 
        3  6990 1 1 136 LEU CG   C   5.550  -8.693   1.315 1.00 . A A . 136 LEU CG   1 1 
        3  6991 1 1 136 LEU H    H   2.479  -6.909   3.254 1.00 . A A . 136 LEU H    1 1 
        3  6992 1 1 136 LEU HA   H   2.869  -8.296   0.785 1.00 . A A . 136 LEU HA   1 1 
        3  6993 1 1 136 LEU HB2  H   4.587  -6.960   2.090 1.00 . A A . 136 LEU HB2  1 1 
        3  6994 1 1 136 LEU HB3  H   4.661  -8.303   3.211 1.00 . A A . 136 LEU HB3  1 1 
        3  6995 1 1 136 LEU HD11 H   7.299  -8.133   0.219 1.00 . A A . 136 LEU HD11 1 1 
        3  6996 1 1 136 LEU HD12 H   7.013  -7.175   1.673 1.00 . A A . 136 LEU HD12 1 1 
        3  6997 1 1 136 LEU HD13 H   6.028  -6.911   0.234 1.00 . A A . 136 LEU HD13 1 1 
        3  6998 1 1 136 LEU HD21 H   7.012 -10.247   1.464 1.00 . A A . 136 LEU HD21 1 1 
        3  6999 1 1 136 LEU HD22 H   5.562 -10.515   2.434 1.00 . A A . 136 LEU HD22 1 1 
        3  7000 1 1 136 LEU HD23 H   6.766  -9.334   2.952 1.00 . A A . 136 LEU HD23 1 1 
        3  7001 1 1 136 LEU HG   H   5.083  -9.149   0.454 1.00 . A A . 136 LEU HG   1 1 
        3  7002 1 1 136 LEU N    N   2.134  -7.441   2.507 1.00 . A A . 136 LEU N    1 1 
        3  7003 1 1 136 LEU O    O   2.072 -10.016   3.333 1.00 . A A . 136 LEU O    1 1 
        3  7004 1 1 137 ASP C    C   1.212 -12.404   1.346 1.00 . A A . 137 ASP C    1 1 
        3  7005 1 1 137 ASP CA   C   2.696 -12.186   1.628 1.00 . A A . 137 ASP CA   1 1 
        3  7006 1 1 137 ASP CB   C   3.030 -12.679   3.044 1.00 . A A . 137 ASP CB   1 1 
        3  7007 1 1 137 ASP CG   C   4.515 -12.805   3.309 1.00 . A A . 137 ASP CG   1 1 
        3  7008 1 1 137 ASP H    H   3.580 -10.531   0.650 1.00 . A A . 137 ASP H    1 1 
        3  7009 1 1 137 ASP HA   H   3.266 -12.764   0.915 1.00 . A A . 137 ASP HA   1 1 
        3  7010 1 1 137 ASP HB2  H   2.618 -11.986   3.763 1.00 . A A . 137 ASP HB2  1 1 
        3  7011 1 1 137 ASP HB3  H   2.576 -13.648   3.191 1.00 . A A . 137 ASP HB3  1 1 
        3  7012 1 1 137 ASP N    N   3.052 -10.776   1.434 1.00 . A A . 137 ASP N    1 1 
        3  7013 1 1 137 ASP O    O   0.546 -11.546   0.767 1.00 . A A . 137 ASP O    1 1 
        3  7014 1 1 137 ASP OD1  O   5.131 -13.779   2.823 1.00 . A A . 137 ASP OD1  1 1 
        3  7015 1 1 137 ASP OD2  O   5.070 -11.954   4.028 1.00 . A A . 137 ASP OD2  1 1 
        3  7016 1 1 138 ASN C    C  -1.158 -14.799   2.700 1.00 . A A . 138 ASN C    1 1 
        3  7017 1 1 138 ASN CA   C  -0.705 -13.887   1.558 1.00 . A A . 138 ASN CA   1 1 
        3  7018 1 1 138 ASN CB   C  -0.895 -14.590   0.200 1.00 . A A . 138 ASN CB   1 1 
        3  7019 1 1 138 ASN CG   C  -2.348 -14.710  -0.237 1.00 . A A . 138 ASN CG   1 1 
        3  7020 1 1 138 ASN H    H   1.294 -14.224   2.156 1.00 . A A . 138 ASN H    1 1 
        3  7021 1 1 138 ASN HA   H  -1.273 -12.970   1.577 1.00 . A A . 138 ASN HA   1 1 
        3  7022 1 1 138 ASN HB2  H  -0.363 -14.033  -0.558 1.00 . A A . 138 ASN HB2  1 1 
        3  7023 1 1 138 ASN HB3  H  -0.477 -15.585   0.261 1.00 . A A . 138 ASN HB3  1 1 
        3  7024 1 1 138 ASN HD21 H  -1.942 -16.413  -1.185 1.00 . A A . 138 ASN HD21 1 1 
        3  7025 1 1 138 ASN HD22 H  -3.589 -15.875  -1.257 1.00 . A A . 138 ASN HD22 1 1 
        3  7026 1 1 138 ASN N    N   0.706 -13.567   1.734 1.00 . A A . 138 ASN N    1 1 
        3  7027 1 1 138 ASN ND2  N  -2.659 -15.771  -0.965 1.00 . A A . 138 ASN ND2  1 1 
        3  7028 1 1 138 ASN O    O  -0.415 -15.699   3.107 1.00 . A A . 138 ASN O    1 1 
        3  7029 1 1 138 ASN OD1  O  -3.176 -13.850   0.046 1.00 . A A . 138 ASN OD1  1 1 
        3  7030 1 1 139 PRO C    C  -3.176 -16.869   3.819 1.00 . A A . 139 PRO C    1 1 
        3  7031 1 1 139 PRO CA   C  -2.925 -15.444   4.296 1.00 . A A . 139 PRO CA   1 1 
        3  7032 1 1 139 PRO CB   C  -4.244 -14.767   4.676 1.00 . A A . 139 PRO CB   1 1 
        3  7033 1 1 139 PRO CD   C  -3.279 -13.472   2.912 1.00 . A A . 139 PRO CD   1 1 
        3  7034 1 1 139 PRO CG   C  -4.586 -13.898   3.514 1.00 . A A . 139 PRO CG   1 1 
        3  7035 1 1 139 PRO HA   H  -2.273 -15.471   5.157 1.00 . A A . 139 PRO HA   1 1 
        3  7036 1 1 139 PRO HB2  H  -5.001 -15.521   4.840 1.00 . A A . 139 PRO HB2  1 1 
        3  7037 1 1 139 PRO HB3  H  -4.106 -14.188   5.574 1.00 . A A . 139 PRO HB3  1 1 
        3  7038 1 1 139 PRO HD2  H  -3.375 -13.357   1.843 1.00 . A A . 139 PRO HD2  1 1 
        3  7039 1 1 139 PRO HD3  H  -2.936 -12.552   3.364 1.00 . A A . 139 PRO HD3  1 1 
        3  7040 1 1 139 PRO HG2  H  -5.165 -14.457   2.793 1.00 . A A . 139 PRO HG2  1 1 
        3  7041 1 1 139 PRO HG3  H  -5.140 -13.034   3.852 1.00 . A A . 139 PRO HG3  1 1 
        3  7042 1 1 139 PRO N    N  -2.374 -14.588   3.241 1.00 . A A . 139 PRO N    1 1 
        3  7043 1 1 139 PRO O    O  -3.370 -17.110   2.625 1.00 . A A . 139 PRO O    1 1 
        3  7044 1 1 140 ALA C    C  -2.314 -19.760   3.509 1.00 . A A . 140 ALA C    1 1 
        3  7045 1 1 140 ALA CA   C  -3.357 -19.226   4.493 1.00 . A A . 140 ALA CA   1 1 
        3  7046 1 1 140 ALA CB   C  -4.768 -19.473   3.978 1.00 . A A . 140 ALA CB   1 1 
        3  7047 1 1 140 ALA H    H  -3.027 -17.519   5.701 1.00 . A A . 140 ALA H    1 1 
        3  7048 1 1 140 ALA HA   H  -3.249 -19.758   5.427 1.00 . A A . 140 ALA HA   1 1 
        3  7049 1 1 140 ALA HB1  H  -4.908 -18.947   3.044 1.00 . A A . 140 ALA HB1  1 1 
        3  7050 1 1 140 ALA HB2  H  -5.483 -19.116   4.703 1.00 . A A . 140 ALA HB2  1 1 
        3  7051 1 1 140 ALA HB3  H  -4.913 -20.531   3.818 1.00 . A A . 140 ALA HB3  1 1 
        3  7052 1 1 140 ALA N    N  -3.161 -17.801   4.772 1.00 . A A . 140 ALA N    1 1 
        3  7053 1 1 140 ALA O    O  -2.499 -20.812   2.896 1.00 . A A . 140 ALA O    1 1 
        3  7054 1 1 141 GLU C    C   1.205 -19.239   3.190 1.00 . A A . 141 GLU C    1 1 
        3  7055 1 1 141 GLU CA   C  -0.134 -19.429   2.484 1.00 . A A . 141 GLU CA   1 1 
        3  7056 1 1 141 GLU CB   C  -0.198 -18.589   1.200 1.00 . A A . 141 GLU CB   1 1 
        3  7057 1 1 141 GLU CD   C   1.866 -19.543   0.069 1.00 . A A . 141 GLU CD   1 1 
        3  7058 1 1 141 GLU CG   C   0.380 -19.274  -0.032 1.00 . A A . 141 GLU CG   1 1 
        3  7059 1 1 141 GLU H    H  -1.119 -18.216   3.903 1.00 . A A . 141 GLU H    1 1 
        3  7060 1 1 141 GLU HA   H  -0.261 -20.473   2.237 1.00 . A A . 141 GLU HA   1 1 
        3  7061 1 1 141 GLU HB2  H  -1.230 -18.348   0.995 1.00 . A A . 141 GLU HB2  1 1 
        3  7062 1 1 141 GLU HB3  H   0.350 -17.670   1.361 1.00 . A A . 141 GLU HB3  1 1 
        3  7063 1 1 141 GLU HG2  H  -0.127 -20.217  -0.171 1.00 . A A . 141 GLU HG2  1 1 
        3  7064 1 1 141 GLU HG3  H   0.203 -18.643  -0.891 1.00 . A A . 141 GLU HG3  1 1 
        3  7065 1 1 141 GLU N    N  -1.209 -19.038   3.381 1.00 . A A . 141 GLU N    1 1 
        3  7066 1 1 141 GLU O    O   1.967 -20.188   3.375 1.00 . A A . 141 GLU O    1 1 
        3  7067 1 1 141 GLU OE1  O   2.662 -18.608  -0.151 1.00 . A A . 141 GLU OE1  1 1 
        3  7068 1 1 141 GLU OE2  O   2.244 -20.696   0.359 1.00 . A A . 141 GLU OE2  1 1 
        3  7069 1 1 142 THR C    C   2.595 -17.950   5.801 1.00 . A A . 142 THR C    1 1 
        3  7070 1 1 142 THR CA   C   2.713 -17.680   4.296 1.00 . A A . 142 THR CA   1 1 
        3  7071 1 1 142 THR CB   C   3.080 -16.197   4.044 1.00 . A A . 142 THR CB   1 1 
        3  7072 1 1 142 THR CG2  C   2.218 -15.273   4.896 1.00 . A A . 142 THR CG2  1 1 
        3  7073 1 1 142 THR H    H   0.800 -17.304   3.480 1.00 . A A . 142 THR H    1 1 
        3  7074 1 1 142 THR HA   H   3.496 -18.302   3.884 1.00 . A A . 142 THR HA   1 1 
        3  7075 1 1 142 THR HB   H   2.890 -15.974   3.004 1.00 . A A . 142 THR HB   1 1 
        3  7076 1 1 142 THR HG1  H   4.751 -15.146   3.865 1.00 . A A . 142 THR HG1  1 1 
        3  7077 1 1 142 THR HG21 H   2.492 -14.245   4.702 1.00 . A A . 142 THR HG21 1 1 
        3  7078 1 1 142 THR HG22 H   2.377 -15.497   5.942 1.00 . A A . 142 THR HG22 1 1 
        3  7079 1 1 142 THR HG23 H   1.177 -15.420   4.650 1.00 . A A . 142 THR HG23 1 1 
        3  7080 1 1 142 THR N    N   1.465 -18.013   3.623 1.00 . A A . 142 THR N    1 1 
        3  7081 1 1 142 THR O    O   3.398 -17.454   6.598 1.00 . A A . 142 THR O    1 1 
        3  7082 1 1 142 THR OG1  O   4.468 -15.959   4.322 1.00 . A A . 142 THR OG1  1 1 
        3  7083 1 1 143 ALA C    C   0.517 -17.901   8.190 1.00 . A A . 143 ALA C    1 1 
        3  7084 1 1 143 ALA CA   C   1.251 -19.066   7.549 1.00 . A A . 143 ALA CA   1 1 
        3  7085 1 1 143 ALA CB   C   2.470 -19.425   8.387 1.00 . A A . 143 ALA CB   1 1 
        3  7086 1 1 143 ALA H    H   1.080 -19.202   5.449 1.00 . A A . 143 ALA H    1 1 
        3  7087 1 1 143 ALA HA   H   0.592 -19.924   7.544 1.00 . A A . 143 ALA HA   1 1 
        3  7088 1 1 143 ALA HB1  H   2.149 -19.710   9.379 1.00 . A A . 143 ALA HB1  1 1 
        3  7089 1 1 143 ALA HB2  H   3.120 -18.564   8.455 1.00 . A A . 143 ALA HB2  1 1 
        3  7090 1 1 143 ALA HB3  H   2.999 -20.243   7.928 1.00 . A A . 143 ALA HB3  1 1 
        3  7091 1 1 143 ALA N    N   1.601 -18.771   6.158 1.00 . A A . 143 ALA N    1 1 
        3  7092 1 1 143 ALA O    O   0.779 -16.734   7.888 1.00 . A A . 143 ALA O    1 1 
        3  7093 1 1 144 PRO C    C  -0.229 -16.572  10.901 1.00 . A A . 144 PRO C    1 1 
        3  7094 1 1 144 PRO CA   C  -1.129 -17.181   9.837 1.00 . A A . 144 PRO CA   1 1 
        3  7095 1 1 144 PRO CB   C  -2.288 -17.941  10.482 1.00 . A A . 144 PRO CB   1 1 
        3  7096 1 1 144 PRO CD   C  -0.910 -19.557   9.394 1.00 . A A . 144 PRO CD   1 1 
        3  7097 1 1 144 PRO CG   C  -1.811 -19.346  10.578 1.00 . A A . 144 PRO CG   1 1 
        3  7098 1 1 144 PRO HA   H  -1.515 -16.401   9.199 1.00 . A A . 144 PRO HA   1 1 
        3  7099 1 1 144 PRO HB2  H  -2.496 -17.526  11.459 1.00 . A A . 144 PRO HB2  1 1 
        3  7100 1 1 144 PRO HB3  H  -3.164 -17.865   9.858 1.00 . A A . 144 PRO HB3  1 1 
        3  7101 1 1 144 PRO HD2  H  -0.086 -20.201   9.659 1.00 . A A . 144 PRO HD2  1 1 
        3  7102 1 1 144 PRO HD3  H  -1.467 -19.972   8.568 1.00 . A A . 144 PRO HD3  1 1 
        3  7103 1 1 144 PRO HG2  H  -1.262 -19.486  11.497 1.00 . A A . 144 PRO HG2  1 1 
        3  7104 1 1 144 PRO HG3  H  -2.653 -20.021  10.533 1.00 . A A . 144 PRO HG3  1 1 
        3  7105 1 1 144 PRO N    N  -0.434 -18.201   9.074 1.00 . A A . 144 PRO N    1 1 
        3  7106 1 1 144 PRO O    O   0.764 -17.178  11.318 1.00 . A A . 144 PRO O    1 1 
        3  7107 1 1 145 ASP C    C   1.474 -14.124  11.996 1.00 . A A . 145 ASP C    1 1 
        3  7108 1 1 145 ASP CA   C   0.088 -14.646  12.394 1.00 . A A . 145 ASP CA   1 1 
        3  7109 1 1 145 ASP CB   C   0.172 -15.556  13.631 1.00 . A A . 145 ASP CB   1 1 
        3  7110 1 1 145 ASP CG   C   0.552 -14.816  14.901 1.00 . A A . 145 ASP CG   1 1 
        3  7111 1 1 145 ASP H    H  -1.290 -14.912  10.810 1.00 . A A . 145 ASP H    1 1 
        3  7112 1 1 145 ASP HA   H  -0.532 -13.795  12.639 1.00 . A A . 145 ASP HA   1 1 
        3  7113 1 1 145 ASP HB2  H  -0.790 -16.021  13.790 1.00 . A A . 145 ASP HB2  1 1 
        3  7114 1 1 145 ASP HB3  H   0.910 -16.324  13.452 1.00 . A A . 145 ASP HB3  1 1 
        3  7115 1 1 145 ASP N    N  -0.567 -15.355  11.288 1.00 . A A . 145 ASP N    1 1 
        3  7116 1 1 145 ASP O    O   2.156 -13.483  12.790 1.00 . A A . 145 ASP O    1 1 
        3  7117 1 1 145 ASP OD1  O  -0.336 -14.180  15.510 1.00 . A A . 145 ASP OD1  1 1 
        3  7118 1 1 145 ASP OD2  O   1.729 -14.891  15.311 1.00 . A A . 145 ASP OD2  1 1 
        3  7119 1 1 146 GLN C    C   3.010 -13.027   9.019 1.00 . A A . 146 GLN C    1 1 
        3  7120 1 1 146 GLN CA   C   3.172 -13.873  10.274 1.00 . A A . 146 GLN CA   1 1 
        3  7121 1 1 146 GLN CB   C   4.148 -15.017  10.000 1.00 . A A . 146 GLN CB   1 1 
        3  7122 1 1 146 GLN CD   C   6.193 -16.261  10.797 1.00 . A A . 146 GLN CD   1 1 
        3  7123 1 1 146 GLN CG   C   5.056 -15.335  11.177 1.00 . A A . 146 GLN CG   1 1 
        3  7124 1 1 146 GLN H    H   1.311 -14.890  10.152 1.00 . A A . 146 GLN H    1 1 
        3  7125 1 1 146 GLN HA   H   3.586 -13.248  11.051 1.00 . A A . 146 GLN HA   1 1 
        3  7126 1 1 146 GLN HB2  H   3.585 -15.905   9.757 1.00 . A A . 146 GLN HB2  1 1 
        3  7127 1 1 146 GLN HB3  H   4.768 -14.752   9.157 1.00 . A A . 146 GLN HB3  1 1 
        3  7128 1 1 146 GLN HE21 H   5.088 -17.842  11.263 1.00 . A A . 146 GLN HE21 1 1 
        3  7129 1 1 146 GLN HE22 H   6.684 -18.179  10.678 1.00 . A A . 146 GLN HE22 1 1 
        3  7130 1 1 146 GLN HG2  H   5.475 -14.413  11.554 1.00 . A A . 146 GLN HG2  1 1 
        3  7131 1 1 146 GLN HG3  H   4.469 -15.807  11.951 1.00 . A A . 146 GLN HG3  1 1 
        3  7132 1 1 146 GLN N    N   1.882 -14.368  10.755 1.00 . A A . 146 GLN N    1 1 
        3  7133 1 1 146 GLN NE2  N   5.968 -17.555  10.928 1.00 . A A . 146 GLN NE2  1 1 
        3  7134 1 1 146 GLN O    O   3.953 -12.865   8.243 1.00 . A A . 146 GLN O    1 1 
        3  7135 1 1 146 GLN OE1  O   7.269 -15.813  10.393 1.00 . A A . 146 GLN OE1  1 1 
        3  7136 1 1 147 LEU C    C   2.413 -10.317   7.892 1.00 . A A . 147 LEU C    1 1 
        3  7137 1 1 147 LEU CA   C   1.574 -11.576   7.720 1.00 . A A . 147 LEU CA   1 1 
        3  7138 1 1 147 LEU CB   C   0.089 -11.217   7.644 1.00 . A A . 147 LEU CB   1 1 
        3  7139 1 1 147 LEU CD1  C  -2.306 -11.932   7.410 1.00 . A A . 147 LEU CD1  1 1 
        3  7140 1 1 147 LEU CD2  C  -0.524 -13.098   6.100 1.00 . A A . 147 LEU CD2  1 1 
        3  7141 1 1 147 LEU CG   C  -0.857 -12.397   7.410 1.00 . A A . 147 LEU CG   1 1 
        3  7142 1 1 147 LEU H    H   1.103 -12.666   9.467 1.00 . A A . 147 LEU H    1 1 
        3  7143 1 1 147 LEU HA   H   1.869 -12.078   6.809 1.00 . A A . 147 LEU HA   1 1 
        3  7144 1 1 147 LEU HB2  H  -0.189 -10.740   8.573 1.00 . A A . 147 LEU HB2  1 1 
        3  7145 1 1 147 LEU HB3  H  -0.046 -10.511   6.840 1.00 . A A . 147 LEU HB3  1 1 
        3  7146 1 1 147 LEU HD11 H  -2.957 -12.781   7.266 1.00 . A A . 147 LEU HD11 1 1 
        3  7147 1 1 147 LEU HD12 H  -2.456 -11.222   6.610 1.00 . A A . 147 LEU HD12 1 1 
        3  7148 1 1 147 LEU HD13 H  -2.533 -11.461   8.356 1.00 . A A . 147 LEU HD13 1 1 
        3  7149 1 1 147 LEU HD21 H   0.489 -13.472   6.138 1.00 . A A . 147 LEU HD21 1 1 
        3  7150 1 1 147 LEU HD22 H  -0.619 -12.398   5.285 1.00 . A A . 147 LEU HD22 1 1 
        3  7151 1 1 147 LEU HD23 H  -1.207 -13.922   5.950 1.00 . A A . 147 LEU HD23 1 1 
        3  7152 1 1 147 LEU HG   H  -0.736 -13.112   8.212 1.00 . A A . 147 LEU HG   1 1 
        3  7153 1 1 147 LEU N    N   1.822 -12.478   8.834 1.00 . A A . 147 LEU N    1 1 
        3  7154 1 1 147 LEU O    O   2.337  -9.654   8.924 1.00 . A A . 147 LEU O    1 1 
        3  7155 1 1 148 ARG C    C   3.644  -7.671   6.253 1.00 . A A . 148 ARG C    1 1 
        3  7156 1 1 148 ARG CA   C   4.153  -8.891   7.006 1.00 . A A . 148 ARG CA   1 1 
        3  7157 1 1 148 ARG CB   C   5.532  -9.300   6.488 1.00 . A A . 148 ARG CB   1 1 
        3  7158 1 1 148 ARG CD   C   7.489 -10.861   6.715 1.00 . A A . 148 ARG CD   1 1 
        3  7159 1 1 148 ARG CG   C   6.207 -10.353   7.351 1.00 . A A . 148 ARG CG   1 1 
        3  7160 1 1 148 ARG CZ   C   8.178 -12.032   4.660 1.00 . A A . 148 ARG CZ   1 1 
        3  7161 1 1 148 ARG H    H   3.193 -10.527   6.067 1.00 . A A . 148 ARG H    1 1 
        3  7162 1 1 148 ARG HA   H   4.237  -8.637   8.053 1.00 . A A . 148 ARG HA   1 1 
        3  7163 1 1 148 ARG HB2  H   5.426  -9.698   5.489 1.00 . A A . 148 ARG HB2  1 1 
        3  7164 1 1 148 ARG HB3  H   6.168  -8.428   6.456 1.00 . A A . 148 ARG HB3  1 1 
        3  7165 1 1 148 ARG HD2  H   8.143 -10.022   6.531 1.00 . A A . 148 ARG HD2  1 1 
        3  7166 1 1 148 ARG HD3  H   7.968 -11.549   7.398 1.00 . A A . 148 ARG HD3  1 1 
        3  7167 1 1 148 ARG HE   H   6.282 -11.662   5.182 1.00 . A A . 148 ARG HE   1 1 
        3  7168 1 1 148 ARG HG2  H   6.443  -9.920   8.311 1.00 . A A . 148 ARG HG2  1 1 
        3  7169 1 1 148 ARG HG3  H   5.528 -11.182   7.484 1.00 . A A . 148 ARG HG3  1 1 
        3  7170 1 1 148 ARG HH11 H   9.725 -11.395   5.807 1.00 . A A . 148 ARG HH11 1 1 
        3  7171 1 1 148 ARG HH12 H  10.176 -12.234   4.354 1.00 . A A . 148 ARG HH12 1 1 
        3  7172 1 1 148 ARG HH21 H   6.847 -12.772   3.322 1.00 . A A . 148 ARG HH21 1 1 
        3  7173 1 1 148 ARG HH22 H   8.524 -13.053   2.940 1.00 . A A . 148 ARG HH22 1 1 
        3  7174 1 1 148 ARG N    N   3.224 -10.004   6.898 1.00 . A A . 148 ARG N    1 1 
        3  7175 1 1 148 ARG NE   N   7.234 -11.547   5.455 1.00 . A A . 148 ARG NE   1 1 
        3  7176 1 1 148 ARG NH1  N   9.461 -11.877   4.967 1.00 . A A . 148 ARG NH1  1 1 
        3  7177 1 1 148 ARG NH2  N   7.826 -12.668   3.551 1.00 . A A . 148 ARG NH2  1 1 
        3  7178 1 1 148 ARG O    O   3.659  -7.629   5.029 1.00 . A A . 148 ARG O    1 1 
        3  7179 1 1 149 THR C    C   3.803  -4.378   6.454 1.00 . A A . 149 THR C    1 1 
        3  7180 1 1 149 THR CA   C   2.718  -5.445   6.404 1.00 . A A . 149 THR CA   1 1 
        3  7181 1 1 149 THR CB   C   1.461  -4.939   7.138 1.00 . A A . 149 THR CB   1 1 
        3  7182 1 1 149 THR CG2  C   0.888  -3.704   6.456 1.00 . A A . 149 THR CG2  1 1 
        3  7183 1 1 149 THR H    H   3.196  -6.771   7.977 1.00 . A A . 149 THR H    1 1 
        3  7184 1 1 149 THR HA   H   2.461  -5.641   5.371 1.00 . A A . 149 THR HA   1 1 
        3  7185 1 1 149 THR HB   H   1.733  -4.679   8.151 1.00 . A A . 149 THR HB   1 1 
        3  7186 1 1 149 THR HG1  H   0.890  -6.810   7.393 1.00 . A A . 149 THR HG1  1 1 
        3  7187 1 1 149 THR HG21 H   1.624  -2.914   6.460 1.00 . A A . 149 THR HG21 1 1 
        3  7188 1 1 149 THR HG22 H   0.006  -3.378   6.985 1.00 . A A . 149 THR HG22 1 1 
        3  7189 1 1 149 THR HG23 H   0.626  -3.945   5.436 1.00 . A A . 149 THR HG23 1 1 
        3  7190 1 1 149 THR N    N   3.201  -6.675   6.995 1.00 . A A . 149 THR N    1 1 
        3  7191 1 1 149 THR O    O   4.187  -3.910   7.527 1.00 . A A . 149 THR O    1 1 
        3  7192 1 1 149 THR OG1  O   0.470  -5.974   7.170 1.00 . A A . 149 THR OG1  1 1 
        3  7193 1 1 150 ARG C    C   4.639  -1.635   5.052 1.00 . A A . 150 ARG C    1 1 
        3  7194 1 1 150 ARG CA   C   5.325  -2.983   5.198 1.00 . A A . 150 ARG CA   1 1 
        3  7195 1 1 150 ARG CB   C   6.272  -3.241   4.024 1.00 . A A . 150 ARG CB   1 1 
        3  7196 1 1 150 ARG CD   C   7.964  -4.779   2.957 1.00 . A A . 150 ARG CD   1 1 
        3  7197 1 1 150 ARG CG   C   6.969  -4.592   4.094 1.00 . A A . 150 ARG CG   1 1 
        3  7198 1 1 150 ARG CZ   C  10.252  -3.912   3.301 1.00 . A A . 150 ARG CZ   1 1 
        3  7199 1 1 150 ARG H    H   3.999  -4.459   4.469 1.00 . A A . 150 ARG H    1 1 
        3  7200 1 1 150 ARG HA   H   5.890  -2.989   6.119 1.00 . A A . 150 ARG HA   1 1 
        3  7201 1 1 150 ARG HB2  H   5.706  -3.198   3.104 1.00 . A A . 150 ARG HB2  1 1 
        3  7202 1 1 150 ARG HB3  H   7.027  -2.470   4.009 1.00 . A A . 150 ARG HB3  1 1 
        3  7203 1 1 150 ARG HD2  H   8.451  -5.735   3.075 1.00 . A A . 150 ARG HD2  1 1 
        3  7204 1 1 150 ARG HD3  H   7.428  -4.760   2.020 1.00 . A A . 150 ARG HD3  1 1 
        3  7205 1 1 150 ARG HE   H   8.698  -2.833   2.655 1.00 . A A . 150 ARG HE   1 1 
        3  7206 1 1 150 ARG HG2  H   7.495  -4.667   5.033 1.00 . A A . 150 ARG HG2  1 1 
        3  7207 1 1 150 ARG HG3  H   6.223  -5.372   4.036 1.00 . A A . 150 ARG HG3  1 1 
        3  7208 1 1 150 ARG HH11 H  10.065  -5.906   3.638 1.00 . A A . 150 ARG HH11 1 1 
        3  7209 1 1 150 ARG HH12 H  11.646  -5.245   3.919 1.00 . A A . 150 ARG HH12 1 1 
        3  7210 1 1 150 ARG HH21 H  10.776  -1.983   2.996 1.00 . A A . 150 ARG HH21 1 1 
        3  7211 1 1 150 ARG HH22 H  12.057  -3.021   3.559 1.00 . A A . 150 ARG HH22 1 1 
        3  7212 1 1 150 ARG N    N   4.319  -4.022   5.289 1.00 . A A . 150 ARG N    1 1 
        3  7213 1 1 150 ARG NE   N   8.981  -3.729   2.944 1.00 . A A . 150 ARG NE   1 1 
        3  7214 1 1 150 ARG NH1  N  10.691  -5.116   3.646 1.00 . A A . 150 ARG NH1  1 1 
        3  7215 1 1 150 ARG NH2  N  11.093  -2.891   3.280 1.00 . A A . 150 ARG NH2  1 1 
        3  7216 1 1 150 ARG O    O   4.246  -1.238   3.955 1.00 . A A . 150 ARG O    1 1 
        3  7217 1 1 151 VAL C    C   4.646   1.484   6.427 1.00 . A A . 151 VAL C    1 1 
        3  7218 1 1 151 VAL CA   C   3.721   0.288   6.203 1.00 . A A . 151 VAL CA   1 1 
        3  7219 1 1 151 VAL CB   C   2.617   0.237   7.287 1.00 . A A . 151 VAL CB   1 1 
        3  7220 1 1 151 VAL CG1  C   3.175  -0.265   8.607 1.00 . A A . 151 VAL CG1  1 1 
        3  7221 1 1 151 VAL CG2  C   1.951   1.595   7.463 1.00 . A A . 151 VAL CG2  1 1 
        3  7222 1 1 151 VAL H    H   4.859  -1.299   7.004 1.00 . A A . 151 VAL H    1 1 
        3  7223 1 1 151 VAL HA   H   3.237   0.402   5.245 1.00 . A A . 151 VAL HA   1 1 
        3  7224 1 1 151 VAL HB   H   1.862  -0.464   6.959 1.00 . A A . 151 VAL HB   1 1 
        3  7225 1 1 151 VAL HG11 H   3.583  -1.255   8.471 1.00 . A A . 151 VAL HG11 1 1 
        3  7226 1 1 151 VAL HG12 H   2.384  -0.299   9.343 1.00 . A A . 151 VAL HG12 1 1 
        3  7227 1 1 151 VAL HG13 H   3.953   0.402   8.947 1.00 . A A . 151 VAL HG13 1 1 
        3  7228 1 1 151 VAL HG21 H   2.691   2.326   7.752 1.00 . A A . 151 VAL HG21 1 1 
        3  7229 1 1 151 VAL HG22 H   1.193   1.528   8.229 1.00 . A A . 151 VAL HG22 1 1 
        3  7230 1 1 151 VAL HG23 H   1.495   1.896   6.532 1.00 . A A . 151 VAL HG23 1 1 
        3  7231 1 1 151 VAL N    N   4.467  -0.956   6.171 1.00 . A A . 151 VAL N    1 1 
        3  7232 1 1 151 VAL O    O   5.476   1.488   7.338 1.00 . A A . 151 VAL O    1 1 
        3  7233 1 1 152 SER C    C   4.312   4.875   5.912 1.00 . A A . 152 SER C    1 1 
        3  7234 1 1 152 SER CA   C   5.269   3.713   5.656 1.00 . A A . 152 SER CA   1 1 
        3  7235 1 1 152 SER CB   C   6.048   3.943   4.361 1.00 . A A . 152 SER CB   1 1 
        3  7236 1 1 152 SER H    H   3.866   2.379   4.822 1.00 . A A . 152 SER H    1 1 
        3  7237 1 1 152 SER HA   H   5.959   3.627   6.483 1.00 . A A . 152 SER HA   1 1 
        3  7238 1 1 152 SER HB2  H   5.366   4.232   3.577 1.00 . A A . 152 SER HB2  1 1 
        3  7239 1 1 152 SER HB3  H   6.775   4.728   4.514 1.00 . A A . 152 SER HB3  1 1 
        3  7240 1 1 152 SER HG   H   6.095   2.046   3.884 1.00 . A A . 152 SER HG   1 1 
        3  7241 1 1 152 SER N    N   4.510   2.478   5.561 1.00 . A A . 152 SER N    1 1 
        3  7242 1 1 152 SER O    O   3.253   4.960   5.285 1.00 . A A . 152 SER O    1 1 
        3  7243 1 1 152 SER OG   O   6.729   2.764   3.964 1.00 . A A . 152 SER OG   1 1 
        3  7244 1 1 153 LEU C    C   4.452   8.178   7.307 1.00 . A A . 153 LEU C    1 1 
        3  7245 1 1 153 LEU CA   C   3.761   6.819   7.251 1.00 . A A . 153 LEU CA   1 1 
        3  7246 1 1 153 LEU CB   C   3.174   6.481   8.621 1.00 . A A . 153 LEU CB   1 1 
        3  7247 1 1 153 LEU CD1  C   2.050   4.819  10.121 1.00 . A A . 153 LEU CD1  1 1 
        3  7248 1 1 153 LEU CD2  C   1.046   5.370   7.904 1.00 . A A . 153 LEU CD2  1 1 
        3  7249 1 1 153 LEU CG   C   2.342   5.197   8.680 1.00 . A A . 153 LEU CG   1 1 
        3  7250 1 1 153 LEU H    H   5.573   5.707   7.227 1.00 . A A . 153 LEU H    1 1 
        3  7251 1 1 153 LEU HA   H   2.957   6.867   6.532 1.00 . A A . 153 LEU HA   1 1 
        3  7252 1 1 153 LEU HB2  H   3.990   6.389   9.319 1.00 . A A . 153 LEU HB2  1 1 
        3  7253 1 1 153 LEU HB3  H   2.547   7.304   8.934 1.00 . A A . 153 LEU HB3  1 1 
        3  7254 1 1 153 LEU HD11 H   2.980   4.664  10.649 1.00 . A A . 153 LEU HD11 1 1 
        3  7255 1 1 153 LEU HD12 H   1.469   3.909  10.143 1.00 . A A . 153 LEU HD12 1 1 
        3  7256 1 1 153 LEU HD13 H   1.494   5.613  10.598 1.00 . A A . 153 LEU HD13 1 1 
        3  7257 1 1 153 LEU HD21 H   0.456   4.470   7.984 1.00 . A A . 153 LEU HD21 1 1 
        3  7258 1 1 153 LEU HD22 H   1.271   5.561   6.866 1.00 . A A . 153 LEU HD22 1 1 
        3  7259 1 1 153 LEU HD23 H   0.490   6.202   8.311 1.00 . A A . 153 LEU HD23 1 1 
        3  7260 1 1 153 LEU HG   H   2.901   4.391   8.228 1.00 . A A . 153 LEU HG   1 1 
        3  7261 1 1 153 LEU N    N   4.672   5.760   6.830 1.00 . A A . 153 LEU N    1 1 
        3  7262 1 1 153 LEU O    O   5.570   8.344   6.815 1.00 . A A . 153 LEU O    1 1 
        3  7263 1 1 154 MET C    C   5.522  10.606   8.813 1.00 . A A . 154 MET C    1 1 
        3  7264 1 1 154 MET CA   C   4.238  10.514   8.007 1.00 . A A . 154 MET CA   1 1 
        3  7265 1 1 154 MET CB   C   3.195  11.427   8.666 1.00 . A A . 154 MET CB   1 1 
        3  7266 1 1 154 MET CE   C   1.032   9.420   6.407 1.00 . A A . 154 MET CE   1 1 
        3  7267 1 1 154 MET CG   C   1.886  11.587   7.900 1.00 . A A . 154 MET CG   1 1 
        3  7268 1 1 154 MET H    H   2.910   8.911   8.343 1.00 . A A . 154 MET H    1 1 
        3  7269 1 1 154 MET HA   H   4.428  10.864   7.003 1.00 . A A . 154 MET HA   1 1 
        3  7270 1 1 154 MET HB2  H   2.960  11.027   9.641 1.00 . A A . 154 MET HB2  1 1 
        3  7271 1 1 154 MET HB3  H   3.630  12.407   8.792 1.00 . A A . 154 MET HB3  1 1 
        3  7272 1 1 154 MET HE1  H   2.075   9.164   6.270 1.00 . A A . 154 MET HE1  1 1 
        3  7273 1 1 154 MET HE2  H   0.733  10.127   5.649 1.00 . A A . 154 MET HE2  1 1 
        3  7274 1 1 154 MET HE3  H   0.430   8.527   6.323 1.00 . A A . 154 MET HE3  1 1 
        3  7275 1 1 154 MET HG2  H   1.361  12.444   8.292 1.00 . A A . 154 MET HG2  1 1 
        3  7276 1 1 154 MET HG3  H   2.117  11.756   6.859 1.00 . A A . 154 MET HG3  1 1 
        3  7277 1 1 154 MET N    N   3.764   9.140   7.923 1.00 . A A . 154 MET N    1 1 
        3  7278 1 1 154 MET O    O   5.648  10.002   9.880 1.00 . A A . 154 MET O    1 1 
        3  7279 1 1 154 MET SD   S   0.806  10.149   8.025 1.00 . A A . 154 MET SD   1 1 
        3  7280 1 1 155 LEU C    C   7.345  12.715  10.112 1.00 . A A . 155 LEU C    1 1 
        3  7281 1 1 155 LEU CA   C   7.673  11.681   9.040 1.00 . A A . 155 LEU CA   1 1 
        3  7282 1 1 155 LEU CB   C   8.771  12.206   8.113 1.00 . A A . 155 LEU CB   1 1 
        3  7283 1 1 155 LEU CD1  C  10.374  10.276   8.287 1.00 . A A . 155 LEU CD1  1 1 
        3  7284 1 1 155 LEU CD2  C   8.668  10.290   6.470 1.00 . A A . 155 LEU CD2  1 1 
        3  7285 1 1 155 LEU CG   C   9.574  11.149   7.336 1.00 . A A . 155 LEU CG   1 1 
        3  7286 1 1 155 LEU H    H   6.366  11.701   7.386 1.00 . A A . 155 LEU H    1 1 
        3  7287 1 1 155 LEU HA   H   8.016  10.776   9.521 1.00 . A A . 155 LEU HA   1 1 
        3  7288 1 1 155 LEU HB2  H   8.308  12.868   7.401 1.00 . A A . 155 LEU HB2  1 1 
        3  7289 1 1 155 LEU HB3  H   9.464  12.783   8.708 1.00 . A A . 155 LEU HB3  1 1 
        3  7290 1 1 155 LEU HD11 H   9.701   9.777   8.967 1.00 . A A . 155 LEU HD11 1 1 
        3  7291 1 1 155 LEU HD12 H  11.062  10.892   8.847 1.00 . A A . 155 LEU HD12 1 1 
        3  7292 1 1 155 LEU HD13 H  10.927   9.541   7.721 1.00 . A A . 155 LEU HD13 1 1 
        3  7293 1 1 155 LEU HD21 H   8.179  10.911   5.733 1.00 . A A . 155 LEU HD21 1 1 
        3  7294 1 1 155 LEU HD22 H   7.922   9.816   7.091 1.00 . A A . 155 LEU HD22 1 1 
        3  7295 1 1 155 LEU HD23 H   9.255   9.534   5.971 1.00 . A A . 155 LEU HD23 1 1 
        3  7296 1 1 155 LEU HG   H  10.276  11.653   6.686 1.00 . A A . 155 LEU HG   1 1 
        3  7297 1 1 155 LEU N    N   6.472  11.361   8.295 1.00 . A A . 155 LEU N    1 1 
        3  7298 1 1 155 LEU O    O   7.215  13.902   9.823 1.00 . A A . 155 LEU O    1 1 
        3  7299 1 1 156 HIS C    C   5.499  13.708  12.440 1.00 . A A . 156 HIS C    1 1 
        3  7300 1 1 156 HIS CA   C   6.846  12.981  12.537 1.00 . A A . 156 HIS CA   1 1 
        3  7301 1 1 156 HIS CB   C   7.984  13.925  12.981 1.00 . A A . 156 HIS CB   1 1 
        3  7302 1 1 156 HIS CD2  C   9.064  15.610  11.325 1.00 . A A . 156 HIS CD2  1 1 
        3  7303 1 1 156 HIS CE1  C   7.744  17.317  11.684 1.00 . A A . 156 HIS CE1  1 1 
        3  7304 1 1 156 HIS CG   C   8.139  15.223  12.236 1.00 . A A . 156 HIS CG   1 1 
        3  7305 1 1 156 HIS H    H   7.303  11.254  11.438 1.00 . A A . 156 HIS H    1 1 
        3  7306 1 1 156 HIS HA   H   6.731  12.243  13.320 1.00 . A A . 156 HIS HA   1 1 
        3  7307 1 1 156 HIS HB2  H   7.828  14.167  14.012 1.00 . A A . 156 HIS HB2  1 1 
        3  7308 1 1 156 HIS HB3  H   8.919  13.390  12.896 1.00 . A A . 156 HIS HB3  1 1 
        3  7309 1 1 156 HIS HD1  H   6.552  16.358  13.037 1.00 . A A . 156 HIS HD1  1 1 
        3  7310 1 1 156 HIS HD2  H   9.864  15.002  10.929 1.00 . A A . 156 HIS HD2  1 1 
        3  7311 1 1 156 HIS HE1  H   7.300  18.301  11.636 1.00 . A A . 156 HIS HE1  1 1 
        3  7312 1 1 156 HIS HE2  H   9.400  17.511  10.487 1.00 . A A . 156 HIS HE2  1 1 
        3  7313 1 1 156 HIS N    N   7.185  12.214  11.334 1.00 . A A . 156 HIS N    1 1 
        3  7314 1 1 156 HIS ND1  N   7.326  16.318  12.436 1.00 . A A . 156 HIS ND1  1 1 
        3  7315 1 1 156 HIS NE2  N   8.797  16.915  11.002 1.00 . A A . 156 HIS NE2  1 1 
        3  7316 1 1 156 HIS O    O   4.962  13.924  11.355 1.00 . A A . 156 HIS O    1 1 
        3  7317 1 1 157 GLU C    C   2.515  13.743  13.311 1.00 . A A . 157 GLU C    1 1 
        3  7318 1 1 157 GLU CA   C   3.641  14.680  13.744 1.00 . A A . 157 GLU CA   1 1 
        3  7319 1 1 157 GLU CB   C   3.581  16.007  12.986 1.00 . A A . 157 GLU CB   1 1 
        3  7320 1 1 157 GLU CD   C   4.225  18.453  13.003 1.00 . A A . 157 GLU CD   1 1 
        3  7321 1 1 157 GLU CG   C   4.352  17.113  13.686 1.00 . A A . 157 GLU CG   1 1 
        3  7322 1 1 157 GLU H    H   5.468  13.870  14.434 1.00 . A A . 157 GLU H    1 1 
        3  7323 1 1 157 GLU HA   H   3.502  14.890  14.795 1.00 . A A . 157 GLU HA   1 1 
        3  7324 1 1 157 GLU HB2  H   3.998  15.868  11.999 1.00 . A A . 157 GLU HB2  1 1 
        3  7325 1 1 157 GLU HB3  H   2.549  16.314  12.895 1.00 . A A . 157 GLU HB3  1 1 
        3  7326 1 1 157 GLU HG2  H   3.978  17.209  14.694 1.00 . A A . 157 GLU HG2  1 1 
        3  7327 1 1 157 GLU HG3  H   5.397  16.840  13.718 1.00 . A A . 157 GLU HG3  1 1 
        3  7328 1 1 157 GLU N    N   4.958  14.048  13.615 1.00 . A A . 157 GLU N    1 1 
        3  7329 1 1 157 GLU O    O   1.436  14.184  12.919 1.00 . A A . 157 GLU O    1 1 
        3  7330 1 1 157 GLU OE1  O   3.118  19.030  13.021 1.00 . A A . 157 GLU OE1  1 1 
        3  7331 1 1 157 GLU OE2  O   5.239  18.945  12.473 1.00 . A A . 157 GLU OE2  1 1 
        3  7332 1 1 158 SER C    C   0.912  11.295  14.486 1.00 . A A . 158 SER C    1 1 
        3  7333 1 1 158 SER CA   C   1.735  11.449  13.207 1.00 . A A . 158 SER CA   1 1 
        3  7334 1 1 158 SER CB   C   2.373  10.121  12.800 1.00 . A A . 158 SER CB   1 1 
        3  7335 1 1 158 SER H    H   3.672  12.153  13.641 1.00 . A A . 158 SER H    1 1 
        3  7336 1 1 158 SER HA   H   1.088  11.794  12.414 1.00 . A A . 158 SER HA   1 1 
        3  7337 1 1 158 SER HB2  H   1.646   9.327  12.888 1.00 . A A . 158 SER HB2  1 1 
        3  7338 1 1 158 SER HB3  H   2.715  10.186  11.777 1.00 . A A . 158 SER HB3  1 1 
        3  7339 1 1 158 SER HG   H   3.236   9.973  14.552 1.00 . A A . 158 SER HG   1 1 
        3  7340 1 1 158 SER N    N   2.767  12.447  13.415 1.00 . A A . 158 SER N    1 1 
        3  7341 1 1 158 SER O    O   1.445  10.921  15.533 1.00 . A A . 158 SER O    1 1 
        3  7342 1 1 158 SER OG   O   3.479   9.820  13.632 1.00 . A A . 158 SER OG   1 1 
        3  7343 1 1 159 LEU C    C  -1.551  10.260  16.103 1.00 . A A . 159 LEU C    1 1 
        3  7344 1 1 159 LEU CA   C  -1.242  11.655  15.572 1.00 . A A . 159 LEU CA   1 1 
        3  7345 1 1 159 LEU CB   C  -2.557  12.393  15.262 1.00 . A A . 159 LEU CB   1 1 
        3  7346 1 1 159 LEU CD1  C  -1.532  14.594  15.924 1.00 . A A . 159 LEU CD1  1 1 
        3  7347 1 1 159 LEU CD2  C  -1.937  14.092  13.498 1.00 . A A . 159 LEU CD2  1 1 
        3  7348 1 1 159 LEU CG   C  -2.436  13.888  14.924 1.00 . A A . 159 LEU CG   1 1 
        3  7349 1 1 159 LEU H    H  -0.750  11.825  13.522 1.00 . A A . 159 LEU H    1 1 
        3  7350 1 1 159 LEU HA   H  -0.716  12.201  16.341 1.00 . A A . 159 LEU HA   1 1 
        3  7351 1 1 159 LEU HB2  H  -3.028  11.898  14.426 1.00 . A A . 159 LEU HB2  1 1 
        3  7352 1 1 159 LEU HB3  H  -3.203  12.296  16.121 1.00 . A A . 159 LEU HB3  1 1 
        3  7353 1 1 159 LEU HD11 H  -1.499  15.650  15.697 1.00 . A A . 159 LEU HD11 1 1 
        3  7354 1 1 159 LEU HD12 H  -0.537  14.181  15.863 1.00 . A A . 159 LEU HD12 1 1 
        3  7355 1 1 159 LEU HD13 H  -1.919  14.453  16.922 1.00 . A A . 159 LEU HD13 1 1 
        3  7356 1 1 159 LEU HD21 H  -2.609  13.603  12.807 1.00 . A A . 159 LEU HD21 1 1 
        3  7357 1 1 159 LEU HD22 H  -0.948  13.670  13.397 1.00 . A A . 159 LEU HD22 1 1 
        3  7358 1 1 159 LEU HD23 H  -1.901  15.150  13.276 1.00 . A A . 159 LEU HD23 1 1 
        3  7359 1 1 159 LEU HG   H  -3.416  14.337  14.999 1.00 . A A . 159 LEU HG   1 1 
        3  7360 1 1 159 LEU N    N  -0.373  11.610  14.399 1.00 . A A . 159 LEU N    1 1 
        3  7361 1 1 159 LEU O    O  -2.506   9.619  15.660 1.00 . A A . 159 LEU O    1 1 
        3  7362 1 1 160 GLU C    C   0.186   8.288  18.724 1.00 . A A . 160 GLU C    1 1 
        3  7363 1 1 160 GLU CA   C  -0.941   8.536  17.728 1.00 . A A . 160 GLU CA   1 1 
        3  7364 1 1 160 GLU CB   C  -1.024   7.359  16.746 1.00 . A A . 160 GLU CB   1 1 
        3  7365 1 1 160 GLU CD   C  -2.616   6.107  18.250 1.00 . A A . 160 GLU CD   1 1 
        3  7366 1 1 160 GLU CG   C  -1.351   6.035  17.421 1.00 . A A . 160 GLU CG   1 1 
        3  7367 1 1 160 GLU H    H   0.064  10.335  17.272 1.00 . A A . 160 GLU H    1 1 
        3  7368 1 1 160 GLU HA   H  -1.872   8.609  18.269 1.00 . A A . 160 GLU HA   1 1 
        3  7369 1 1 160 GLU HB2  H  -1.795   7.567  16.017 1.00 . A A . 160 GLU HB2  1 1 
        3  7370 1 1 160 GLU HB3  H  -0.077   7.257  16.238 1.00 . A A . 160 GLU HB3  1 1 
        3  7371 1 1 160 GLU HG2  H  -1.478   5.278  16.661 1.00 . A A . 160 GLU HG2  1 1 
        3  7372 1 1 160 GLU HG3  H  -0.529   5.762  18.067 1.00 . A A . 160 GLU HG3  1 1 
        3  7373 1 1 160 GLU N    N  -0.726   9.801  17.038 1.00 . A A . 160 GLU N    1 1 
        3  7374 1 1 160 GLU O    O   1.358   8.261  18.347 1.00 . A A . 160 GLU O    1 1 
        3  7375 1 1 160 GLU OE1  O  -2.560   6.624  19.390 1.00 . A A . 160 GLU OE1  1 1 
        3  7376 1 1 160 GLU OE2  O  -3.674   5.657  17.769 1.00 . A A . 160 GLU OE2  1 1 
        3  7377 1 1 161 HIS C    C   0.249   7.151  22.241 1.00 . A A . 161 HIS C    1 1 
        3  7378 1 1 161 HIS CA   C   0.834   7.872  21.026 1.00 . A A . 161 HIS CA   1 1 
        3  7379 1 1 161 HIS CB   C   1.486   9.188  21.464 1.00 . A A . 161 HIS CB   1 1 
        3  7380 1 1 161 HIS CD2  C   4.027   8.695  21.406 1.00 . A A . 161 HIS CD2  1 1 
        3  7381 1 1 161 HIS CE1  C   4.595  10.098  19.830 1.00 . A A . 161 HIS CE1  1 1 
        3  7382 1 1 161 HIS CG   C   2.902   9.327  21.001 1.00 . A A . 161 HIS CG   1 1 
        3  7383 1 1 161 HIS H    H  -1.117   8.168  20.240 1.00 . A A . 161 HIS H    1 1 
        3  7384 1 1 161 HIS HA   H   1.595   7.243  20.592 1.00 . A A . 161 HIS HA   1 1 
        3  7385 1 1 161 HIS HB2  H   0.923  10.014  21.060 1.00 . A A . 161 HIS HB2  1 1 
        3  7386 1 1 161 HIS HB3  H   1.481   9.245  22.543 1.00 . A A . 161 HIS HB3  1 1 
        3  7387 1 1 161 HIS HD1  H   2.694  10.792  19.492 1.00 . A A . 161 HIS HD1  1 1 
        3  7388 1 1 161 HIS HD2  H   4.093   7.938  22.175 1.00 . A A . 161 HIS HD2  1 1 
        3  7389 1 1 161 HIS HE1  H   5.177  10.666  19.119 1.00 . A A . 161 HIS HE1  1 1 
        3  7390 1 1 161 HIS HE2  H   5.945   8.742  20.562 1.00 . A A . 161 HIS HE2  1 1 
        3  7391 1 1 161 HIS N    N  -0.165   8.117  19.993 1.00 . A A . 161 HIS N    1 1 
        3  7392 1 1 161 HIS ND1  N   3.293  10.199  20.011 1.00 . A A . 161 HIS ND1  1 1 
        3  7393 1 1 161 HIS NE2  N   5.068   9.191  20.663 1.00 . A A . 161 HIS NE2  1 1 
        3  7394 1 1 161 HIS O    O   0.839   7.185  23.322 1.00 . A A . 161 HIS O    1 1 
        3  7395 1 1 162 HIS C    C  -1.014   4.258  23.120 1.00 . A A . 162 HIS C    1 1 
        3  7396 1 1 162 HIS CA   C  -1.462   5.717  23.186 1.00 . A A . 162 HIS CA   1 1 
        3  7397 1 1 162 HIS CB   C  -3.001   5.838  23.221 1.00 . A A . 162 HIS CB   1 1 
        3  7398 1 1 162 HIS CD2  C  -4.398   3.749  22.561 1.00 . A A . 162 HIS CD2  1 1 
        3  7399 1 1 162 HIS CE1  C  -4.715   4.217  20.449 1.00 . A A . 162 HIS CE1  1 1 
        3  7400 1 1 162 HIS CG   C  -3.761   4.917  22.304 1.00 . A A . 162 HIS CG   1 1 
        3  7401 1 1 162 HIS H    H  -1.331   6.477  21.197 1.00 . A A . 162 HIS H    1 1 
        3  7402 1 1 162 HIS HA   H  -1.065   6.144  24.097 1.00 . A A . 162 HIS HA   1 1 
        3  7403 1 1 162 HIS HB2  H  -3.338   5.635  24.227 1.00 . A A . 162 HIS HB2  1 1 
        3  7404 1 1 162 HIS HB3  H  -3.272   6.852  22.966 1.00 . A A . 162 HIS HB3  1 1 
        3  7405 1 1 162 HIS HD1  H  -3.609   5.943  20.461 1.00 . A A . 162 HIS HD1  1 1 
        3  7406 1 1 162 HIS HD2  H  -4.433   3.236  23.512 1.00 . A A . 162 HIS HD2  1 1 
        3  7407 1 1 162 HIS HE1  H  -5.045   4.163  19.422 1.00 . A A . 162 HIS HE1  1 1 
        3  7408 1 1 162 HIS HE2  H  -5.342   2.431  21.226 1.00 . A A . 162 HIS HE2  1 1 
        3  7409 1 1 162 HIS N    N  -0.883   6.472  22.073 1.00 . A A . 162 HIS N    1 1 
        3  7410 1 1 162 HIS ND1  N  -3.976   5.176  20.971 1.00 . A A . 162 HIS ND1  1 1 
        3  7411 1 1 162 HIS NE2  N  -4.985   3.337  21.392 1.00 . A A . 162 HIS NE2  1 1 
        3  7412 1 1 162 HIS O    O  -1.580   3.383  23.776 1.00 . A A . 162 HIS O    1 1 
        3  7413 1 1 163 HIS C    C   1.150   2.179  23.499 1.00 . A A . 163 HIS C    1 1 
        3  7414 1 1 163 HIS CA   C   0.596   2.692  22.169 1.00 . A A . 163 HIS CA   1 1 
        3  7415 1 1 163 HIS CB   C   1.704   2.723  21.107 1.00 . A A . 163 HIS CB   1 1 
        3  7416 1 1 163 HIS CD2  C   1.766   0.191  20.536 1.00 . A A . 163 HIS CD2  1 1 
        3  7417 1 1 163 HIS CE1  C   3.941  -0.084  20.517 1.00 . A A . 163 HIS CE1  1 1 
        3  7418 1 1 163 HIS CG   C   2.329   1.388  20.823 1.00 . A A . 163 HIS CG   1 1 
        3  7419 1 1 163 HIS H    H   0.437   4.773  21.859 1.00 . A A . 163 HIS H    1 1 
        3  7420 1 1 163 HIS HA   H  -0.190   2.031  21.839 1.00 . A A . 163 HIS HA   1 1 
        3  7421 1 1 163 HIS HB2  H   1.292   3.096  20.182 1.00 . A A . 163 HIS HB2  1 1 
        3  7422 1 1 163 HIS HB3  H   2.486   3.391  21.439 1.00 . A A . 163 HIS HB3  1 1 
        3  7423 1 1 163 HIS HD1  H   4.388   1.880  20.949 1.00 . A A . 163 HIS HD1  1 1 
        3  7424 1 1 163 HIS HD2  H   0.708  -0.019  20.471 1.00 . A A . 163 HIS HD2  1 1 
        3  7425 1 1 163 HIS HE1  H   4.921  -0.535  20.437 1.00 . A A . 163 HIS HE1  1 1 
        3  7426 1 1 163 HIS HE2  H   2.674  -1.689  20.292 1.00 . A A . 163 HIS HE2  1 1 
        3  7427 1 1 163 HIS N    N   0.029   4.023  22.334 1.00 . A A . 163 HIS N    1 1 
        3  7428 1 1 163 HIS ND1  N   3.694   1.183  20.800 1.00 . A A . 163 HIS ND1  1 1 
        3  7429 1 1 163 HIS NE2  N   2.787  -0.708  20.350 1.00 . A A . 163 HIS NE2  1 1 
        3  7430 1 1 163 HIS O    O   1.833   2.906  24.220 1.00 . A A . 163 HIS O    1 1 
        3  7431 1 1 164 HIS C    C   2.601  -0.431  24.826 1.00 . A A . 164 HIS C    1 1 
        3  7432 1 1 164 HIS CA   C   1.297   0.317  25.051 1.00 . A A . 164 HIS CA   1 1 
        3  7433 1 1 164 HIS CB   C   0.244  -0.656  25.588 1.00 . A A . 164 HIS CB   1 1 
        3  7434 1 1 164 HIS CD2  C  -1.423   0.997  26.683 1.00 . A A . 164 HIS CD2  1 1 
        3  7435 1 1 164 HIS CE1  C  -3.253   0.293  25.710 1.00 . A A . 164 HIS CE1  1 1 
        3  7436 1 1 164 HIS CG   C  -1.083  -0.024  25.865 1.00 . A A . 164 HIS CG   1 1 
        3  7437 1 1 164 HIS H    H   0.274   0.407  23.199 1.00 . A A . 164 HIS H    1 1 
        3  7438 1 1 164 HIS HA   H   1.459   1.098  25.778 1.00 . A A . 164 HIS HA   1 1 
        3  7439 1 1 164 HIS HB2  H   0.091  -1.442  24.863 1.00 . A A . 164 HIS HB2  1 1 
        3  7440 1 1 164 HIS HB3  H   0.604  -1.091  26.509 1.00 . A A . 164 HIS HB3  1 1 
        3  7441 1 1 164 HIS HD1  H  -2.335  -1.184  24.620 1.00 . A A . 164 HIS HD1  1 1 
        3  7442 1 1 164 HIS HD2  H  -0.751   1.571  27.305 1.00 . A A . 164 HIS HD2  1 1 
        3  7443 1 1 164 HIS HE1  H  -4.287   0.190  25.419 1.00 . A A . 164 HIS HE1  1 1 
        3  7444 1 1 164 HIS HE2  H  -3.333   1.733  27.172 1.00 . A A . 164 HIS HE2  1 1 
        3  7445 1 1 164 HIS N    N   0.838   0.932  23.816 1.00 . A A . 164 HIS N    1 1 
        3  7446 1 1 164 HIS ND1  N  -2.251  -0.443  25.271 1.00 . A A . 164 HIS ND1  1 1 
        3  7447 1 1 164 HIS NE2  N  -2.779   1.175  26.569 1.00 . A A . 164 HIS NE2  1 1 
        3  7448 1 1 164 HIS O    O   3.037  -0.607  23.687 1.00 . A A . 164 HIS O    1 1 
        3  7449 1 1 165 HIS C    C   4.125  -3.076  26.419 1.00 . A A . 165 HIS C    1 1 
        3  7450 1 1 165 HIS CA   C   4.414  -1.699  25.832 1.00 . A A . 165 HIS CA   1 1 
        3  7451 1 1 165 HIS CB   C   5.613  -1.042  26.536 1.00 . A A . 165 HIS CB   1 1 
        3  7452 1 1 165 HIS CD2  C   4.679   0.261  28.585 1.00 . A A . 165 HIS CD2  1 1 
        3  7453 1 1 165 HIS CE1  C   5.682  -0.873  30.167 1.00 . A A . 165 HIS CE1  1 1 
        3  7454 1 1 165 HIS CG   C   5.405  -0.715  27.987 1.00 . A A . 165 HIS CG   1 1 
        3  7455 1 1 165 HIS H    H   2.860  -0.623  26.798 1.00 . A A . 165 HIS H    1 1 
        3  7456 1 1 165 HIS HA   H   4.650  -1.822  24.784 1.00 . A A . 165 HIS HA   1 1 
        3  7457 1 1 165 HIS HB2  H   6.458  -1.709  26.471 1.00 . A A . 165 HIS HB2  1 1 
        3  7458 1 1 165 HIS HB3  H   5.854  -0.122  26.022 1.00 . A A . 165 HIS HB3  1 1 
        3  7459 1 1 165 HIS HD1  H   6.635  -2.175  28.895 1.00 . A A . 165 HIS HD1  1 1 
        3  7460 1 1 165 HIS HD2  H   4.068   1.001  28.086 1.00 . A A . 165 HIS HD2  1 1 
        3  7461 1 1 165 HIS HE1  H   6.014  -1.207  31.138 1.00 . A A . 165 HIS HE1  1 1 
        3  7462 1 1 165 HIS HE2  H   4.474   0.726  30.628 1.00 . A A . 165 HIS HE2  1 1 
        3  7463 1 1 165 HIS N    N   3.220  -0.865  25.914 1.00 . A A . 165 HIS N    1 1 
        3  7464 1 1 165 HIS ND1  N   6.022  -1.406  29.007 1.00 . A A . 165 HIS ND1  1 1 
        3  7465 1 1 165 HIS NE2  N   4.870   0.139  29.935 1.00 . A A . 165 HIS NE2  1 1 
        3  7466 1 1 165 HIS O    O   4.916  -4.008  26.281 1.00 . A A . 165 HIS O    1 1 
        3  7467 1 1 166 HIS C    C   0.996  -4.284  27.907 1.00 . A A . 166 HIS C    1 1 
        3  7468 1 1 166 HIS CA   C   2.480  -4.437  27.601 1.00 . A A . 166 HIS CA   1 1 
        3  7469 1 1 166 HIS CB   C   3.240  -4.867  28.865 1.00 . A A . 166 HIS CB   1 1 
        3  7470 1 1 166 HIS CD2  C   1.733  -6.817  29.700 1.00 . A A . 166 HIS CD2  1 1 
        3  7471 1 1 166 HIS CE1  C   3.260  -8.376  29.822 1.00 . A A . 166 HIS CE1  1 1 
        3  7472 1 1 166 HIS CG   C   2.908  -6.263  29.317 1.00 . A A . 166 HIS CG   1 1 
        3  7473 1 1 166 HIS H    H   2.450  -2.365  27.234 1.00 . A A . 166 HIS H    1 1 
        3  7474 1 1 166 HIS HA   H   2.605  -5.189  26.834 1.00 . A A . 166 HIS HA   1 1 
        3  7475 1 1 166 HIS HB2  H   4.301  -4.825  28.672 1.00 . A A . 166 HIS HB2  1 1 
        3  7476 1 1 166 HIS HB3  H   2.996  -4.187  29.671 1.00 . A A . 166 HIS HB3  1 1 
        3  7477 1 1 166 HIS HD1  H   4.811  -7.183  29.196 1.00 . A A . 166 HIS HD1  1 1 
        3  7478 1 1 166 HIS HD2  H   0.777  -6.315  29.752 1.00 . A A . 166 HIS HD2  1 1 
        3  7479 1 1 166 HIS HE1  H   3.752  -9.326  29.982 1.00 . A A . 166 HIS HE1  1 1 
        3  7480 1 1 166 HIS HE2  H   1.279  -8.834  30.079 1.00 . A A . 166 HIS HE2  1 1 
        3  7481 1 1 166 HIS N    N   2.983  -3.177  27.081 1.00 . A A . 166 HIS N    1 1 
        3  7482 1 1 166 HIS ND1  N   3.845  -7.268  29.408 1.00 . A A . 166 HIS ND1  1 1 
        3  7483 1 1 166 HIS NE2  N   1.977  -8.131  30.009 1.00 . A A . 166 HIS NE2  1 1 
        3  7484 1 1 166 HIS O    O   0.663  -3.586  28.888 1.00 . A A . 166 HIS O    1 1 
        3  7485 1 1 166 HIS OXT  O   0.177  -4.844  27.164 1.00 . A A . 166 HIS OXT  1 1 
        4  7486 1 1   1 MET C    C  -4.803  -0.102  23.726 1.00 . A A .   1 MET C    1 1 
        4  7487 1 1   1 MET CA   C  -5.383  -1.213  22.846 1.00 . A A .   1 MET CA   1 1 
        4  7488 1 1   1 MET CB   C  -6.555  -1.897  23.564 1.00 . A A .   1 MET CB   1 1 
        4  7489 1 1   1 MET CE   C  -9.581  -2.980  23.305 1.00 . A A .   1 MET CE   1 1 
        4  7490 1 1   1 MET CG   C  -7.739  -0.977  23.839 1.00 . A A .   1 MET CG   1 1 
        4  7491 1 1   1 MET H1   H  -3.906  -2.600  23.353 1.00 . A A .   1 MET H1   1 1 
        4  7492 1 1   1 MET H2   H  -3.607  -1.770  21.901 1.00 . A A .   1 MET H2   1 1 
        4  7493 1 1   1 MET H3   H  -4.772  -2.995  21.954 1.00 . A A .   1 MET H3   1 1 
        4  7494 1 1   1 MET HA   H  -5.745  -0.770  21.928 1.00 . A A .   1 MET HA   1 1 
        4  7495 1 1   1 MET HB2  H  -6.902  -2.720  22.958 1.00 . A A .   1 MET HB2  1 1 
        4  7496 1 1   1 MET HB3  H  -6.203  -2.284  24.509 1.00 . A A .   1 MET HB3  1 1 
        4  7497 1 1   1 MET HE1  H  -9.850  -2.427  22.417 1.00 . A A .   1 MET HE1  1 1 
        4  7498 1 1   1 MET HE2  H -10.423  -3.576  23.628 1.00 . A A .   1 MET HE2  1 1 
        4  7499 1 1   1 MET HE3  H  -8.744  -3.626  23.089 1.00 . A A .   1 MET HE3  1 1 
        4  7500 1 1   1 MET HG2  H  -7.415  -0.185  24.497 1.00 . A A .   1 MET HG2  1 1 
        4  7501 1 1   1 MET HG3  H  -8.070  -0.550  22.903 1.00 . A A .   1 MET HG3  1 1 
        4  7502 1 1   1 MET N    N  -4.346  -2.213  22.493 1.00 . A A .   1 MET N    1 1 
        4  7503 1 1   1 MET O    O  -5.453   0.919  23.952 1.00 . A A .   1 MET O    1 1 
        4  7504 1 1   1 MET SD   S  -9.129  -1.834  24.606 1.00 . A A .   1 MET SD   1 1 
        4  7505 1 1   2 ASP C    C  -2.452   1.905  24.330 1.00 . A A .   2 ASP C    1 1 
        4  7506 1 1   2 ASP CA   C  -2.985   0.701  25.115 1.00 . A A .   2 ASP CA   1 1 
        4  7507 1 1   2 ASP CB   C  -1.901   0.078  26.021 1.00 . A A .   2 ASP CB   1 1 
        4  7508 1 1   2 ASP CG   C  -0.811  -0.665  25.270 1.00 . A A .   2 ASP CG   1 1 
        4  7509 1 1   2 ASP H    H  -3.075  -1.096  23.990 1.00 . A A .   2 ASP H    1 1 
        4  7510 1 1   2 ASP HA   H  -3.782   1.059  25.749 1.00 . A A .   2 ASP HA   1 1 
        4  7511 1 1   2 ASP HB2  H  -1.433   0.863  26.595 1.00 . A A .   2 ASP HB2  1 1 
        4  7512 1 1   2 ASP HB3  H  -2.375  -0.615  26.701 1.00 . A A .   2 ASP HB3  1 1 
        4  7513 1 1   2 ASP N    N  -3.581  -0.290  24.225 1.00 . A A .   2 ASP N    1 1 
        4  7514 1 1   2 ASP O    O  -3.178   2.889  24.161 1.00 . A A .   2 ASP O    1 1 
        4  7515 1 1   2 ASP OD1  O  -0.990  -1.864  24.978 1.00 . A A .   2 ASP OD1  1 1 
        4  7516 1 1   2 ASP OD2  O   0.235  -0.054  24.977 1.00 . A A .   2 ASP OD2  1 1 
        4  7517 1 1   3 PHE C    C   0.810   2.601  22.658 1.00 . A A .   3 PHE C    1 1 
        4  7518 1 1   3 PHE CA   C  -0.614   2.935  23.094 1.00 . A A .   3 PHE CA   1 1 
        4  7519 1 1   3 PHE CB   C  -0.593   4.203  23.964 1.00 . A A .   3 PHE CB   1 1 
        4  7520 1 1   3 PHE CD1  C  -0.682   6.074  22.294 1.00 . A A .   3 PHE CD1  1 1 
        4  7521 1 1   3 PHE CD2  C   1.273   5.854  23.642 1.00 . A A .   3 PHE CD2  1 1 
        4  7522 1 1   3 PHE CE1  C  -0.130   7.177  21.671 1.00 . A A .   3 PHE CE1  1 1 
        4  7523 1 1   3 PHE CE2  C   1.830   6.956  23.022 1.00 . A A .   3 PHE CE2  1 1 
        4  7524 1 1   3 PHE CG   C   0.011   5.402  23.285 1.00 . A A .   3 PHE CG   1 1 
        4  7525 1 1   3 PHE CZ   C   1.127   7.617  22.036 1.00 . A A .   3 PHE CZ   1 1 
        4  7526 1 1   3 PHE H    H  -0.695   1.003  23.967 1.00 . A A .   3 PHE H    1 1 
        4  7527 1 1   3 PHE HA   H  -1.214   3.120  22.217 1.00 . A A .   3 PHE HA   1 1 
        4  7528 1 1   3 PHE HB2  H  -1.605   4.458  24.240 1.00 . A A .   3 PHE HB2  1 1 
        4  7529 1 1   3 PHE HB3  H  -0.022   4.005  24.858 1.00 . A A .   3 PHE HB3  1 1 
        4  7530 1 1   3 PHE HD1  H  -1.666   5.731  22.009 1.00 . A A .   3 PHE HD1  1 1 
        4  7531 1 1   3 PHE HD2  H   1.824   5.338  24.414 1.00 . A A .   3 PHE HD2  1 1 
        4  7532 1 1   3 PHE HE1  H  -0.680   7.693  20.898 1.00 . A A .   3 PHE HE1  1 1 
        4  7533 1 1   3 PHE HE2  H   2.813   7.297  23.309 1.00 . A A .   3 PHE HE2  1 1 
        4  7534 1 1   3 PHE HZ   H   1.561   8.478  21.548 1.00 . A A .   3 PHE HZ   1 1 
        4  7535 1 1   3 PHE N    N  -1.220   1.827  23.831 1.00 . A A .   3 PHE N    1 1 
        4  7536 1 1   3 PHE O    O   1.210   2.895  21.533 1.00 . A A .   3 PHE O    1 1 
        4  7537 1 1   4 GLU C    C   3.345   0.476  22.703 1.00 . A A .   4 GLU C    1 1 
        4  7538 1 1   4 GLU CA   C   2.996   1.817  23.336 1.00 . A A .   4 GLU CA   1 1 
        4  7539 1 1   4 GLU CB   C   3.749   2.000  24.654 1.00 . A A .   4 GLU CB   1 1 
        4  7540 1 1   4 GLU CD   C   4.319   3.572  26.553 1.00 . A A .   4 GLU CD   1 1 
        4  7541 1 1   4 GLU CG   C   3.583   3.391  25.245 1.00 . A A .   4 GLU CG   1 1 
        4  7542 1 1   4 GLU H    H   1.148   1.584  24.346 1.00 . A A .   4 GLU H    1 1 
        4  7543 1 1   4 GLU HA   H   3.307   2.598  22.657 1.00 . A A .   4 GLU HA   1 1 
        4  7544 1 1   4 GLU HB2  H   3.383   1.277  25.370 1.00 . A A .   4 GLU HB2  1 1 
        4  7545 1 1   4 GLU HB3  H   4.802   1.826  24.484 1.00 . A A .   4 GLU HB3  1 1 
        4  7546 1 1   4 GLU HG2  H   3.960   4.115  24.537 1.00 . A A .   4 GLU HG2  1 1 
        4  7547 1 1   4 GLU HG3  H   2.532   3.572  25.414 1.00 . A A .   4 GLU HG3  1 1 
        4  7548 1 1   4 GLU N    N   1.565   1.974  23.546 1.00 . A A .   4 GLU N    1 1 
        4  7549 1 1   4 GLU O    O   3.550  -0.525  23.393 1.00 . A A .   4 GLU O    1 1 
        4  7550 1 1   4 GLU OE1  O   5.519   3.909  26.523 1.00 . A A .   4 GLU OE1  1 1 
        4  7551 1 1   4 GLU OE2  O   3.698   3.387  27.620 1.00 . A A .   4 GLU OE2  1 1 
        4  7552 1 1   5 CYS C    C   4.950  -0.263  19.668 1.00 . A A .   5 CYS C    1 1 
        4  7553 1 1   5 CYS CA   C   3.853  -0.693  20.633 1.00 . A A .   5 CYS CA   1 1 
        4  7554 1 1   5 CYS CB   C   2.696  -1.345  19.872 1.00 . A A .   5 CYS CB   1 1 
        4  7555 1 1   5 CYS H    H   3.104   1.264  20.885 1.00 . A A .   5 CYS H    1 1 
        4  7556 1 1   5 CYS HA   H   4.264  -1.404  21.336 1.00 . A A .   5 CYS HA   1 1 
        4  7557 1 1   5 CYS HB2  H   2.313  -0.644  19.147 1.00 . A A .   5 CYS HB2  1 1 
        4  7558 1 1   5 CYS HB3  H   3.064  -2.221  19.357 1.00 . A A .   5 CYS HB3  1 1 
        4  7559 1 1   5 CYS HG   H   1.738  -1.882  22.178 1.00 . A A .   5 CYS HG   1 1 
        4  7560 1 1   5 CYS N    N   3.393   0.465  21.380 1.00 . A A .   5 CYS N    1 1 
        4  7561 1 1   5 CYS O    O   4.688   0.034  18.502 1.00 . A A .   5 CYS O    1 1 
        4  7562 1 1   5 CYS SG   S   1.313  -1.860  20.919 1.00 . A A .   5 CYS SG   1 1 
        4  7563 1 1   6 GLN C    C   7.897  -0.760  18.516 1.00 . A A .   6 GLN C    1 1 
        4  7564 1 1   6 GLN CA   C   7.285   0.323  19.391 1.00 . A A .   6 GLN CA   1 1 
        4  7565 1 1   6 GLN CB   C   8.351   0.916  20.313 1.00 . A A .   6 GLN CB   1 1 
        4  7566 1 1   6 GLN CD   C   8.906   2.591  22.117 1.00 . A A .   6 GLN CD   1 1 
        4  7567 1 1   6 GLN CG   C   7.837   2.042  21.196 1.00 . A A .   6 GLN CG   1 1 
        4  7568 1 1   6 GLN H    H   6.341  -0.531  21.074 1.00 . A A .   6 GLN H    1 1 
        4  7569 1 1   6 GLN HA   H   6.900   1.107  18.754 1.00 . A A .   6 GLN HA   1 1 
        4  7570 1 1   6 GLN HB2  H   8.732   0.132  20.953 1.00 . A A .   6 GLN HB2  1 1 
        4  7571 1 1   6 GLN HB3  H   9.159   1.300  19.708 1.00 . A A .   6 GLN HB3  1 1 
        4  7572 1 1   6 GLN HE21 H   9.401   3.970  20.775 1.00 . A A .   6 GLN HE21 1 1 
        4  7573 1 1   6 GLN HE22 H  10.308   3.990  22.247 1.00 . A A .   6 GLN HE22 1 1 
        4  7574 1 1   6 GLN HG2  H   7.482   2.843  20.565 1.00 . A A .   6 GLN HG2  1 1 
        4  7575 1 1   6 GLN HG3  H   7.020   1.668  21.798 1.00 . A A .   6 GLN HG3  1 1 
        4  7576 1 1   6 GLN N    N   6.175  -0.200  20.166 1.00 . A A .   6 GLN N    1 1 
        4  7577 1 1   6 GLN NE2  N   9.609   3.619  21.668 1.00 . A A .   6 GLN NE2  1 1 
        4  7578 1 1   6 GLN O    O   8.645  -1.614  18.994 1.00 . A A .   6 GLN O    1 1 
        4  7579 1 1   6 GLN OE1  O   9.092   2.102  23.227 1.00 . A A .   6 GLN OE1  1 1 
        4  7580 1 1   7 PHE C    C   9.259  -0.934  15.519 1.00 . A A .   7 PHE C    1 1 
        4  7581 1 1   7 PHE CA   C   8.142  -1.645  16.271 1.00 . A A .   7 PHE CA   1 1 
        4  7582 1 1   7 PHE CB   C   7.086  -2.165  15.293 1.00 . A A .   7 PHE CB   1 1 
        4  7583 1 1   7 PHE CD1  C   6.342  -4.471  15.945 1.00 . A A .   7 PHE CD1  1 1 
        4  7584 1 1   7 PHE CD2  C   4.926  -2.630  16.485 1.00 . A A .   7 PHE CD2  1 1 
        4  7585 1 1   7 PHE CE1  C   5.435  -5.341  16.521 1.00 . A A .   7 PHE CE1  1 1 
        4  7586 1 1   7 PHE CE2  C   4.016  -3.495  17.063 1.00 . A A .   7 PHE CE2  1 1 
        4  7587 1 1   7 PHE CG   C   6.098  -3.107  15.920 1.00 . A A .   7 PHE CG   1 1 
        4  7588 1 1   7 PHE CZ   C   4.272  -4.853  17.081 1.00 . A A .   7 PHE CZ   1 1 
        4  7589 1 1   7 PHE H    H   6.861  -0.108  16.950 1.00 . A A .   7 PHE H    1 1 
        4  7590 1 1   7 PHE HA   H   8.563  -2.480  16.812 1.00 . A A .   7 PHE HA   1 1 
        4  7591 1 1   7 PHE HB2  H   6.535  -1.327  14.896 1.00 . A A .   7 PHE HB2  1 1 
        4  7592 1 1   7 PHE HB3  H   7.577  -2.683  14.484 1.00 . A A .   7 PHE HB3  1 1 
        4  7593 1 1   7 PHE HD1  H   7.252  -4.855  15.507 1.00 . A A .   7 PHE HD1  1 1 
        4  7594 1 1   7 PHE HD2  H   4.724  -1.570  16.473 1.00 . A A .   7 PHE HD2  1 1 
        4  7595 1 1   7 PHE HE1  H   5.637  -6.401  16.535 1.00 . A A .   7 PHE HE1  1 1 
        4  7596 1 1   7 PHE HE2  H   3.106  -3.111  17.499 1.00 . A A .   7 PHE HE2  1 1 
        4  7597 1 1   7 PHE HZ   H   3.561  -5.530  17.532 1.00 . A A .   7 PHE HZ   1 1 
        4  7598 1 1   7 PHE N    N   7.545  -0.743  17.244 1.00 . A A .   7 PHE N    1 1 
        4  7599 1 1   7 PHE O    O   9.134   0.245  15.174 1.00 . A A .   7 PHE O    1 1 
        4  7600 1 1   8 VAL C    C  11.178  -0.603  13.209 1.00 . A A .   8 VAL C    1 1 
        4  7601 1 1   8 VAL CA   C  11.519  -1.081  14.622 1.00 . A A .   8 VAL CA   1 1 
        4  7602 1 1   8 VAL CB   C  12.692  -2.090  14.588 1.00 . A A .   8 VAL CB   1 1 
        4  7603 1 1   8 VAL CG1  C  12.325  -3.347  13.807 1.00 . A A .   8 VAL CG1  1 1 
        4  7604 1 1   8 VAL CG2  C  13.948  -1.445  14.025 1.00 . A A .   8 VAL CG2  1 1 
        4  7605 1 1   8 VAL H    H  10.370  -2.589  15.551 1.00 . A A .   8 VAL H    1 1 
        4  7606 1 1   8 VAL HA   H  11.833  -0.225  15.205 1.00 . A A .   8 VAL HA   1 1 
        4  7607 1 1   8 VAL HB   H  12.899  -2.385  15.607 1.00 . A A .   8 VAL HB   1 1 
        4  7608 1 1   8 VAL HG11 H  13.174  -4.014  13.778 1.00 . A A .   8 VAL HG11 1 1 
        4  7609 1 1   8 VAL HG12 H  12.045  -3.076  12.800 1.00 . A A .   8 VAL HG12 1 1 
        4  7610 1 1   8 VAL HG13 H  11.495  -3.844  14.290 1.00 . A A .   8 VAL HG13 1 1 
        4  7611 1 1   8 VAL HG21 H  14.224  -0.595  14.634 1.00 . A A .   8 VAL HG21 1 1 
        4  7612 1 1   8 VAL HG22 H  13.762  -1.117  13.012 1.00 . A A .   8 VAL HG22 1 1 
        4  7613 1 1   8 VAL HG23 H  14.753  -2.165  14.027 1.00 . A A .   8 VAL HG23 1 1 
        4  7614 1 1   8 VAL N    N  10.352  -1.650  15.281 1.00 . A A .   8 VAL N    1 1 
        4  7615 1 1   8 VAL O    O  10.527  -1.309  12.434 1.00 . A A .   8 VAL O    1 1 
        4  7616 1 1   9 CYS C    C  12.465   1.175  10.674 1.00 . A A .   9 CYS C    1 1 
        4  7617 1 1   9 CYS CA   C  11.275   1.232  11.626 1.00 . A A .   9 CYS CA   1 1 
        4  7618 1 1   9 CYS CB   C  10.856   2.680  11.869 1.00 . A A .   9 CYS CB   1 1 
        4  7619 1 1   9 CYS H    H  12.175   1.095  13.528 1.00 . A A .   9 CYS H    1 1 
        4  7620 1 1   9 CYS HA   H  10.449   0.690  11.191 1.00 . A A .   9 CYS HA   1 1 
        4  7621 1 1   9 CYS HB2  H  11.733   3.269  12.101 1.00 . A A .   9 CYS HB2  1 1 
        4  7622 1 1   9 CYS HB3  H  10.392   3.069  10.973 1.00 . A A .   9 CYS HB3  1 1 
        4  7623 1 1   9 CYS HG   H   9.719   1.769  13.967 1.00 . A A .   9 CYS HG   1 1 
        4  7624 1 1   9 CYS N    N  11.608   0.608  12.894 1.00 . A A .   9 CYS N    1 1 
        4  7625 1 1   9 CYS O    O  13.613   1.323  11.098 1.00 . A A .   9 CYS O    1 1 
        4  7626 1 1   9 CYS SG   S   9.680   2.876  13.231 1.00 . A A .   9 CYS SG   1 1 
        4  7627 1 1  10 GLU C    C  13.112   1.995   7.374 1.00 . A A .  10 GLU C    1 1 
        4  7628 1 1  10 GLU CA   C  13.241   0.870   8.392 1.00 . A A .  10 GLU CA   1 1 
        4  7629 1 1  10 GLU CB   C  13.182  -0.460   7.629 1.00 . A A .  10 GLU CB   1 1 
        4  7630 1 1  10 GLU CD   C  13.432  -2.962   7.667 1.00 . A A .  10 GLU CD   1 1 
        4  7631 1 1  10 GLU CG   C  13.266  -1.703   8.496 1.00 . A A .  10 GLU CG   1 1 
        4  7632 1 1  10 GLU H    H  11.252   0.842   9.116 1.00 . A A .  10 GLU H    1 1 
        4  7633 1 1  10 GLU HA   H  14.193   0.953   8.892 1.00 . A A .  10 GLU HA   1 1 
        4  7634 1 1  10 GLU HB2  H  12.252  -0.501   7.083 1.00 . A A .  10 GLU HB2  1 1 
        4  7635 1 1  10 GLU HB3  H  13.999  -0.487   6.923 1.00 . A A .  10 GLU HB3  1 1 
        4  7636 1 1  10 GLU HG2  H  14.112  -1.611   9.161 1.00 . A A .  10 GLU HG2  1 1 
        4  7637 1 1  10 GLU HG3  H  12.358  -1.786   9.074 1.00 . A A .  10 GLU HG3  1 1 
        4  7638 1 1  10 GLU N    N  12.191   0.951   9.396 1.00 . A A .  10 GLU N    1 1 
        4  7639 1 1  10 GLU O    O  12.027   2.544   7.160 1.00 . A A .  10 GLU O    1 1 
        4  7640 1 1  10 GLU OE1  O  12.597  -3.213   6.771 1.00 . A A .  10 GLU OE1  1 1 
        4  7641 1 1  10 GLU OE2  O  14.417  -3.699   7.887 1.00 . A A .  10 GLU OE2  1 1 
        4  7642 1 1  11 LEU C    C  14.028   2.245   4.370 1.00 . A A .  11 LEU C    1 1 
        4  7643 1 1  11 LEU CA   C  14.221   3.163   5.568 1.00 . A A .  11 LEU CA   1 1 
        4  7644 1 1  11 LEU CB   C  15.532   3.971   5.473 1.00 . A A .  11 LEU CB   1 1 
        4  7645 1 1  11 LEU CD1  C  15.989   4.253   2.995 1.00 . A A .  11 LEU CD1  1 1 
        4  7646 1 1  11 LEU CD2  C  14.404   5.803   4.143 1.00 . A A .  11 LEU CD2  1 1 
        4  7647 1 1  11 LEU CG   C  15.666   4.966   4.300 1.00 . A A .  11 LEU CG   1 1 
        4  7648 1 1  11 LEU H    H  15.086   2.002   7.098 1.00 . A A .  11 LEU H    1 1 
        4  7649 1 1  11 LEU HA   H  13.381   3.838   5.636 1.00 . A A .  11 LEU HA   1 1 
        4  7650 1 1  11 LEU HB2  H  15.640   4.529   6.390 1.00 . A A .  11 LEU HB2  1 1 
        4  7651 1 1  11 LEU HB3  H  16.350   3.270   5.407 1.00 . A A .  11 LEU HB3  1 1 
        4  7652 1 1  11 LEU HD11 H  15.216   3.530   2.783 1.00 . A A .  11 LEU HD11 1 1 
        4  7653 1 1  11 LEU HD12 H  16.940   3.750   3.085 1.00 . A A .  11 LEU HD12 1 1 
        4  7654 1 1  11 LEU HD13 H  16.035   4.975   2.194 1.00 . A A .  11 LEU HD13 1 1 
        4  7655 1 1  11 LEU HD21 H  13.562   5.153   3.962 1.00 . A A .  11 LEU HD21 1 1 
        4  7656 1 1  11 LEU HD22 H  14.524   6.478   3.306 1.00 . A A .  11 LEU HD22 1 1 
        4  7657 1 1  11 LEU HD23 H  14.233   6.374   5.043 1.00 . A A .  11 LEU HD23 1 1 
        4  7658 1 1  11 LEU HG   H  16.483   5.640   4.512 1.00 . A A .  11 LEU HG   1 1 
        4  7659 1 1  11 LEU N    N  14.230   2.330   6.753 1.00 . A A .  11 LEU N    1 1 
        4  7660 1 1  11 LEU O    O  14.863   1.380   4.097 1.00 . A A .  11 LEU O    1 1 
        4  7661 1 1  12 LYS C    C  12.394   2.396   1.323 1.00 . A A .  12 LYS C    1 1 
        4  7662 1 1  12 LYS CA   C  12.583   1.546   2.565 1.00 . A A .  12 LYS CA   1 1 
        4  7663 1 1  12 LYS CB   C  11.307   0.743   2.842 1.00 . A A .  12 LYS CB   1 1 
        4  7664 1 1  12 LYS CD   C  12.374  -1.433   3.521 1.00 . A A .  12 LYS CD   1 1 
        4  7665 1 1  12 LYS CE   C  12.469  -2.928   3.249 1.00 . A A .  12 LYS CE   1 1 
        4  7666 1 1  12 LYS CG   C  11.434  -0.744   2.542 1.00 . A A .  12 LYS CG   1 1 
        4  7667 1 1  12 LYS H    H  12.279   3.112   3.957 1.00 . A A .  12 LYS H    1 1 
        4  7668 1 1  12 LYS HA   H  13.407   0.866   2.406 1.00 . A A .  12 LYS HA   1 1 
        4  7669 1 1  12 LYS HB2  H  11.043   0.857   3.880 1.00 . A A .  12 LYS HB2  1 1 
        4  7670 1 1  12 LYS HB3  H  10.509   1.143   2.233 1.00 . A A .  12 LYS HB3  1 1 
        4  7671 1 1  12 LYS HD2  H  13.358  -0.997   3.427 1.00 . A A .  12 LYS HD2  1 1 
        4  7672 1 1  12 LYS HD3  H  12.007  -1.281   4.525 1.00 . A A .  12 LYS HD3  1 1 
        4  7673 1 1  12 LYS HE2  H  11.477  -3.352   3.286 1.00 . A A .  12 LYS HE2  1 1 
        4  7674 1 1  12 LYS HE3  H  12.886  -3.076   2.264 1.00 . A A .  12 LYS HE3  1 1 
        4  7675 1 1  12 LYS HG2  H  10.459  -1.203   2.614 1.00 . A A .  12 LYS HG2  1 1 
        4  7676 1 1  12 LYS HG3  H  11.819  -0.868   1.539 1.00 . A A .  12 LYS HG3  1 1 
        4  7677 1 1  12 LYS HZ1  H  13.370  -4.649   4.027 1.00 . A A .  12 LYS HZ1  1 1 
        4  7678 1 1  12 LYS HZ2  H  12.938  -3.505   5.210 1.00 . A A .  12 LYS HZ2  1 1 
        4  7679 1 1  12 LYS HZ3  H  14.291  -3.238   4.225 1.00 . A A .  12 LYS HZ3  1 1 
        4  7680 1 1  12 LYS N    N  12.905   2.397   3.696 1.00 . A A .  12 LYS N    1 1 
        4  7681 1 1  12 LYS NZ   N  13.327  -3.627   4.245 1.00 . A A .  12 LYS NZ   1 1 
        4  7682 1 1  12 LYS O    O  11.940   3.536   1.410 1.00 . A A .  12 LYS O    1 1 
        4  7683 1 1  13 GLU C    C  11.510   1.886  -1.925 1.00 . A A .  13 GLU C    1 1 
        4  7684 1 1  13 GLU CA   C  12.553   2.581  -1.066 1.00 . A A .  13 GLU CA   1 1 
        4  7685 1 1  13 GLU CB   C  13.868   2.752  -1.825 1.00 . A A .  13 GLU CB   1 1 
        4  7686 1 1  13 GLU CD   C  15.826   1.708  -2.988 1.00 . A A .  13 GLU CD   1 1 
        4  7687 1 1  13 GLU CG   C  14.537   1.455  -2.243 1.00 . A A .  13 GLU CG   1 1 
        4  7688 1 1  13 GLU H    H  13.146   0.961   0.152 1.00 . A A .  13 GLU H    1 1 
        4  7689 1 1  13 GLU HA   H  12.176   3.561  -0.809 1.00 . A A .  13 GLU HA   1 1 
        4  7690 1 1  13 GLU HB2  H  13.679   3.332  -2.715 1.00 . A A .  13 GLU HB2  1 1 
        4  7691 1 1  13 GLU HB3  H  14.557   3.298  -1.196 1.00 . A A .  13 GLU HB3  1 1 
        4  7692 1 1  13 GLU HG2  H  14.755   0.875  -1.358 1.00 . A A .  13 GLU HG2  1 1 
        4  7693 1 1  13 GLU HG3  H  13.864   0.903  -2.881 1.00 . A A .  13 GLU HG3  1 1 
        4  7694 1 1  13 GLU N    N  12.751   1.860   0.172 1.00 . A A .  13 GLU N    1 1 
        4  7695 1 1  13 GLU O    O  11.530   0.667  -2.094 1.00 . A A .  13 GLU O    1 1 
        4  7696 1 1  13 GLU OE1  O  15.801   2.464  -3.981 1.00 . A A .  13 GLU OE1  1 1 
        4  7697 1 1  13 GLU OE2  O  16.878   1.193  -2.559 1.00 . A A .  13 GLU OE2  1 1 
        4  7698 1 1  14 LEU C    C  10.042   1.842  -4.659 1.00 . A A .  14 LEU C    1 1 
        4  7699 1 1  14 LEU CA   C   9.514   2.150  -3.263 1.00 . A A .  14 LEU CA   1 1 
        4  7700 1 1  14 LEU CB   C   8.365   3.163  -3.338 1.00 . A A .  14 LEU CB   1 1 
        4  7701 1 1  14 LEU CD1  C   6.652   1.633  -4.366 1.00 . A A .  14 LEU CD1  1 1 
        4  7702 1 1  14 LEU CD2  C   6.796   1.855  -1.885 1.00 . A A .  14 LEU CD2  1 1 
        4  7703 1 1  14 LEU CG   C   6.955   2.576  -3.214 1.00 . A A .  14 LEU CG   1 1 
        4  7704 1 1  14 LEU H    H  10.619   3.638  -2.250 1.00 . A A .  14 LEU H    1 1 
        4  7705 1 1  14 LEU HA   H   9.157   1.238  -2.810 1.00 . A A .  14 LEU HA   1 1 
        4  7706 1 1  14 LEU HB2  H   8.502   3.886  -2.547 1.00 . A A .  14 LEU HB2  1 1 
        4  7707 1 1  14 LEU HB3  H   8.432   3.678  -4.285 1.00 . A A .  14 LEU HB3  1 1 
        4  7708 1 1  14 LEU HD11 H   6.720   2.174  -5.299 1.00 . A A .  14 LEU HD11 1 1 
        4  7709 1 1  14 LEU HD12 H   5.655   1.235  -4.252 1.00 . A A .  14 LEU HD12 1 1 
        4  7710 1 1  14 LEU HD13 H   7.367   0.824  -4.365 1.00 . A A .  14 LEU HD13 1 1 
        4  7711 1 1  14 LEU HD21 H   7.536   1.073  -1.808 1.00 . A A .  14 LEU HD21 1 1 
        4  7712 1 1  14 LEU HD22 H   5.808   1.424  -1.825 1.00 . A A .  14 LEU HD22 1 1 
        4  7713 1 1  14 LEU HD23 H   6.932   2.560  -1.077 1.00 . A A .  14 LEU HD23 1 1 
        4  7714 1 1  14 LEU HG   H   6.234   3.379  -3.246 1.00 . A A .  14 LEU HG   1 1 
        4  7715 1 1  14 LEU N    N  10.583   2.671  -2.436 1.00 . A A .  14 LEU N    1 1 
        4  7716 1 1  14 LEU O    O  10.634   2.701  -5.313 1.00 . A A .  14 LEU O    1 1 
        4  7717 1 1  15 ALA C    C   9.156   0.480  -7.426 1.00 . A A .  15 ALA C    1 1 
        4  7718 1 1  15 ALA CA   C  10.265   0.198  -6.422 1.00 . A A .  15 ALA CA   1 1 
        4  7719 1 1  15 ALA CB   C  10.623  -1.280  -6.422 1.00 . A A .  15 ALA CB   1 1 
        4  7720 1 1  15 ALA H    H   9.416  -0.038  -4.507 1.00 . A A .  15 ALA H    1 1 
        4  7721 1 1  15 ALA HA   H  11.143   0.764  -6.694 1.00 . A A .  15 ALA HA   1 1 
        4  7722 1 1  15 ALA HB1  H  10.945  -1.573  -7.411 1.00 . A A .  15 ALA HB1  1 1 
        4  7723 1 1  15 ALA HB2  H   9.758  -1.861  -6.137 1.00 . A A .  15 ALA HB2  1 1 
        4  7724 1 1  15 ALA HB3  H  11.422  -1.458  -5.717 1.00 . A A .  15 ALA HB3  1 1 
        4  7725 1 1  15 ALA N    N   9.852   0.611  -5.093 1.00 . A A .  15 ALA N    1 1 
        4  7726 1 1  15 ALA O    O   7.976   0.427  -7.077 1.00 . A A .  15 ALA O    1 1 
        4  7727 1 1  16 PRO C    C   7.834  -0.271 -10.126 1.00 . A A .  16 PRO C    1 1 
        4  7728 1 1  16 PRO CA   C   8.533   1.026  -9.741 1.00 . A A .  16 PRO CA   1 1 
        4  7729 1 1  16 PRO CB   C   9.366   1.565 -10.916 1.00 . A A .  16 PRO CB   1 1 
        4  7730 1 1  16 PRO CD   C  10.886   1.018  -9.151 1.00 . A A .  16 PRO CD   1 1 
        4  7731 1 1  16 PRO CG   C  10.692   1.928 -10.329 1.00 . A A .  16 PRO CG   1 1 
        4  7732 1 1  16 PRO HA   H   7.790   1.754  -9.454 1.00 . A A .  16 PRO HA   1 1 
        4  7733 1 1  16 PRO HB2  H   9.466   0.797 -11.668 1.00 . A A .  16 PRO HB2  1 1 
        4  7734 1 1  16 PRO HB3  H   8.875   2.428 -11.340 1.00 . A A .  16 PRO HB3  1 1 
        4  7735 1 1  16 PRO HD2  H  11.335   0.085  -9.463 1.00 . A A .  16 PRO HD2  1 1 
        4  7736 1 1  16 PRO HD3  H  11.490   1.498  -8.396 1.00 . A A .  16 PRO HD3  1 1 
        4  7737 1 1  16 PRO HG2  H  11.474   1.769 -11.057 1.00 . A A .  16 PRO HG2  1 1 
        4  7738 1 1  16 PRO HG3  H  10.681   2.957 -10.005 1.00 . A A .  16 PRO HG3  1 1 
        4  7739 1 1  16 PRO N    N   9.512   0.812  -8.675 1.00 . A A .  16 PRO N    1 1 
        4  7740 1 1  16 PRO O    O   8.389  -1.102 -10.845 1.00 . A A .  16 PRO O    1 1 
        4  7741 1 1  17 VAL C    C   4.563  -1.317 -10.561 1.00 . A A .  17 VAL C    1 1 
        4  7742 1 1  17 VAL CA   C   5.868  -1.662  -9.855 1.00 . A A .  17 VAL CA   1 1 
        4  7743 1 1  17 VAL CB   C   5.558  -2.385  -8.518 1.00 . A A .  17 VAL CB   1 1 
        4  7744 1 1  17 VAL CG1  C   4.785  -3.673  -8.743 1.00 . A A .  17 VAL CG1  1 1 
        4  7745 1 1  17 VAL CG2  C   6.839  -2.670  -7.747 1.00 . A A .  17 VAL CG2  1 1 
        4  7746 1 1  17 VAL H    H   6.238   0.250  -9.044 1.00 . A A .  17 VAL H    1 1 
        4  7747 1 1  17 VAL HA   H   6.455  -2.320 -10.479 1.00 . A A .  17 VAL HA   1 1 
        4  7748 1 1  17 VAL HB   H   4.946  -1.730  -7.915 1.00 . A A .  17 VAL HB   1 1 
        4  7749 1 1  17 VAL HG11 H   4.569  -4.133  -7.791 1.00 . A A .  17 VAL HG11 1 1 
        4  7750 1 1  17 VAL HG12 H   5.377  -4.347  -9.343 1.00 . A A .  17 VAL HG12 1 1 
        4  7751 1 1  17 VAL HG13 H   3.861  -3.451  -9.256 1.00 . A A .  17 VAL HG13 1 1 
        4  7752 1 1  17 VAL HG21 H   7.479  -3.312  -8.336 1.00 . A A .  17 VAL HG21 1 1 
        4  7753 1 1  17 VAL HG22 H   6.596  -3.159  -6.816 1.00 . A A .  17 VAL HG22 1 1 
        4  7754 1 1  17 VAL HG23 H   7.351  -1.741  -7.543 1.00 . A A .  17 VAL HG23 1 1 
        4  7755 1 1  17 VAL N    N   6.631  -0.452  -9.610 1.00 . A A .  17 VAL N    1 1 
        4  7756 1 1  17 VAL O    O   3.951  -0.288 -10.265 1.00 . A A .  17 VAL O    1 1 
        4  7757 1 1  18 PRO C    C   1.690  -2.387 -11.223 1.00 . A A .  18 PRO C    1 1 
        4  7758 1 1  18 PRO CA   C   2.828  -2.005 -12.164 1.00 . A A .  18 PRO CA   1 1 
        4  7759 1 1  18 PRO CB   C   2.889  -2.972 -13.359 1.00 . A A .  18 PRO CB   1 1 
        4  7760 1 1  18 PRO CD   C   4.883  -3.284 -12.073 1.00 . A A .  18 PRO CD   1 1 
        4  7761 1 1  18 PRO CG   C   4.318  -3.400 -13.458 1.00 . A A .  18 PRO CG   1 1 
        4  7762 1 1  18 PRO HA   H   2.677  -0.993 -12.520 1.00 . A A .  18 PRO HA   1 1 
        4  7763 1 1  18 PRO HB2  H   2.238  -3.813 -13.177 1.00 . A A .  18 PRO HB2  1 1 
        4  7764 1 1  18 PRO HB3  H   2.572  -2.456 -14.254 1.00 . A A .  18 PRO HB3  1 1 
        4  7765 1 1  18 PRO HD2  H   4.702  -4.189 -11.512 1.00 . A A .  18 PRO HD2  1 1 
        4  7766 1 1  18 PRO HD3  H   5.939  -3.063 -12.111 1.00 . A A .  18 PRO HD3  1 1 
        4  7767 1 1  18 PRO HG2  H   4.373  -4.422 -13.802 1.00 . A A .  18 PRO HG2  1 1 
        4  7768 1 1  18 PRO HG3  H   4.849  -2.746 -14.134 1.00 . A A .  18 PRO HG3  1 1 
        4  7769 1 1  18 PRO N    N   4.129  -2.155 -11.516 1.00 . A A .  18 PRO N    1 1 
        4  7770 1 1  18 PRO O    O   1.466  -3.568 -10.943 1.00 . A A .  18 PRO O    1 1 
        4  7771 1 1  19 ALA C    C  -1.405  -1.102 -10.337 1.00 . A A .  19 ALA C    1 1 
        4  7772 1 1  19 ALA CA   C  -0.087  -1.609  -9.773 1.00 . A A .  19 ALA CA   1 1 
        4  7773 1 1  19 ALA CB   C   0.223  -0.923  -8.452 1.00 . A A .  19 ALA CB   1 1 
        4  7774 1 1  19 ALA H    H   1.211  -0.463 -10.987 1.00 . A A .  19 ALA H    1 1 
        4  7775 1 1  19 ALA HA   H  -0.166  -2.672  -9.593 1.00 . A A .  19 ALA HA   1 1 
        4  7776 1 1  19 ALA HB1  H   1.162  -1.291  -8.070 1.00 . A A .  19 ALA HB1  1 1 
        4  7777 1 1  19 ALA HB2  H  -0.564  -1.133  -7.742 1.00 . A A .  19 ALA HB2  1 1 
        4  7778 1 1  19 ALA HB3  H   0.292   0.143  -8.609 1.00 . A A .  19 ALA HB3  1 1 
        4  7779 1 1  19 ALA N    N   0.994  -1.387 -10.714 1.00 . A A .  19 ALA N    1 1 
        4  7780 1 1  19 ALA O    O  -1.421  -0.182 -11.153 1.00 . A A .  19 ALA O    1 1 
        4  7781 1 1  20 LEU C    C  -4.730  -1.223  -9.103 1.00 . A A .  20 LEU C    1 1 
        4  7782 1 1  20 LEU CA   C  -3.830  -1.317 -10.327 1.00 . A A .  20 LEU CA   1 1 
        4  7783 1 1  20 LEU CB   C  -4.387  -2.323 -11.346 1.00 . A A .  20 LEU CB   1 1 
        4  7784 1 1  20 LEU CD1  C  -5.877  -2.565 -13.340 1.00 . A A .  20 LEU CD1  1 1 
        4  7785 1 1  20 LEU CD2  C  -6.882  -2.554 -11.070 1.00 . A A .  20 LEU CD2  1 1 
        4  7786 1 1  20 LEU CG   C  -5.763  -1.995 -11.938 1.00 . A A .  20 LEU CG   1 1 
        4  7787 1 1  20 LEU H    H  -2.403  -2.468  -9.280 1.00 . A A .  20 LEU H    1 1 
        4  7788 1 1  20 LEU HA   H  -3.761  -0.342 -10.788 1.00 . A A .  20 LEU HA   1 1 
        4  7789 1 1  20 LEU HB2  H  -3.681  -2.399 -12.161 1.00 . A A .  20 LEU HB2  1 1 
        4  7790 1 1  20 LEU HB3  H  -4.451  -3.287 -10.864 1.00 . A A .  20 LEU HB3  1 1 
        4  7791 1 1  20 LEU HD11 H  -6.834  -2.293 -13.760 1.00 . A A .  20 LEU HD11 1 1 
        4  7792 1 1  20 LEU HD12 H  -5.794  -3.642 -13.299 1.00 . A A .  20 LEU HD12 1 1 
        4  7793 1 1  20 LEU HD13 H  -5.087  -2.166 -13.958 1.00 . A A .  20 LEU HD13 1 1 
        4  7794 1 1  20 LEU HD21 H  -6.828  -2.112 -10.087 1.00 . A A .  20 LEU HD21 1 1 
        4  7795 1 1  20 LEU HD22 H  -6.773  -3.625 -10.989 1.00 . A A .  20 LEU HD22 1 1 
        4  7796 1 1  20 LEU HD23 H  -7.837  -2.321 -11.518 1.00 . A A .  20 LEU HD23 1 1 
        4  7797 1 1  20 LEU HG   H  -5.881  -0.923 -11.997 1.00 . A A .  20 LEU HG   1 1 
        4  7798 1 1  20 LEU N    N  -2.496  -1.714  -9.910 1.00 . A A .  20 LEU N    1 1 
        4  7799 1 1  20 LEU O    O  -4.636  -2.047  -8.186 1.00 . A A .  20 LEU O    1 1 
        4  7800 1 1  21 LEU C    C  -7.651   0.876  -8.290 1.00 . A A .  21 LEU C    1 1 
        4  7801 1 1  21 LEU CA   C  -6.457   0.003  -7.935 1.00 . A A .  21 LEU CA   1 1 
        4  7802 1 1  21 LEU CB   C  -5.694   0.600  -6.721 1.00 . A A .  21 LEU CB   1 1 
        4  7803 1 1  21 LEU CD1  C  -3.619   1.621  -7.800 1.00 . A A .  21 LEU CD1  1 1 
        4  7804 1 1  21 LEU CD2  C  -5.647   3.040  -7.479 1.00 . A A .  21 LEU CD2  1 1 
        4  7805 1 1  21 LEU CG   C  -4.834   1.880  -6.921 1.00 . A A .  21 LEU CG   1 1 
        4  7806 1 1  21 LEU H    H  -5.624   0.414  -9.839 1.00 . A A .  21 LEU H    1 1 
        4  7807 1 1  21 LEU HA   H  -6.835  -0.968  -7.649 1.00 . A A .  21 LEU HA   1 1 
        4  7808 1 1  21 LEU HB2  H  -6.424   0.820  -5.958 1.00 . A A .  21 LEU HB2  1 1 
        4  7809 1 1  21 LEU HB3  H  -5.042  -0.174  -6.339 1.00 . A A .  21 LEU HB3  1 1 
        4  7810 1 1  21 LEU HD11 H  -3.040   2.530  -7.891 1.00 . A A .  21 LEU HD11 1 1 
        4  7811 1 1  21 LEU HD12 H  -3.944   1.303  -8.779 1.00 . A A .  21 LEU HD12 1 1 
        4  7812 1 1  21 LEU HD13 H  -3.009   0.850  -7.354 1.00 . A A .  21 LEU HD13 1 1 
        4  7813 1 1  21 LEU HD21 H  -5.017   3.912  -7.567 1.00 . A A .  21 LEU HD21 1 1 
        4  7814 1 1  21 LEU HD22 H  -6.469   3.255  -6.813 1.00 . A A .  21 LEU HD22 1 1 
        4  7815 1 1  21 LEU HD23 H  -6.032   2.773  -8.451 1.00 . A A .  21 LEU HD23 1 1 
        4  7816 1 1  21 LEU HG   H  -4.462   2.187  -5.953 1.00 . A A .  21 LEU HG   1 1 
        4  7817 1 1  21 LEU N    N  -5.580  -0.207  -9.072 1.00 . A A .  21 LEU N    1 1 
        4  7818 1 1  21 LEU O    O  -7.700   1.491  -9.359 1.00 . A A .  21 LEU O    1 1 
        4  7819 1 1  22 ILE C    C  -9.363   3.010  -6.527 1.00 . A A .  22 ILE C    1 1 
        4  7820 1 1  22 ILE CA   C  -9.708   1.847  -7.436 1.00 . A A .  22 ILE CA   1 1 
        4  7821 1 1  22 ILE CB   C -11.042   1.230  -6.947 1.00 . A A .  22 ILE CB   1 1 
        4  7822 1 1  22 ILE CD1  C -11.574   0.212  -9.212 1.00 . A A .  22 ILE CD1  1 1 
        4  7823 1 1  22 ILE CG1  C -11.387  -0.030  -7.736 1.00 . A A .  22 ILE CG1  1 1 
        4  7824 1 1  22 ILE CG2  C -12.174   2.245  -7.045 1.00 . A A .  22 ILE CG2  1 1 
        4  7825 1 1  22 ILE H    H  -8.592   0.250  -6.653 1.00 . A A .  22 ILE H    1 1 
        4  7826 1 1  22 ILE HA   H  -9.826   2.196  -8.452 1.00 . A A .  22 ILE HA   1 1 
        4  7827 1 1  22 ILE HB   H -10.925   0.968  -5.905 1.00 . A A .  22 ILE HB   1 1 
        4  7828 1 1  22 ILE HD11 H -12.388   0.904  -9.363 1.00 . A A .  22 ILE HD11 1 1 
        4  7829 1 1  22 ILE HD12 H -11.797  -0.722  -9.703 1.00 . A A .  22 ILE HD12 1 1 
        4  7830 1 1  22 ILE HD13 H -10.666   0.629  -9.625 1.00 . A A .  22 ILE HD13 1 1 
        4  7831 1 1  22 ILE HG12 H -10.592  -0.750  -7.618 1.00 . A A .  22 ILE HG12 1 1 
        4  7832 1 1  22 ILE HG13 H -12.305  -0.448  -7.350 1.00 . A A .  22 ILE HG13 1 1 
        4  7833 1 1  22 ILE HG21 H -12.299   2.546  -8.075 1.00 . A A .  22 ILE HG21 1 1 
        4  7834 1 1  22 ILE HG22 H -11.935   3.108  -6.444 1.00 . A A .  22 ILE HG22 1 1 
        4  7835 1 1  22 ILE HG23 H -13.090   1.798  -6.685 1.00 . A A .  22 ILE HG23 1 1 
        4  7836 1 1  22 ILE N    N  -8.617   0.897  -7.385 1.00 . A A .  22 ILE N    1 1 
        4  7837 1 1  22 ILE O    O  -9.164   2.813  -5.325 1.00 . A A .  22 ILE O    1 1 
        4  7838 1 1  23 ARG C    C -10.289   5.807  -5.569 1.00 . A A .  23 ARG C    1 1 
        4  7839 1 1  23 ARG CA   C  -8.992   5.355  -6.228 1.00 . A A .  23 ARG CA   1 1 
        4  7840 1 1  23 ARG CB   C  -8.304   6.486  -7.004 1.00 . A A .  23 ARG CB   1 1 
        4  7841 1 1  23 ARG CD   C  -8.349   8.219  -8.796 1.00 . A A .  23 ARG CD   1 1 
        4  7842 1 1  23 ARG CG   C  -9.113   7.083  -8.143 1.00 . A A .  23 ARG CG   1 1 
        4  7843 1 1  23 ARG CZ   C  -8.815  10.194 -10.186 1.00 . A A .  23 ARG CZ   1 1 
        4  7844 1 1  23 ARG H    H  -9.398   4.324  -8.035 1.00 . A A .  23 ARG H    1 1 
        4  7845 1 1  23 ARG HA   H  -8.324   5.015  -5.447 1.00 . A A .  23 ARG HA   1 1 
        4  7846 1 1  23 ARG HB2  H  -8.068   7.280  -6.312 1.00 . A A .  23 ARG HB2  1 1 
        4  7847 1 1  23 ARG HB3  H  -7.381   6.103  -7.415 1.00 . A A .  23 ARG HB3  1 1 
        4  7848 1 1  23 ARG HD2  H  -7.964   8.866  -8.023 1.00 . A A .  23 ARG HD2  1 1 
        4  7849 1 1  23 ARG HD3  H  -7.524   7.802  -9.356 1.00 . A A .  23 ARG HD3  1 1 
        4  7850 1 1  23 ARG HE   H -10.063   8.648  -9.942 1.00 . A A .  23 ARG HE   1 1 
        4  7851 1 1  23 ARG HG2  H  -9.306   6.317  -8.880 1.00 . A A .  23 ARG HG2  1 1 
        4  7852 1 1  23 ARG HG3  H -10.047   7.461  -7.753 1.00 . A A .  23 ARG HG3  1 1 
        4  7853 1 1  23 ARG HH11 H  -6.994  10.182  -9.300 1.00 . A A .  23 ARG HH11 1 1 
        4  7854 1 1  23 ARG HH12 H  -7.329  11.580 -10.269 1.00 . A A .  23 ARG HH12 1 1 
        4  7855 1 1  23 ARG HH21 H -10.543  10.492 -11.201 1.00 . A A .  23 ARG HH21 1 1 
        4  7856 1 1  23 ARG HH22 H  -9.376  11.778 -11.327 1.00 . A A .  23 ARG HH22 1 1 
        4  7857 1 1  23 ARG N    N  -9.271   4.209  -7.069 1.00 . A A .  23 ARG N    1 1 
        4  7858 1 1  23 ARG NE   N  -9.179   9.010  -9.700 1.00 . A A .  23 ARG NE   1 1 
        4  7859 1 1  23 ARG NH1  N  -7.619  10.693  -9.891 1.00 . A A .  23 ARG NH1  1 1 
        4  7860 1 1  23 ARG NH2  N  -9.641  10.872 -10.970 1.00 . A A .  23 ARG NH2  1 1 
        4  7861 1 1  23 ARG O    O -11.148   6.438  -6.185 1.00 . A A .  23 ARG O    1 1 
        4  7862 1 1  24 THR C    C -11.534   6.682  -2.537 1.00 . A A .  24 THR C    1 1 
        4  7863 1 1  24 THR CA   C -11.671   5.595  -3.591 1.00 . A A .  24 THR CA   1 1 
        4  7864 1 1  24 THR CB   C -12.092   4.272  -2.923 1.00 . A A .  24 THR CB   1 1 
        4  7865 1 1  24 THR CG2  C -13.208   3.599  -3.698 1.00 . A A .  24 THR CG2  1 1 
        4  7866 1 1  24 THR H    H  -9.666   5.015  -3.853 1.00 . A A .  24 THR H    1 1 
        4  7867 1 1  24 THR HA   H -12.438   5.881  -4.294 1.00 . A A .  24 THR HA   1 1 
        4  7868 1 1  24 THR HB   H -12.445   4.487  -1.924 1.00 . A A .  24 THR HB   1 1 
        4  7869 1 1  24 THR HG1  H -10.417   3.486  -3.624 1.00 . A A .  24 THR HG1  1 1 
        4  7870 1 1  24 THR HG21 H -14.071   4.246  -3.720 1.00 . A A .  24 THR HG21 1 1 
        4  7871 1 1  24 THR HG22 H -13.467   2.668  -3.216 1.00 . A A .  24 THR HG22 1 1 
        4  7872 1 1  24 THR HG23 H -12.875   3.403  -4.706 1.00 . A A .  24 THR HG23 1 1 
        4  7873 1 1  24 THR N    N -10.434   5.418  -4.318 1.00 . A A .  24 THR N    1 1 
        4  7874 1 1  24 THR O    O -10.432   7.145  -2.253 1.00 . A A .  24 THR O    1 1 
        4  7875 1 1  24 THR OG1  O -10.967   3.383  -2.839 1.00 . A A .  24 THR OG1  1 1 
        4  7876 1 1  25 GLN C    C -13.668   7.698   0.143 1.00 . A A .  25 GLN C    1 1 
        4  7877 1 1  25 GLN CA   C -12.664   8.095  -0.927 1.00 . A A .  25 GLN CA   1 1 
        4  7878 1 1  25 GLN CB   C -12.992   9.475  -1.496 1.00 . A A .  25 GLN CB   1 1 
        4  7879 1 1  25 GLN CD   C -14.508  10.853  -2.982 1.00 . A A .  25 GLN CD   1 1 
        4  7880 1 1  25 GLN CG   C -14.267   9.507  -2.326 1.00 . A A .  25 GLN CG   1 1 
        4  7881 1 1  25 GLN H    H -13.512   6.722  -2.291 1.00 . A A .  25 GLN H    1 1 
        4  7882 1 1  25 GLN HA   H -11.678   8.119  -0.485 1.00 . A A .  25 GLN HA   1 1 
        4  7883 1 1  25 GLN HB2  H -13.101  10.169  -0.675 1.00 . A A .  25 GLN HB2  1 1 
        4  7884 1 1  25 GLN HB3  H -12.172   9.795  -2.120 1.00 . A A .  25 GLN HB3  1 1 
        4  7885 1 1  25 GLN HE21 H -15.424   9.974  -4.516 1.00 . A A .  25 GLN HE21 1 1 
        4  7886 1 1  25 GLN HE22 H -15.305  11.703  -4.595 1.00 . A A .  25 GLN HE22 1 1 
        4  7887 1 1  25 GLN HG2  H -14.200   8.755  -3.098 1.00 . A A .  25 GLN HG2  1 1 
        4  7888 1 1  25 GLN HG3  H -15.104   9.283  -1.680 1.00 . A A .  25 GLN HG3  1 1 
        4  7889 1 1  25 GLN N    N -12.655   7.100  -1.983 1.00 . A A .  25 GLN N    1 1 
        4  7890 1 1  25 GLN NE2  N -15.144  10.842  -4.145 1.00 . A A .  25 GLN NE2  1 1 
        4  7891 1 1  25 GLN O    O -14.702   7.099  -0.158 1.00 . A A .  25 GLN O    1 1 
        4  7892 1 1  25 GLN OE1  O -14.122  11.895  -2.452 1.00 . A A .  25 GLN OE1  1 1 
        4  7893 1 1  26 THR C    C -14.109   8.617   3.635 1.00 . A A .  26 THR C    1 1 
        4  7894 1 1  26 THR CA   C -14.189   7.601   2.499 1.00 . A A .  26 THR CA   1 1 
        4  7895 1 1  26 THR CB   C -13.766   6.190   2.989 1.00 . A A .  26 THR CB   1 1 
        4  7896 1 1  26 THR CG2  C -12.306   6.170   3.422 1.00 . A A .  26 THR CG2  1 1 
        4  7897 1 1  26 THR H    H -12.567   8.578   1.559 1.00 . A A .  26 THR H    1 1 
        4  7898 1 1  26 THR HA   H -15.212   7.545   2.151 1.00 . A A .  26 THR HA   1 1 
        4  7899 1 1  26 THR HB   H -13.883   5.500   2.167 1.00 . A A .  26 THR HB   1 1 
        4  7900 1 1  26 THR HG1  H -15.434   5.401   3.736 1.00 . A A .  26 THR HG1  1 1 
        4  7901 1 1  26 THR HG21 H -11.680   6.472   2.595 1.00 . A A .  26 THR HG21 1 1 
        4  7902 1 1  26 THR HG22 H -12.038   5.171   3.728 1.00 . A A .  26 THR HG22 1 1 
        4  7903 1 1  26 THR HG23 H -12.165   6.850   4.250 1.00 . A A .  26 THR HG23 1 1 
        4  7904 1 1  26 THR N    N -13.363   8.023   1.385 1.00 . A A .  26 THR N    1 1 
        4  7905 1 1  26 THR O    O -13.431   9.641   3.518 1.00 . A A .  26 THR O    1 1 
        4  7906 1 1  26 THR OG1  O -14.589   5.750   4.077 1.00 . A A .  26 THR OG1  1 1 
        4  7907 1 1  27 ALA C    C -13.705   8.894   6.833 1.00 . A A .  27 ALA C    1 1 
        4  7908 1 1  27 ALA CA   C -14.834   9.232   5.866 1.00 . A A .  27 ALA CA   1 1 
        4  7909 1 1  27 ALA CB   C -16.183   9.148   6.562 1.00 . A A .  27 ALA CB   1 1 
        4  7910 1 1  27 ALA H    H -15.307   7.493   4.762 1.00 . A A .  27 ALA H    1 1 
        4  7911 1 1  27 ALA HA   H -14.699  10.243   5.506 1.00 . A A .  27 ALA HA   1 1 
        4  7912 1 1  27 ALA HB1  H -16.333   8.145   6.938 1.00 . A A .  27 ALA HB1  1 1 
        4  7913 1 1  27 ALA HB2  H -16.966   9.390   5.861 1.00 . A A .  27 ALA HB2  1 1 
        4  7914 1 1  27 ALA HB3  H -16.206   9.848   7.385 1.00 . A A .  27 ALA HB3  1 1 
        4  7915 1 1  27 ALA N    N -14.809   8.339   4.722 1.00 . A A .  27 ALA N    1 1 
        4  7916 1 1  27 ALA O    O -12.864   8.038   6.545 1.00 . A A .  27 ALA O    1 1 
        4  7917 1 1  28 MET C    C -12.940   8.004   9.695 1.00 . A A .  28 MET C    1 1 
        4  7918 1 1  28 MET CA   C -12.654   9.317   8.975 1.00 . A A .  28 MET CA   1 1 
        4  7919 1 1  28 MET CB   C -12.578  10.483   9.966 1.00 . A A .  28 MET CB   1 1 
        4  7920 1 1  28 MET CE   C -12.879  12.102  12.650 1.00 . A A .  28 MET CE   1 1 
        4  7921 1 1  28 MET CG   C -11.496  10.325  11.025 1.00 . A A .  28 MET CG   1 1 
        4  7922 1 1  28 MET H    H -14.388  10.221   8.164 1.00 . A A .  28 MET H    1 1 
        4  7923 1 1  28 MET HA   H -11.710   9.230   8.458 1.00 . A A .  28 MET HA   1 1 
        4  7924 1 1  28 MET HB2  H -12.382  11.392   9.416 1.00 . A A .  28 MET HB2  1 1 
        4  7925 1 1  28 MET HB3  H -13.531  10.578  10.467 1.00 . A A .  28 MET HB3  1 1 
        4  7926 1 1  28 MET HE1  H -13.575  12.249  11.839 1.00 . A A .  28 MET HE1  1 1 
        4  7927 1 1  28 MET HE2  H -12.871  12.979  13.283 1.00 . A A .  28 MET HE2  1 1 
        4  7928 1 1  28 MET HE3  H -13.177  11.242  13.230 1.00 . A A .  28 MET HE3  1 1 
        4  7929 1 1  28 MET HG2  H -11.785   9.533  11.699 1.00 . A A .  28 MET HG2  1 1 
        4  7930 1 1  28 MET HG3  H -10.571  10.063  10.537 1.00 . A A .  28 MET HG3  1 1 
        4  7931 1 1  28 MET N    N -13.683   9.562   7.978 1.00 . A A .  28 MET N    1 1 
        4  7932 1 1  28 MET O    O -13.784   7.948  10.587 1.00 . A A .  28 MET O    1 1 
        4  7933 1 1  28 MET SD   S -11.236  11.830  11.986 1.00 . A A .  28 MET SD   1 1 
        4  7934 1 1  29 SER C    C -13.775   5.031   9.272 1.00 . A A .  29 SER C    1 1 
        4  7935 1 1  29 SER CA   C -12.441   5.597   9.768 1.00 . A A .  29 SER CA   1 1 
        4  7936 1 1  29 SER CB   C -12.354   5.546  11.300 1.00 . A A .  29 SER CB   1 1 
        4  7937 1 1  29 SER H    H -11.576   7.097   8.561 1.00 . A A .  29 SER H    1 1 
        4  7938 1 1  29 SER HA   H -11.648   4.989   9.359 1.00 . A A .  29 SER HA   1 1 
        4  7939 1 1  29 SER HB2  H -11.452   6.047  11.624 1.00 . A A .  29 SER HB2  1 1 
        4  7940 1 1  29 SER HB3  H -13.213   6.045  11.724 1.00 . A A .  29 SER HB3  1 1 
        4  7941 1 1  29 SER HG   H -12.103   4.206  12.711 1.00 . A A .  29 SER HG   1 1 
        4  7942 1 1  29 SER N    N -12.244   6.953   9.262 1.00 . A A .  29 SER N    1 1 
        4  7943 1 1  29 SER O    O -14.767   4.980  10.003 1.00 . A A .  29 SER O    1 1 
        4  7944 1 1  29 SER OG   O -12.322   4.208  11.770 1.00 . A A .  29 SER OG   1 1 
        4  7945 1 1  30 GLU C    C -14.508   3.065   6.293 1.00 . A A .  30 GLU C    1 1 
        4  7946 1 1  30 GLU CA   C -14.968   4.031   7.385 1.00 . A A .  30 GLU CA   1 1 
        4  7947 1 1  30 GLU CB   C -15.906   5.110   6.813 1.00 . A A .  30 GLU CB   1 1 
        4  7948 1 1  30 GLU CD   C -17.377   4.124   4.972 1.00 . A A .  30 GLU CD   1 1 
        4  7949 1 1  30 GLU CG   C -17.296   4.620   6.407 1.00 . A A .  30 GLU CG   1 1 
        4  7950 1 1  30 GLU H    H -13.025   4.858   7.435 1.00 . A A .  30 GLU H    1 1 
        4  7951 1 1  30 GLU HA   H -15.486   3.476   8.152 1.00 . A A .  30 GLU HA   1 1 
        4  7952 1 1  30 GLU HB2  H -16.031   5.883   7.556 1.00 . A A .  30 GLU HB2  1 1 
        4  7953 1 1  30 GLU HB3  H -15.437   5.543   5.941 1.00 . A A .  30 GLU HB3  1 1 
        4  7954 1 1  30 GLU HG2  H -17.578   3.809   7.062 1.00 . A A .  30 GLU HG2  1 1 
        4  7955 1 1  30 GLU HG3  H -17.996   5.434   6.529 1.00 . A A .  30 GLU HG3  1 1 
        4  7956 1 1  30 GLU N    N -13.801   4.667   7.994 1.00 . A A .  30 GLU N    1 1 
        4  7957 1 1  30 GLU O    O -15.288   2.284   5.760 1.00 . A A .  30 GLU O    1 1 
        4  7958 1 1  30 GLU OE1  O -17.057   4.904   4.046 1.00 . A A .  30 GLU OE1  1 1 
        4  7959 1 1  30 GLU OE2  O -17.770   2.958   4.760 1.00 . A A .  30 GLU OE2  1 1 
        4  7960 1 1  31 LEU C    C -12.874   0.826   5.008 1.00 . A A .  31 LEU C    1 1 
        4  7961 1 1  31 LEU CA   C -12.628   2.334   4.906 1.00 . A A .  31 LEU CA   1 1 
        4  7962 1 1  31 LEU CB   C -11.125   2.639   4.790 1.00 . A A .  31 LEU CB   1 1 
        4  7963 1 1  31 LEU CD1  C -10.058   1.162   6.543 1.00 . A A .  31 LEU CD1  1 1 
        4  7964 1 1  31 LEU CD2  C  -9.005   3.343   5.929 1.00 . A A .  31 LEU CD2  1 1 
        4  7965 1 1  31 LEU CG   C -10.318   2.594   6.095 1.00 . A A .  31 LEU CG   1 1 
        4  7966 1 1  31 LEU H    H -12.612   3.610   6.585 1.00 . A A .  31 LEU H    1 1 
        4  7967 1 1  31 LEU HA   H -13.111   2.688   4.008 1.00 . A A .  31 LEU HA   1 1 
        4  7968 1 1  31 LEU HB2  H -10.692   1.925   4.106 1.00 . A A .  31 LEU HB2  1 1 
        4  7969 1 1  31 LEU HB3  H -11.015   3.625   4.362 1.00 . A A .  31 LEU HB3  1 1 
        4  7970 1 1  31 LEU HD11 H  -9.518   1.169   7.477 1.00 . A A .  31 LEU HD11 1 1 
        4  7971 1 1  31 LEU HD12 H  -9.473   0.651   5.792 1.00 . A A .  31 LEU HD12 1 1 
        4  7972 1 1  31 LEU HD13 H -11.000   0.650   6.676 1.00 . A A .  31 LEU HD13 1 1 
        4  7973 1 1  31 LEU HD21 H  -9.208   4.369   5.657 1.00 . A A .  31 LEU HD21 1 1 
        4  7974 1 1  31 LEU HD22 H  -8.418   2.874   5.154 1.00 . A A .  31 LEU HD22 1 1 
        4  7975 1 1  31 LEU HD23 H  -8.458   3.319   6.860 1.00 . A A .  31 LEU HD23 1 1 
        4  7976 1 1  31 LEU HG   H -10.883   3.085   6.874 1.00 . A A .  31 LEU HG   1 1 
        4  7977 1 1  31 LEU N    N -13.205   3.082   6.021 1.00 . A A .  31 LEU N    1 1 
        4  7978 1 1  31 LEU O    O -12.738   0.112   4.018 1.00 . A A .  31 LEU O    1 1 
        4  7979 1 1  32 GLY C    C -14.548  -1.605   5.421 1.00 . A A .  32 GLY C    1 1 
        4  7980 1 1  32 GLY CA   C -13.500  -1.070   6.382 1.00 . A A .  32 GLY CA   1 1 
        4  7981 1 1  32 GLY H    H -13.364   0.968   6.942 1.00 . A A .  32 GLY H    1 1 
        4  7982 1 1  32 GLY HA2  H -12.579  -1.612   6.231 1.00 . A A .  32 GLY HA2  1 1 
        4  7983 1 1  32 GLY HA3  H -13.840  -1.232   7.395 1.00 . A A .  32 GLY HA3  1 1 
        4  7984 1 1  32 GLY N    N -13.248   0.350   6.193 1.00 . A A .  32 GLY N    1 1 
        4  7985 1 1  32 GLY O    O -14.368  -2.660   4.814 1.00 . A A .  32 GLY O    1 1 
        4  7986 1 1  33 SER C    C -16.321  -0.997   2.907 1.00 . A A .  33 SER C    1 1 
        4  7987 1 1  33 SER CA   C -16.705  -1.256   4.364 1.00 . A A .  33 SER CA   1 1 
        4  7988 1 1  33 SER CB   C -17.977  -0.489   4.729 1.00 . A A .  33 SER CB   1 1 
        4  7989 1 1  33 SER H    H -15.724  -0.026   5.773 1.00 . A A .  33 SER H    1 1 
        4  7990 1 1  33 SER HA   H -16.882  -2.312   4.497 1.00 . A A .  33 SER HA   1 1 
        4  7991 1 1  33 SER HB2  H -18.389  -0.032   3.841 1.00 . A A .  33 SER HB2  1 1 
        4  7992 1 1  33 SER HB3  H -18.699  -1.172   5.152 1.00 . A A .  33 SER HB3  1 1 
        4  7993 1 1  33 SER HG   H -17.703   1.405   5.241 1.00 . A A .  33 SER HG   1 1 
        4  7994 1 1  33 SER N    N -15.634  -0.863   5.265 1.00 . A A .  33 SER N    1 1 
        4  7995 1 1  33 SER O    O -16.725  -1.731   2.001 1.00 . A A .  33 SER O    1 1 
        4  7996 1 1  33 SER OG   O -17.694   0.528   5.683 1.00 . A A .  33 SER OG   1 1 
        4  7997 1 1  34 LEU C    C -14.142  -0.514   0.718 1.00 . A A .  34 LEU C    1 1 
        4  7998 1 1  34 LEU CA   C -15.135   0.460   1.356 1.00 . A A .  34 LEU CA   1 1 
        4  7999 1 1  34 LEU CB   C -14.544   1.869   1.410 1.00 . A A .  34 LEU CB   1 1 
        4  8000 1 1  34 LEU CD1  C -15.585   2.637  -0.744 1.00 . A A .  34 LEU CD1  1 1 
        4  8001 1 1  34 LEU CD2  C -13.671   3.900   0.241 1.00 . A A .  34 LEU CD2  1 1 
        4  8002 1 1  34 LEU CG   C -14.291   2.528   0.051 1.00 . A A .  34 LEU CG   1 1 
        4  8003 1 1  34 LEU H    H -15.163   0.524   3.467 1.00 . A A .  34 LEU H    1 1 
        4  8004 1 1  34 LEU HA   H -16.031   0.481   0.754 1.00 . A A .  34 LEU HA   1 1 
        4  8005 1 1  34 LEU HB2  H -15.220   2.497   1.971 1.00 . A A .  34 LEU HB2  1 1 
        4  8006 1 1  34 LEU HB3  H -13.603   1.821   1.939 1.00 . A A .  34 LEU HB3  1 1 
        4  8007 1 1  34 LEU HD11 H -15.385   3.112  -1.693 1.00 . A A .  34 LEU HD11 1 1 
        4  8008 1 1  34 LEU HD12 H -16.301   3.226  -0.189 1.00 . A A .  34 LEU HD12 1 1 
        4  8009 1 1  34 LEU HD13 H -15.987   1.649  -0.914 1.00 . A A .  34 LEU HD13 1 1 
        4  8010 1 1  34 LEU HD21 H -13.504   4.357  -0.725 1.00 . A A .  34 LEU HD21 1 1 
        4  8011 1 1  34 LEU HD22 H -12.728   3.800   0.759 1.00 . A A .  34 LEU HD22 1 1 
        4  8012 1 1  34 LEU HD23 H -14.337   4.520   0.822 1.00 . A A .  34 LEU HD23 1 1 
        4  8013 1 1  34 LEU HG   H -13.599   1.921  -0.514 1.00 . A A .  34 LEU HG   1 1 
        4  8014 1 1  34 LEU N    N -15.513   0.033   2.697 1.00 . A A .  34 LEU N    1 1 
        4  8015 1 1  34 LEU O    O -14.211  -0.779  -0.483 1.00 . A A .  34 LEU O    1 1 
        4  8016 1 1  35 PHE C    C -12.890  -3.245   0.444 1.00 . A A .  35 PHE C    1 1 
        4  8017 1 1  35 PHE CA   C -12.231  -1.998   1.026 1.00 . A A .  35 PHE CA   1 1 
        4  8018 1 1  35 PHE CB   C -11.258  -2.389   2.140 1.00 . A A .  35 PHE CB   1 1 
        4  8019 1 1  35 PHE CD1  C -10.169  -0.139   2.431 1.00 . A A .  35 PHE CD1  1 1 
        4  8020 1 1  35 PHE CD2  C  -8.776  -2.042   2.087 1.00 . A A .  35 PHE CD2  1 1 
        4  8021 1 1  35 PHE CE1  C  -9.053   0.671   2.502 1.00 . A A .  35 PHE CE1  1 1 
        4  8022 1 1  35 PHE CE2  C  -7.654  -1.237   2.157 1.00 . A A .  35 PHE CE2  1 1 
        4  8023 1 1  35 PHE CG   C -10.045  -1.503   2.224 1.00 . A A .  35 PHE CG   1 1 
        4  8024 1 1  35 PHE CZ   C  -7.794   0.122   2.366 1.00 . A A .  35 PHE CZ   1 1 
        4  8025 1 1  35 PHE H    H -13.213  -0.793   2.473 1.00 . A A .  35 PHE H    1 1 
        4  8026 1 1  35 PHE HA   H -11.676  -1.507   0.241 1.00 . A A .  35 PHE HA   1 1 
        4  8027 1 1  35 PHE HB2  H -11.772  -2.337   3.089 1.00 . A A .  35 PHE HB2  1 1 
        4  8028 1 1  35 PHE HB3  H -10.922  -3.402   1.975 1.00 . A A .  35 PHE HB3  1 1 
        4  8029 1 1  35 PHE HD1  H -11.153   0.292   2.538 1.00 . A A .  35 PHE HD1  1 1 
        4  8030 1 1  35 PHE HD2  H  -8.666  -3.103   1.925 1.00 . A A .  35 PHE HD2  1 1 
        4  8031 1 1  35 PHE HE1  H  -9.165   1.732   2.664 1.00 . A A .  35 PHE HE1  1 1 
        4  8032 1 1  35 PHE HE2  H  -6.671  -1.668   2.049 1.00 . A A .  35 PHE HE2  1 1 
        4  8033 1 1  35 PHE HZ   H  -6.919   0.753   2.421 1.00 . A A .  35 PHE HZ   1 1 
        4  8034 1 1  35 PHE N    N -13.226  -1.048   1.522 1.00 . A A .  35 PHE N    1 1 
        4  8035 1 1  35 PHE O    O -12.455  -3.764  -0.583 1.00 . A A .  35 PHE O    1 1 
        4  8036 1 1  36 GLU C    C -15.287  -4.578  -0.759 1.00 . A A .  36 GLU C    1 1 
        4  8037 1 1  36 GLU CA   C -14.687  -4.872   0.616 1.00 . A A .  36 GLU CA   1 1 
        4  8038 1 1  36 GLU CB   C -15.778  -5.245   1.633 1.00 . A A .  36 GLU CB   1 1 
        4  8039 1 1  36 GLU CD   C -17.884  -6.059   0.483 1.00 . A A .  36 GLU CD   1 1 
        4  8040 1 1  36 GLU CG   C -16.634  -6.446   1.249 1.00 . A A .  36 GLU CG   1 1 
        4  8041 1 1  36 GLU H    H -14.236  -3.263   1.920 1.00 . A A .  36 GLU H    1 1 
        4  8042 1 1  36 GLU HA   H -13.991  -5.694   0.525 1.00 . A A .  36 GLU HA   1 1 
        4  8043 1 1  36 GLU HB2  H -15.306  -5.463   2.580 1.00 . A A .  36 GLU HB2  1 1 
        4  8044 1 1  36 GLU HB3  H -16.431  -4.395   1.762 1.00 . A A .  36 GLU HB3  1 1 
        4  8045 1 1  36 GLU HG2  H -16.045  -7.110   0.632 1.00 . A A .  36 GLU HG2  1 1 
        4  8046 1 1  36 GLU HG3  H -16.927  -6.963   2.151 1.00 . A A .  36 GLU HG3  1 1 
        4  8047 1 1  36 GLU N    N -13.947  -3.710   1.096 1.00 . A A .  36 GLU N    1 1 
        4  8048 1 1  36 GLU O    O -15.201  -5.396  -1.682 1.00 . A A .  36 GLU O    1 1 
        4  8049 1 1  36 GLU OE1  O -18.884  -5.678   1.128 1.00 . A A .  36 GLU OE1  1 1 
        4  8050 1 1  36 GLU OE2  O -17.877  -6.134  -0.761 1.00 . A A .  36 GLU OE2  1 1 
        4  8051 1 1  37 ALA C    C -15.406  -2.829  -3.232 1.00 . A A .  37 ALA C    1 1 
        4  8052 1 1  37 ALA CA   C -16.466  -2.961  -2.143 1.00 . A A .  37 ALA CA   1 1 
        4  8053 1 1  37 ALA CB   C -17.195  -1.639  -1.950 1.00 . A A .  37 ALA CB   1 1 
        4  8054 1 1  37 ALA H    H -15.891  -2.786  -0.118 1.00 . A A .  37 ALA H    1 1 
        4  8055 1 1  37 ALA HA   H -17.189  -3.706  -2.444 1.00 . A A .  37 ALA HA   1 1 
        4  8056 1 1  37 ALA HB1  H -17.956  -1.757  -1.194 1.00 . A A .  37 ALA HB1  1 1 
        4  8057 1 1  37 ALA HB2  H -17.655  -1.342  -2.881 1.00 . A A .  37 ALA HB2  1 1 
        4  8058 1 1  37 ALA HB3  H -16.491  -0.883  -1.638 1.00 . A A .  37 ALA HB3  1 1 
        4  8059 1 1  37 ALA N    N -15.868  -3.392  -0.890 1.00 . A A .  37 ALA N    1 1 
        4  8060 1 1  37 ALA O    O -15.615  -3.255  -4.365 1.00 . A A .  37 ALA O    1 1 
        4  8061 1 1  38 GLY C    C -12.635  -3.361  -4.361 1.00 . A A .  38 GLY C    1 1 
        4  8062 1 1  38 GLY CA   C -13.186  -2.055  -3.821 1.00 . A A .  38 GLY CA   1 1 
        4  8063 1 1  38 GLY H    H -14.158  -1.948  -1.941 1.00 . A A .  38 GLY H    1 1 
        4  8064 1 1  38 GLY HA2  H -13.555  -1.465  -4.647 1.00 . A A .  38 GLY HA2  1 1 
        4  8065 1 1  38 GLY HA3  H -12.388  -1.514  -3.334 1.00 . A A .  38 GLY HA3  1 1 
        4  8066 1 1  38 GLY N    N -14.266  -2.252  -2.870 1.00 . A A .  38 GLY N    1 1 
        4  8067 1 1  38 GLY O    O -12.306  -3.457  -5.543 1.00 . A A .  38 GLY O    1 1 
        4  8068 1 1  39 TYR C    C -12.968  -6.309  -4.936 1.00 . A A .  39 TYR C    1 1 
        4  8069 1 1  39 TYR CA   C -12.037  -5.677  -3.901 1.00 . A A .  39 TYR CA   1 1 
        4  8070 1 1  39 TYR CB   C -11.900  -6.590  -2.678 1.00 . A A .  39 TYR CB   1 1 
        4  8071 1 1  39 TYR CD1  C  -9.801  -7.946  -3.035 1.00 . A A .  39 TYR CD1  1 1 
        4  8072 1 1  39 TYR CD2  C -11.898  -9.075  -3.136 1.00 . A A .  39 TYR CD2  1 1 
        4  8073 1 1  39 TYR CE1  C  -9.142  -9.136  -3.282 1.00 . A A .  39 TYR CE1  1 1 
        4  8074 1 1  39 TYR CE2  C -11.247 -10.269  -3.383 1.00 . A A .  39 TYR CE2  1 1 
        4  8075 1 1  39 TYR CG   C -11.187  -7.895  -2.958 1.00 . A A .  39 TYR CG   1 1 
        4  8076 1 1  39 TYR CZ   C  -9.869 -10.294  -3.457 1.00 . A A .  39 TYR CZ   1 1 
        4  8077 1 1  39 TYR H    H -12.807  -4.223  -2.564 1.00 . A A .  39 TYR H    1 1 
        4  8078 1 1  39 TYR HA   H -11.064  -5.538  -4.348 1.00 . A A .  39 TYR HA   1 1 
        4  8079 1 1  39 TYR HB2  H -11.346  -6.071  -1.912 1.00 . A A .  39 TYR HB2  1 1 
        4  8080 1 1  39 TYR HB3  H -12.886  -6.825  -2.304 1.00 . A A .  39 TYR HB3  1 1 
        4  8081 1 1  39 TYR HD1  H  -9.233  -7.038  -2.900 1.00 . A A .  39 TYR HD1  1 1 
        4  8082 1 1  39 TYR HD2  H -12.976  -9.051  -3.080 1.00 . A A .  39 TYR HD2  1 1 
        4  8083 1 1  39 TYR HE1  H  -8.064  -9.154  -3.338 1.00 . A A .  39 TYR HE1  1 1 
        4  8084 1 1  39 TYR HE2  H -11.817 -11.175  -3.520 1.00 . A A .  39 TYR HE2  1 1 
        4  8085 1 1  39 TYR HH   H  -9.651 -11.948  -4.418 1.00 . A A .  39 TYR HH   1 1 
        4  8086 1 1  39 TYR N    N -12.540  -4.367  -3.498 1.00 . A A .  39 TYR N    1 1 
        4  8087 1 1  39 TYR O    O -12.519  -6.892  -5.921 1.00 . A A .  39 TYR O    1 1 
        4  8088 1 1  39 TYR OH   O  -9.213 -11.480  -3.702 1.00 . A A .  39 TYR OH   1 1 
        4  8089 1 1  40 HIS C    C -15.348  -5.869  -6.903 1.00 . A A .  40 HIS C    1 1 
        4  8090 1 1  40 HIS CA   C -15.269  -6.713  -5.631 1.00 . A A .  40 HIS CA   1 1 
        4  8091 1 1  40 HIS CB   C -16.644  -6.795  -4.959 1.00 . A A .  40 HIS CB   1 1 
        4  8092 1 1  40 HIS CD2  C -16.710  -9.285  -4.248 1.00 . A A .  40 HIS CD2  1 1 
        4  8093 1 1  40 HIS CE1  C -17.075  -9.012  -2.107 1.00 . A A .  40 HIS CE1  1 1 
        4  8094 1 1  40 HIS CG   C -16.776  -7.953  -4.016 1.00 . A A .  40 HIS CG   1 1 
        4  8095 1 1  40 HIS H    H -14.567  -5.733  -3.887 1.00 . A A .  40 HIS H    1 1 
        4  8096 1 1  40 HIS HA   H -14.961  -7.710  -5.907 1.00 . A A .  40 HIS HA   1 1 
        4  8097 1 1  40 HIS HB2  H -16.819  -5.887  -4.400 1.00 . A A .  40 HIS HB2  1 1 
        4  8098 1 1  40 HIS HB3  H -17.405  -6.896  -5.718 1.00 . A A .  40 HIS HB3  1 1 
        4  8099 1 1  40 HIS HD1  H -17.124  -6.961  -2.172 1.00 . A A .  40 HIS HD1  1 1 
        4  8100 1 1  40 HIS HD2  H -16.544  -9.760  -5.204 1.00 . A A .  40 HIS HD2  1 1 
        4  8101 1 1  40 HIS HE1  H -17.254  -9.213  -1.060 1.00 . A A .  40 HIS HE1  1 1 
        4  8102 1 1  40 HIS HE2  H -16.766 -10.885  -2.880 1.00 . A A .  40 HIS HE2  1 1 
        4  8103 1 1  40 HIS N    N -14.270  -6.191  -4.703 1.00 . A A .  40 HIS N    1 1 
        4  8104 1 1  40 HIS ND1  N -17.008  -7.816  -2.662 1.00 . A A .  40 HIS ND1  1 1 
        4  8105 1 1  40 HIS NE2  N -16.898  -9.918  -3.047 1.00 . A A .  40 HIS NE2  1 1 
        4  8106 1 1  40 HIS O    O -15.648  -6.378  -7.981 1.00 . A A .  40 HIS O    1 1 
        4  8107 1 1  41 ASP C    C -14.317  -3.964  -9.047 1.00 . A A .  41 ASP C    1 1 
        4  8108 1 1  41 ASP CA   C -15.223  -3.620  -7.863 1.00 . A A .  41 ASP CA   1 1 
        4  8109 1 1  41 ASP CB   C -14.914  -2.206  -7.362 1.00 . A A .  41 ASP CB   1 1 
        4  8110 1 1  41 ASP CG   C -15.485  -1.128  -8.260 1.00 . A A .  41 ASP CG   1 1 
        4  8111 1 1  41 ASP H    H -14.772  -4.250  -5.890 1.00 . A A .  41 ASP H    1 1 
        4  8112 1 1  41 ASP HA   H -16.251  -3.655  -8.192 1.00 . A A .  41 ASP HA   1 1 
        4  8113 1 1  41 ASP HB2  H -15.333  -2.082  -6.376 1.00 . A A .  41 ASP HB2  1 1 
        4  8114 1 1  41 ASP HB3  H -13.842  -2.079  -7.313 1.00 . A A .  41 ASP HB3  1 1 
        4  8115 1 1  41 ASP N    N -15.075  -4.578  -6.764 1.00 . A A .  41 ASP N    1 1 
        4  8116 1 1  41 ASP O    O -14.703  -3.794 -10.203 1.00 . A A .  41 ASP O    1 1 
        4  8117 1 1  41 ASP OD1  O -16.650  -0.731  -8.044 1.00 . A A .  41 ASP OD1  1 1 
        4  8118 1 1  41 ASP OD2  O -14.775  -0.658  -9.170 1.00 . A A .  41 ASP OD2  1 1 
        4  8119 1 1  42 ILE C    C -12.355  -6.162 -10.414 1.00 . A A .  42 ILE C    1 1 
        4  8120 1 1  42 ILE CA   C -12.144  -4.775  -9.805 1.00 . A A .  42 ILE CA   1 1 
        4  8121 1 1  42 ILE CB   C -10.697  -4.681  -9.272 1.00 . A A .  42 ILE CB   1 1 
        4  8122 1 1  42 ILE CD1  C  -9.079  -5.656  -7.552 1.00 . A A .  42 ILE CD1  1 1 
        4  8123 1 1  42 ILE CG1  C -10.494  -5.636  -8.092 1.00 . A A .  42 ILE CG1  1 1 
        4  8124 1 1  42 ILE CG2  C -10.371  -3.251  -8.871 1.00 . A A .  42 ILE CG2  1 1 
        4  8125 1 1  42 ILE H    H -12.896  -4.652  -7.820 1.00 . A A .  42 ILE H    1 1 
        4  8126 1 1  42 ILE HA   H -12.262  -4.036 -10.584 1.00 . A A .  42 ILE HA   1 1 
        4  8127 1 1  42 ILE HB   H -10.025  -4.962 -10.071 1.00 . A A .  42 ILE HB   1 1 
        4  8128 1 1  42 ILE HD11 H  -8.403  -5.980  -8.330 1.00 . A A .  42 ILE HD11 1 1 
        4  8129 1 1  42 ILE HD12 H  -9.022  -6.340  -6.717 1.00 . A A .  42 ILE HD12 1 1 
        4  8130 1 1  42 ILE HD13 H  -8.804  -4.665  -7.2